1CYUA

Solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a human cystatin A variant, cystatin A2-98 M65L, by NMR spectroscopy. A possible role of the interactions between the N- and C-termini to maintain the inhibitory active form of cystatin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteinase inhibitor (cysteine)
molecule keywords CYSTATIN A
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cyuA00
3GAXA 1RN7A 1M9GA 1N9JA 1IV7A 1KWIA 3SVAA 4ZM8A 2CH9A 5ELJA 2W9QA 4N6OB 4IT7A 4EYCA 3QRDA 1G96A 3K9MC 4CCVA 1N5PA 3KSED 4N6V0 1CYVA 4N6UA 1YVBI 3NX0A 3L0RA 1DVCA 2OCTA 3LH4A 3UL6A 1STFI 1CYUA 1CEWI 1IV9A 2O9UX 4N6MA 4TX4A 1LXEA 3IMAB 3PXMA 1GD3A 1MOLA 5A0OB 1A90A 4N6LA 2W9PA 1WNHA 1PFPA 2BO9B 3KFQC 3PYJA 4N6TA 5ELUA 5EQLA 5LC6A 1A67A 1DVDA 3S67A 1FA3A 1MNLA 3Q2PA 1TIJA 3MWZA 2KXGA 4LZIA 1FUWA 5LC7A 1N5HA 3UL5A 1NB3I 4N6NB 1GD4A 1NB5I 1R4CA 3PS8A 1EQKA 1ROAA
chains in the Genus database with same CATH superfamily
1GS3A 1RGFA 4G1MB 1NO3A 2F5WA 1ROVA 4MMXB 3NUVA 3FH1A 1JV2B 4WP5A 1Q7HA 3T0UA 4K90B 1W6YA 4FMCA 3LH4A 3OWSA 2W0QA 2O9UX 4CJNA 2BT3A 1O7HB 3CXC2 2Q07A 4XB5A 4EBGA 2Z7AA 2W9PA 4O3VA 1FA3A 2RSXA 1FYSA 1I2FA 2IYJA 2CC3A 3FG4A 1BSBA 4XBTA 1RCKA 4LZIA 3SOYA 2KF6A 5IW9A 2W56B 1GYBA 3HX8A 4XDVA 1GY5A 3WA3A 1DMQA 1ROAA 3I553 1HU9A 5FW5A 2A15A 3OXAA 2CH9A 3N54B 4PEJA 1RRHA 4N6OB 4GHOA 1I8VA 2XSOB 2KF4A 1UCJA 3ECFA 2IA7A 1A2KA 1ASKA 1G02A 5AI1A 1UI8A 2GSPA 4L8OA 4AEQA 1WMNA 3GZXB 2IUKA 1D6ZA 3GWRA 2GU1A 1DYUA 1C7HA 1BRGA 3J7Yd 1OF5B 4RNYA 2HOHA 1BU4A 4HM4B 1VQK3 1IU7A 3NQZA 3ZG5A 1IVVA 1Q814 1CH0A 2XFTA 4KFDA 1BOXA 1TRQA 1RCLA 3LTCA 1BSAA 3UL5A 3EE1A 4N6NB 2CWUA 3F8XA 4OUQA 4L8PA 3JVCA 3DUKA 1W00A 1IVXA 3AMOA 3SYUA 1AVKA 3HZPA 3DGMA 1GMRA 3LXUX 1IV7A 1K9M4 1BRSA 3F7SA 1B3SA 2B1XB 3CCV3 3EB8A 3D79A 3AHWA 3FKAA 5STDA 4KZ1A 1B20A 1YVBI 1U8CB 1JBRA 3I0YA 2GU3A 4RBNA 1JJ22 1RGLA 1GD3A 1VQM3 3F7XA 1RLSA 1V57A 1RKYA 1NNVA 5ELUA 5CF2A 1B21A 3FZWA 3M8CA 2KRTA 2KXGA 4RNZA 2GBWB 5IENA 4KT3B 2WGQA 3FGYA 3HK4A 3K0ZA 3U97A 2F99A 2CWVA 3S27A 3LT9A 4MJDA 1R4YA 1BANA 1OPYA 1BRKA 1LOVA 3LT8A 4HKVB 4HZBB 5CK6A 1YI23 1M9GA 1WTHA 1BNIA 1V74A 4IT7A 4LGQA 2P05A 2W04A 3WOEB 4BIRA 3JUPA 2HMOB 1RGCA 4HM5B 4WYKB 1Q42A 2V1LA 3LTAA 2E2TA 4JF8A 2UGIA 3STDA 3GRDA 1KC84 1PYLA 1EEJA 1JKGB 2H0HA 3DGLA 1MOLA 3E99A 1IYYA 3MKIA 2ML5A 5AIFA 4BU4A 5M1AA 1HZ1A 1IT7A 1MWTA 4OK0A 4H3UA 1RTUA 3F14A 4LYLB 3DM8A 1A2VA 3AHSA 1VQL3 3JUQA 2CIUA 2XSHB 3D3LA 2MF7A 4BL3A 1M1XB 2KF3A 1S5AA 2XH9A 3CCS3 2RCDA 3DZLA 2CFDA 2YFLB 1JB4A 4IPBA 3CCL3 3JUNA 3OWUA 2FGTA 2QGUA 3DXOA 3B8LA 3D9RA 3G4S3 1ZO2A 1J2BA 2R41A 4WYKA 1X1YA 2F56A 3KSPA 1FGQA 1BNRA 5AIHA 3MG1A 1BSDA 3KIIA 4HVNA 4ILFA 1DE3A 3HIGA 1JZOA 3G0KA 4J9AA 1E97A 1BSCA 1STDA 1UGIA 1BUJA 1IQYA 1BNEA 3X3XA 4CDLA 1W4NA 3WR2A 2W03A 5IG5A 2C4BA 2AAEA 1FUWA 3RGRA 2PNCA 2F4YA 3GSPA 3MHEA 4ORLA 1E3RA 1AR0A 3G16A 2ZHXB 3HOHA 3WODG 3CCR3 2P09A 1R4CA 2F5MA 1FGOA 1T3BA 3X42A 1BNSA 5AIGA 4EV2A 5JPPA 1BUQA 5ELJA 2CW9A 1MWSA 4WHAA 4O2HA 3NQYA 1RHLA 1IVUA 1JZDA 3CMA3 3CCU3 1BNJA 3KE7A 5KP3A 3AGNA 1ZS7A 2CFLA 1JB2A 1TUHA 1CEWI 4N6MA 2W6JH 1OH0A 6STDA 3PYJA 4N6TA 3EHCA 4FMAA 1RGAA 4HAAA 3OWYA 3BNEA 4STDA 1N5HA 1O7NB 1Q864 3B4OA 1Z1SA 4GSPA 1OUNA 3I563 1UI7A 1BRJA 4WWUC 3UB1A 1W2B2 4K61A 1QAKA 1RSNA 1AVLA 3BU4A 4MEIA 4RZMA 4XDWA 5BXQA 1JRQA 2OQEA 2LQVA 3NBJA 2Z77A 2W9QA 5BU4A 4EV5A 1VQ43 1RNBA 1VQ93 3FF2A 4N6V0 1W6GA 2CFWA 1RJOA 2JDIH 1MWUA 3L0RA 2OCTA 2P0MA 1YIT3 1GMPA 1SJWA 1STFI 3MG3A 1PU4A 4IIAA 3G713 2C10A 3GZYB 2RBIA 1A90A 5D82A 1OACA 1PY3A 1A67A 5IEOA 3SOAA 4HBRA 4HM8B 1FGTA 1LNIA 3LZAA 4AKYA 4XBYA 9RNTA 2CHCA 1YVSA 1AV4A 3H3HA 3CC73 1MGRA 1EG9B 2GEXA 2OOVC 4O8SA 5I97A 3LTBA 4HM2B 1BNFA 1N9JA 4Q53A 5AYRB 3KZTA 3S28A 2OWPA 3KCHA 4EYCA 1Q9EA 2HMMB 1LNHA 2HMNB 3FG1A 1QAFA 4NPBA 6GSPA 2SARA 1YJ93 2ZL8A 3MG2A 1DVCA 3OX9A 2RGQA 3EX9A 1YHQ3 1IDPA 3CD63 4XBXA 1LXEA 5A0OB 1RN4A 2XRXB 3NM7A 1RRLA 3B7CA 3NV0A 4RNTA 2XGLA 3SXXA 3G6E3 1OHOA 3EJVA 3KN4A 4HYZA 1QVG2 3EBTA 1MNLA 2GBXB 3PZWA 3IPTA 1OGZA 3FCSB 3F8HA 2KF5A 1KQS2 3GZBA 1VZZA 1ULIB 2WO0A 3MYTA 2OTL3 1QVF2 2RNTA 1Y4KA 4NREA 3OV4A 1JKGA 1RGHA 1Q40A 2IUJA 1VQP3 4KVHA 5IERA 2YFIB 3BLZA 3U1WA 3NV0B 4CPKA 1B2UA 4KFFA 1F8NA 1IVWA 1MGWA 1T2IA 3NM2A 4K1VA 2WOFA 4N3VA 3UNLA 1IK3A 1NU3A 2D1WA 1JB5A 4CCVA 1CYVA 3CC43 7RNTA 2Y73A 2CKFB 1SARA 1QMAA 1IV9A 1IQXA 3RDEA 1B2XA 4I4KA 5KP4A 2IY2A 1TTOA 1NWWA 4XM4A 3LMLA 1VQ83 4R4KA 2QA43 1SIIA 1OHPA 7STDA 3D5GA 2CWTA 3NHXA 3FLJA 1GMQA 3DMCA 3S29A 1VQQA 1VQ53 3CC23 2CFKA 1A2PA 3VGNA 1O7GB 1O7MB 1U5OA 2UX0A 2Y74A 2K54A 1YGWA 3S5CA 1TP6A 8CHOA 3PS8A 3ZG0A 2CG0A 2FNQA 4I5QA 1BRIA 3WA2X 1JBSA 4L7KA 4ZM8A 3GZRA 5D81A 3NBRA 1Q824 1G0TA 1GY7A 3QRDA 3JUOA 1NDOB 1UCIA 4HM1B 1O7WB 2BMRB 1V58A 1UDII 3Q1CA 1M1K4 1YJW3 1UUGB 2M7OA 2BU4A 4QWTA 5EEOA 5JBSA 1N8QA 2GXFA 4FR9A 1K28A 4GB5A 3WHOA 2Z76A 4N6LA 2K0MA 4R1KA 2BO9B 3KFQC 5G2GA 2P0XA 2PZVA 5EQLA 2CX1A 3S67A 3ROBA 1LRAA 5IG3A 5FGOA 3BIRA 2CFGA 2H0IA 1LQGC 2P38A 3A76A 2W56A 2ZA4A 2MC8A 4BL2A 1K8A4 1NB5I 3Q90A 2INXA 3DH2A 3RNTA 2BHMA 2WOHA 3F9SA 4J5KA 2IMJA 4BTXA 2XF3A 3QK9A 1JN5B 1RN7A 2FXTA 3CCJ3 1B2MA 1W5ZA 1X1WA 4FMBA 3IJEB 4LMIA 3CPW2 1UCKA 2ZDJA 3UL6A 1TJDA 2W2CA 1T2HA 1BRHA 4HM7B 4U13A 1I2GA 2OTJ3 1BGSA 5IF6A 3ZFZA 1WNHA 4J8TA 2SBLA 1DVDA 1US1A 1YNVX 1YGEA 2F86B 4R80A 1RGEA 1TU5A 4R9LA 4HM3B 4HZ9B 1D6UA 5D83A 1GY6A 1OGXA 3JUMA 1Q7Y4 4FCMA 1UUWB 1QALA 1ZX2A 2F98A 4EC6A 1JN5A 2XGNA 5HGRA 3PCRA 3SX1A 1KWIA 1LOYA 5IG4A 4H61A 6RNTA 1VQO3 1G96A 3K9MC 1HKXA 1N5PA 3SLUA 3AMOB 3WMDA 1W2ZA 4N6UA 3K7CA 3MPHA 2QEX3 2L4VA 1SPUA 1T5YA 1UCLA 1LOXA 2RFRA 1UUVB 3BNBA 1JNQA 5JPUA 3IMAB 4O02B 2QIYA 3X40A 1YJN3 1BIRA 3ALAA 1EA2A 4J5GA 1B2SA 1AY7A 1TIJA 1TRPA 1BVIA 3MWZA 3BNCA 3V92A 3CME3 5HOHA 2HMJB 1TFKA 5AYSC 2E2UA 2KCDA 3NXJA 5LC7A 3T8UA 1BRNL 2YFJB 1GOYA 3FF0A 1B2ZA 1I3IA 2XR8B 5AIIA 2Z6BA 1VQ73 3D5IA 2C11A 1KD14 3N9HA 4HOHA 1UGHI 5G1LA 1SIHA 3EN1B 4X2HA 3V99A 4LEHA 1B27A 5M19A 3PGBA 1OCVA 1S723 1OHSA 3TDGA 3NX0A 3DY5A 3CNMA 3URPA 1FUTA 1GOUA 2BIRA 2ML6A 3FSDA 3WDGB 2CG1A 2HMLB 4EW5A 5BVBA 8RNTA 1N8R4 1CYUA 3H51A 3PXMA 3OW22 1Q40B 5AEWB 1AQZA 2E2VA 1GSPA 1FGRA 3N8BA 3Q2PA 1DETA 4AKZA 1ISKA 3Q3FA 3G8ZA 4DKIA 3F40A 1GD4A 3CCQ3 4X2OA 1I0XA 1VQ63 3X3YA 5RNTA 1EUIC 4OVMA 1K41A 1EQKA 2AADA 1D6YA 3NBBA 1RN1A 3LOYA 2YX9A 1HYFA 1TFOA 5CLKA 1E3VA 2L1SA 2H0GA 2K3DA 3DGOA 3KSED 2OOVA 1MWRA 3MSOA 5DREA 1LQMB 1QJGA 5CF1A 1O7PB 3K63A 1X1UA 3X3ZA 2BMQB 4GL6A 5M18A 2J8XB 4TX4A 4K1UA 3VSYA 3V98A 4JRFA 3BNDA 2GEYA 5AEUB 1N9EA 1DMMA 3WOFB 3EQQB 3KKGA 4LSOA 4HJLB 1FZUA 3LYGA 5IG0A 3FG3A 4EXRA 3CCM3 1ZGXA 2BMOB 3O8YA 5BIRA 1K734 2R4IA 4MMYB 4BTWA 5G1KA 1RMSA 1NJI4 1LOWA 1W01A 2KAAA 3T8NA 3HIIA 1BSEA 4FCZA 3CNXA 3DGNA 1BNGA 1UW1A 3RGAA 1M904 1ULJB 1I2EA 1LVNA 2XFSA 1PFPA 1GOVA 1YIJ3 1OF5A 1W6CA 2BNGA 1WQLB 5LC6A 2CX0A 2B24B 1I70A 3ER7A 1EKMA 3EF8A 1RGGA 4HM6B 4MMZB 3HI7A 3A5EA 4R9KA 5CXOA 5KP1A 3CCE3 1W02A 5DRVA 2JQ5A 4WFOA 5GSPA 3X41A 3EBYA 3GAXA 3PCSA 1IT8A 1L5GB 3UJMA 1C54A 3EN8A 3SVAA 1SQWA 1BAOA 2STDA 2UUGC 3CPOA 4NHFA 2XEPA 3AGOA 4HM0B 1JBTA 3CU3A 4KFEA 2D42A 3EC9A 1CQSA 1RDSA 5EVHA 1WMOA 2WGOA 2CK3H 1RGKA 1W7CA 1KSIA 3K5TA 3SEDA 1FW7A 1FUSA 1RNTA 2I9WA 3BB9A 3DGYA 5IEPA 5TGNA 1WMPA 1FGMA 2OQEC 7GSPA 2O3OA 3VF1A 1IQ8A 2HMKB 4FMDA 1NB3I 3LTDA 3D4AA 1I0VA 1X1XA 4FCJA 1DMNA 4BTYA 1VQN3 1I3FA 3B4PA 2LYXA
chains in the Genus database with same CATH topology
1GS3A 4G1MB 1NO3A 1ROVA 4MMXB 3NUVA 3FH1A 1JV2B 4WP5A 3T0UA 4K90B 1W6YA 4FMCA 3LH4A 3OWSA 2W0QA 2O9UX 2BT3A 1O7HB 3CXC2 2Q07A 4XB5A 4EBGA 2Z7AA 2W9PA 4O3VA 1FA3A 2RSXA 2CC3A 3FG4A 4XBTA 4LZIA 3SOYA 5IW9A 2W56B 1GYBA 3HX8A 4XDVA 1GY5A 3WA3A 1DMQA 1ROAA 3I553 1HU9A 5FW5A 2A15A 3OXAA 2CH9A 3N54B 4PEJA 1RRHA 4N6OB 2XSOB 3ECFA 2IA7A 1A2KA 1ASKA 5AI1A 1UI8A 4L8OA 4AEQA 1WMNA 3GZXB 2IUKA 1D6ZA 3GWRA 2GU1A 1DYUA 1C7HA 3J7Yd 1OF5B 4RNYA 4HM4B 1VQK3 1IU7A 3NQZA 1Q814 1IVVA 2XFTA 4KFDA 3LTCA 3UL5A 3EE1A 4N6NB 2CWUA 3F8XA 4OUQA 4L8PA 3JVCA 3DUKA 1W00A 1IVXA 3AMOA 1AVKA 3HZPA 3DGMA 3LXUX 1IV7A 1K9M4 3F7SA 2B1XB 3CCV3 3EB8A 3FKAA 5STDA 4KZ1A 1YVBI 1U8CB 3I0YA 2GU3A 4RBNA 1JJ22 1GD3A 1VQM3 3F7XA 1RKYA 5ELUA 5CF2A 3FZWA 3M8CA 2KRTA 2KXGA 4RNZA 2GBWB 5IENA 2WGQA 3FGYA 3HK4A 3K0ZA 3U97A 2F99A 2CWVA 3S27A 3LT9A 4MJDA 3LT8A 4HKVB 1OPYA 1YI23 4HZBB 5CK6A 1M9GA 1WTHA 1V74A 4IT7A 4LGQA 2P05A 2W04A 3WOEB 3JUPA 2HMOB 4HM5B 4WYKB 1Q42A 2V1LA 3LTAA 2E2TA 4JF8A 3STDA 3GRDA 1KC84 1JKGB 3DGLA 1MOLA 3E99A 3MKIA 2ML5A 5AIFA 1IT7A 4OK0A 4H3UA 3F14A 3DM8A 1A2VA 1VQL3 3JUQA 2CIUA 2XSHB 3D3LA 2MF7A 1M1XB 1S5AA 2XH9A 3CCS3 2RCDA 3DZLA 2CFDA 2YFLB 1JB4A 4IPBA 3CCL3 3JUNA 3OWUA 2FGTA 2QGUA 3DXOA 3B8LA 3D9RA 3G4S3 1ZO2A 1J2BA 4WYKA 3KSPA 1FGQA 5AIHA 3MG1A 3KIIA 4HVNA 3HIGA 3G0KA 4J9AA 1E97A 1STDA 1IQYA 3X3XA 4CDLA 1W4NA 2W03A 5IG5A 1FUWA 3RGRA 2PNCA 4ORLA 3MHEA 1E3RA 1AR0A 3G16A 3WODG 3CCR3 2P09A 1R4CA 1FGOA 3X42A 5AIGA 4EV2A 5JPPA 1BUQA 5ELJA 2CW9A 4WHAA 4O2HA 3NQYA 1IVUA 3CMA3 3CCU3 3KE7A 5KP3A 2CFLA 1JB2A 1TUHA 1CEWI 4N6MA 2W6JH 1OH0A 6STDA 3PYJA 4N6TA 3EHCA 4FMAA 3OWYA 3BNEA 4STDA 1N5HA 1O7NB 1Q864 3B4OA 1Z1SA 1OUNA 3I563 1UI7A 1W2B2 4WWUC 3UB1A 4K61A 1QAKA 4MEIA 1AVLA 4RZMA 4XDWA 5BXQA 1JRQA 2OQEA 2LQVA 3NBJA 2Z77A 2W9QA 1VQ93 4EV5A 1VQ43 3FF2A 4N6V0 1W6GA 2CFWA 1RJOA 2JDIH 3L0RA 2OCTA 2P0MA 1YIT3 1SJWA 1STFI 3MG3A 1PU4A 4IIAA 3G713 2C10A 3GZYB 1A90A 5D82A 1OACA 1A67A 5IEOA 3SOAA 4HBRA 4HM8B 1FGTA 3LZAA 4AKYA 4XBYA 2CHCA 1AV4A 3H3HA 3CC73 1EG9B 2GEXA 2OOVC 4O8SA 5I97A 3LTBA 4HM2B 1N9JA 4Q53A 5AYRB 3KZTA 3S28A 2OWPA 4EYCA 2HMMB 1LNHA 2HMNB 3FG1A 1QAFA 1YJ93 2ZL8A 3MG2A 1DVCA 3OX9A 2RGQA 3EX9A 1YHQ3 1IDPA 3CD63 4XBXA 1LXEA 5A0OB 3NM7A 2XRXB 1RRLA 3B7CA 3NV0A 3G6E3 2XGLA 3SXXA 1OHOA 3EJVA 3KN4A 4HYZA 1QVG2 3EBTA 1MNLA 2GBXB 3PZWA 3IPTA 1OGZA 3FCSB 3F8HA 1KQS2 3GZBA 1VZZA 1ULIB 2WO0A 3MYTA 2OTL3 1QVF2 4NREA 1Y4KA 2IUJA 3OV4A 1JKGA 1VQP3 1Q40A 4KVHA 5IERA 3BLZA 2YFIB 3U1WA 3NV0B 4KFFA 1F8NA 1IVWA 3NM2A 3UNLA 1IK3A 4K1VA 2WOFA 4N3VA 1NU3A 2D1WA 1JB5A 4CCVA 1CYVA 3CC43 2Y73A 2CKFB 1QMAA 1IV9A 1IQXA 3RDEA 4I4KA 5KP4A 1NWWA 4XM4A 3LMLA 1VQ83 4R4KA 2QA43 1SIIA 1OHPA 7STDA 2CWTA 3NHXA 3FLJA 3DMCA 3S29A 1VQ53 3CC23 2CFKA 3VGNA 1O7GB 1O7MB 1U5OA 2UX0A 2Y74A 2K54A 3S5CA 8CHOA 1TP6A 3PS8A 2CG0A 2FNQA 3WA2X 4L7KA 4ZM8A 3GZRA 5D81A 3NBRA 1Q824 1GY7A 3QRDA 3JUOA 1NDOB 4HM1B 1O7WB 2BMRB 3Q1CA 1M1K4 1YJW3 2M7OA 4QWTA 5EEOA 5JBSA 1N8QA 2GXFA 4FR9A 1K28A 4GB5A 2Z76A 4N6LA 2K0MA 4R1KA 2BO9B 3KFQC 5G2GA 2P0XA 2PZVA 5EQLA 3S67A 3ROBA 5IG3A 5FGOA 2CFGA 2P38A 3A76A 2W56A 2MC8A 1K8A4 1NB5I 3Q90A 2INXA 2BHMA 2WOHA 3F9SA 2IMJA 4BTXA 2XF3A 3QK9A 1JN5B 1RN7A 2FXTA 3CCJ3 1W5ZA 4FMBA 3IJEB 4LMIA 3CPW2 2ZDJA 3UL6A 2W2CA 4HM7B 4U13A 2OTJ3 5IF6A 1WNHA 4J8TA 2SBLA 1DVDA 1US1A 1YGEA 2F86B 4R80A 1TU5A 4R9LA 4HM3B 4HZ9B 1D6UA 5D83A 1GY6A 1OGXA 3JUMA 1Q7Y4 4FCMA 1UUWB 1QALA 1ZX2A 2F98A 4EC6A 1JN5A 2XGNA 5HGRA 3PCRA 3SX1A 1KWIA 5IG4A 4H61A 1VQO3 1G96A 3K9MC 1HKXA 1N5PA 3SLUA 3AMOB 3WMDA 1W2ZA 4N6UA 3K7CA 3MPHA 2QEX3 2L4VA 1SPUA 1T5YA 1LOXA 2RFRA 1UUVB 3BNBA 1JNQA 5JPUA 3IMAB 4O02B 2QIYA 3X40A 1YJN3 3ALAA 1EA2A 1TIJA 3MWZA 3V92A 3BNCA 3CME3 2HMJB 1TFKA 5AYSC 2E2UA 2KCDA 3NXJA 5LC7A 3T8UA 2YFJB 3FF0A 2XR8B 5AIIA 2Z6BA 1VQ73 2C11A 1KD14 3N9HA 1SIHA 3EN1B 4X2HA 3V99A 4LEHA 1S723 3PGBA 1OCVA 1OHSA 3TDGA 3NX0A 3DY5A 3CNMA 2ML6A 3FSDA 3WDGB 5BVBA 2CG1A 2HMLB 1N8R4 1CYUA 3H51A 3PXMA 3OW22 1Q40B 5AEWB 2E2VA 1FGRA 3N8BA 3Q2PA 4AKZA 1ISKA 3G8ZA 3F40A 1GD4A 3CCQ3 4X2OA 1VQ63 3X3YA 4OVMA 1EQKA 1K41A 1D6YA 3NBBA 3LOYA 2YX9A 1TFOA 5CLKA 1E3VA 3DGOA 3KSED 2OOVA 3MSOA 5DREA 5CF1A 1QJGA 1O7PB 3K63A 3X3ZA 2BMQB 4GL6A 4TX4A 4K1UA 3VSYA 3V98A 4JRFA 3BNDA 2GEYA 5AEUB 1N9EA 1DMMA 3WOFB 3EQQB 3KKGA 4LSOA 4HJLB 3LYGA 5IG0A 3FG3A 4EXRA 3CCM3 2BMOB 3O8YA 1K734 2R4IA 4MMYB 4BTWA 1NJI4 1W01A 3T8NA 3HIIA 4FCZA 3CNXA 3DGNA 1UW1A 3RGAA 1M904 1LVNA 1ULJB 2XFSA 1PFPA 1YIJ3 1OF5A 1W6CA 2BNGA 1WQLB 5LC6A 2B24B 3ER7A 1EKMA 3EF8A 4HM6B 4MMZB 3HI7A 4R9KA 5CXOA 5KP1A 3CCE3 1W02A 5DRVA 2JQ5A 4WFOA 3X41A 3EBYA 3GAXA 3PCSA 1IT8A 1L5GB 3UJMA 3EN8A 3SVAA 1SQWA 2STDA 4NHFA 3CPOA 2XEPA 4HM0B 3CU3A 4KFEA 2D42A 3EC9A 1CQSA 5EVHA 1WMOA 2WGOA 2CK3H 1W7CA 1KSIA 3K5TA 3SEDA 3BB9A 2I9WA 5IEPA 5TGNA 1WMPA 1FGMA 2OQEC 2O3OA 3VF1A 1IQ8A 2HMKB 4FMDA 1NB3I 3LTDA 4FCJA 1DMNA 4BTYA 1VQN3 3B4PA 2LYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GAX A;  1RN7 A;  1M9G A;  1N9J A;  1IV7 A;  1KWI A;  3SVA A;  4ZM8 A;  2CH9 A;  5ELJ A;  2W9Q A;  4N6O B;  4IT7 A;  4EYC A;  3QRD A;  1G96 A;  3K9M C;  4CCV A;  1N5P A;  3KSE D;  4N6V 0;  1CYV A;  4N6U A;  1YVB I;  3NX0 A;  3L0R A;  1DVC A;  2OCT A;  3LH4 A;  3UL6 A;  1STF I;  1CYU A;  1CEW I;  1IV9 A;  2O9U X;  4N6M A;  4TX4 A;  1LXE A;  3IMA B;  3PXM A;  1GD3 A;  1MOL A;  5A0O B;  1A90 A;  4N6L A;  2W9P A;  1WNH A;  1PFP A;  2BO9 B;  3KFQ C;  3PYJ A;  4N6T A;  5ELU A;  5EQL A;  5LC6 A;  1A67 A;  1DVD A;  3S67 A;  1FA3 A;  1MNL A;  3Q2P A;  1TIJ A;  3MWZ A;  2KXG A;  4LZI A;  1FUW A;  5LC7 A;  1N5H A;  3UL5 A;  1NB3 I;  4N6N B;  1GD4 A;  1NB5 I;  1R4C A;  3PS8 A;  1EQK A;  1ROA A; 
#chains in the Genus database with same CATH topology
 1GS3 A;  1RGF A;  4G1M B;  1NO3 A;  2F5W A;  1ROV A;  4MMX B;  3NUV A;  3FH1 A;  1JV2 B;  4WP5 A;  1Q7H A;  3T0U A;  4K90 B;  1W6Y A;  4FMC A;  3LH4 A;  3OWS A;  2W0Q A;  2O9U X;  4CJN A;  2BT3 A;  1O7H B;  3CXC 2;  2Q07 A;  4XB5 A;  4EBG A;  2Z7A A;  2W9P A;  4O3V A;  1FA3 A;  2RSX A;  1FYS A;  1I2F A;  2IYJ A;  2CC3 A;  3FG4 A;  1BSB A;  4XBT A;  1RCK A;  4LZI A;  3SOY A;  2KF6 A;  5IW9 A;  2W56 B;  1GYB A;  3HX8 A;  4XDV A;  1GY5 A;  3WA3 A;  1DMQ A;  1ROA A;  3I55 3;  1HU9 A;  5FW5 A;  2A15 A;  3OXA A;  2CH9 A;  3N54 B;  4PEJ A;  1RRH A;  4N6O B;  4GHO A;  1I8V A;  2XSO B;  2KF4 A;  1UCJ A;  3ECF A;  2IA7 A;  1A2K A;  1ASK A;  1G02 A;  5AI1 A;  1UI8 A;  2GSP A;  4L8O A;  4AEQ A;  1WMN A;  3GZX B;  2IUK A;  1D6Z A;  3GWR A;  2GU1 A;  1DYU A;  1C7H A;  1BRG A;  3J7Y d;  1OF5 B;  4RNY A;  2HOH A;  1BU4 A;  4HM4 B;  1VQK 3;  1IU7 A;  3NQZ A;  3ZG5 A;  1IVV A;  1Q81 4;  1CH0 A;  2XFT A;  4KFD A;  1BOX A;  1TRQ A;  1RCL A;  3LTC A;  1BSA A;  3UL5 A;  3EE1 A;  4N6N B;  2CWU A;  3F8X A;  4OUQ A;  4L8P A;  3JVC A;  3DUK A;  1W00 A;  1IVX A;  3AMO A;  3SYU A;  1AVK A;  3HZP A;  3DGM A;  1GMR A;  3LXU X;  1IV7 A;  1K9M 4;  1BRS A;  3F7S A;  1B3S A;  2B1X B;  3CCV 3;  3EB8 A;  3D79 A;  3AHW A;  3FKA A;  5STD A;  4KZ1 A;  1B20 A;  1YVB I;  1U8C B;  1JBR A;  3I0Y A;  2GU3 A;  4RBN A;  1JJ2 2;  1RGL A;  1GD3 A;  1VQM 3;  3F7X A;  1RLS A;  1V57 A;  1RKY A;  1NNV A;  5ELU A;  5CF2 A;  1B21 A;  3FZW A;  3M8C A;  2KRT A;  2KXG A;  4RNZ A;  2GBW B;  5IEN A;  4KT3 B;  2WGQ A;  3FGY A;  3HK4 A;  3K0Z A;  3U97 A;  2F99 A;  2CWV A;  3S27 A;  3LT9 A;  4MJD A;  1R4Y A;  1BAN A;  1OPY A;  1BRK A;  1LOV A;  3LT8 A;  4HKV B;  4HZB B;  5CK6 A;  1YI2 3;  1M9G A;  1WTH A;  1BNI A;  1V74 A;  4IT7 A;  4LGQ A;  2P05 A;  2W04 A;  3WOE B;  4BIR A;  3JUP A;  2HMO B;  1RGC A;  4HM5 B;  4WYK B;  1Q42 A;  2V1L A;  3LTA A;  2E2T A;  4JF8 A;  2UGI A;  3STD A;  3GRD A;  1KC8 4;  1PYL A;  1EEJ A;  1JKG B;  2H0H A;  3DGL A;  1MOL A;  3E99 A;  1IYY A;  3MKI A;  2ML5 A;  5AIF A;  4BU4 A;  5M1A A;  1HZ1 A;  1IT7 A;  1MWT A;  4OK0 A;  4H3U A;  1RTU A;  3F14 A;  4LYL B;  3DM8 A;  1A2V A;  3AHS A;  1VQL 3;  3JUQ A;  2CIU A;  2XSH B;  3D3L A;  2MF7 A;  4BL3 A;  1M1X B;  2KF3 A;  1S5A A;  2XH9 A;  3CCS 3;  2RCD A;  3DZL A;  2CFD A;  2YFL B;  1JB4 A;  4IPB A;  3CCL 3;  3JUN A;  3OWU A;  2FGT A;  2QGU A;  3DXO A;  3B8L A;  3D9R A;  3G4S 3;  1ZO2 A;  1J2B A;  2R41 A;  4WYK A;  1X1Y A;  2F56 A;  3KSP A;  1FGQ A;  1BNR A;  5AIH A;  3MG1 A;  1BSD A;  3KII A;  4HVN A;  4ILF A;  1DE3 A;  3HIG A;  1JZO A;  3G0K A;  4J9A A;  1E97 A;  1BSC A;  1STD A;  1UGI A;  1BUJ A;  1IQY A;  1BNE A;  3X3X A;  4CDL A;  1W4N A;  3WR2 A;  2W03 A;  5IG5 A;  2C4B A;  2AAE A;  1FUW A;  3RGR A;  2PNC A;  2F4Y A;  3GSP A;  3MHE A;  4ORL A;  1E3R A;  1AR0 A;  3G16 A;  2ZHX B;  3HOH A;  3WOD G;  3CCR 3;  2P09 A;  1R4C A;  2F5M A;  1FGO A;  1T3B A;  3X42 A;  1BNS A;  5AIG A;  4EV2 A;  5JPP A;  1BUQ A;  5ELJ A;  2CW9 A;  1MWS A;  4WHA A;  4O2H A;  3NQY A;  1RHL A;  1IVU A;  1JZD A;  3CMA 3;  3CCU 3;  1BNJ A;  3KE7 A;  5KP3 A;  3AGN A;  1ZS7 A;  2CFL A;  1JB2 A;  1TUH A;  1CEW I;  4N6M A;  2W6J H;  1OH0 A;  6STD A;  3PYJ A;  4N6T A;  3EHC A;  4FMA A;  1RGA A;  4HAA A;  3OWY A;  3BNE A;  4STD A;  1N5H A;  1O7N B;  1Q86 4;  3B4O A;  1Z1S A;  4GSP A;  1OUN A;  3I56 3;  1UI7 A;  1BRJ A;  4WWU C;  3UB1 A;  1W2B 2;  4K61 A;  1QAK A;  1RSN A;  1AVL A;  3BU4 A;  4MEI A;  4RZM A;  4XDW A;  5BXQ A;  1JRQ A;  2OQE A;  2LQV A;  3NBJ A;  2Z77 A;  2W9Q A;  5BU4 A;  4EV5 A;  1VQ4 3;  1RNB A;  1VQ9 3;  3FF2 A;  4N6V 0;  1W6G A;  2CFW A;  1RJO A;  2JDI H;  1MWU A;  3L0R A;  2OCT A;  2P0M A;  1YIT 3;  1GMP A;  1SJW A;  1STF I;  3MG3 A;  1PU4 A;  4IIA A;  3G71 3;  2C10 A;  3GZY B;  2RBI A;  1A90 A;  5D82 A;  1OAC A;  1PY3 A;  1A67 A;  5IEO A;  3SOA A;  4HBR A;  4HM8 B;  1FGT A;  1LNI A;  3LZA A;  4AKY A;  4XBY A;  9RNT A;  2CHC A;  1YVS A;  1AV4 A;  3H3H A;  3CC7 3;  1MGR A;  1EG9 B;  2GEX A;  2OOV C;  4O8S A;  5I97 A;  3LTB A;  4HM2 B;  1BNF A;  1N9J A;  4Q53 A;  5AYR B;  3KZT A;  3S28 A;  2OWP A;  3KCH A;  4EYC A;  1Q9E A;  2HMM B;  1LNH A;  2HMN B;  3FG1 A;  1QAF A;  4NPB A;  6GSP A;  2SAR A;  1YJ9 3;  2ZL8 A;  3MG2 A;  1DVC A;  3OX9 A;  2RGQ A;  3EX9 A;  1YHQ 3;  1IDP A;  3CD6 3;  4XBX A;  1LXE A;  5A0O B;  1RN4 A;  2XRX B;  3NM7 A;  1RRL A;  3B7C A;  3NV0 A;  4RNT A;  2XGL A;  3SXX A;  3G6E 3;  1OHO A;  3EJV A;  3KN4 A;  4HYZ A;  1QVG 2;  3EBT A;  1MNL A;  2GBX B;  3PZW A;  3IPT A;  1OGZ A;  3FCS B;  3F8H A;  2KF5 A;  1KQS 2;  3GZB A;  1VZZ A;  1ULI B;  2WO0 A;  3MYT A;  2OTL 3;  1QVF 2;  2RNT A;  1Y4K A;  4NRE A;  3OV4 A;  1JKG A;  1RGH A;  1Q40 A;  2IUJ A;  1VQP 3;  4KVH A;  5IER A;  2YFI B;  3BLZ A;  3U1W A;  3NV0 B;  4CPK A;  1B2U A;  4KFF A;  1F8N A;  1IVW A;  1MGW A;  1T2I A;  3NM2 A;  4K1V A;  2WOF A;  4N3V A;  3UNL A;  1IK3 A;  1NU3 A;  2D1W A;  1JB5 A;  4CCV A;  1CYV A;  3CC4 3;  7RNT A;  2Y73 A;  2CKF B;  1SAR A;  1QMA A;  1IV9 A;  1IQX A;  3RDE A;  1B2X A;  4I4K A;  5KP4 A;  2IY2 A;  1TTO A;  1NWW A;  4XM4 A;  3LML A;  1VQ8 3;  4R4K A;  2QA4 3;  1SII A;  1OHP A;  7STD A;  3D5G A;  2CWT A;  3NHX A;  3FLJ A;  1GMQ A;  3DMC A;  3S29 A;  1VQQ A;  1VQ5 3;  3CC2 3;  2CFK A;  1A2P A;  3VGN A;  1O7G B;  1O7M B;  1U5O A;  2UX0 A;  2Y74 A;  2K54 A;  1YGW A;  3S5C A;  1TP6 A;  8CHO A;  3PS8 A;  3ZG0 A;  2CG0 A;  2FNQ A;  4I5Q A;  1BRI A;  3WA2 X;  1JBS A;  4L7K A;  4ZM8 A;  3GZR A;  5D81 A;  3NBR A;  1Q82 4;  1G0T A;  1GY7 A;  3QRD A;  3JUO A;  1NDO B;  1UCI A;  4HM1 B;  1O7W B;  2BMR B;  1V58 A;  1UDI I;  3Q1C A;  1M1K 4;  1YJW 3;  1UUG B;  2M7O A;  2BU4 A;  4QWT A;  5EEO A;  5JBS A;  1N8Q A;  2GXF A;  4FR9 A;  1K28 A;  4GB5 A;  3WHO A;  2Z76 A;  4N6L A;  2K0M A;  4R1K A;  2BO9 B;  3KFQ C;  5G2G A;  2P0X A;  2PZV A;  5EQL A;  2CX1 A;  3S67 A;  3ROB A;  1LRA A;  5IG3 A;  5FGO A;  3BIR A;  2CFG A;  2H0I A;  1LQG C;  2P38 A;  3A76 A;  2W56 A;  2ZA4 A;  2MC8 A;  4BL2 A;  1K8A 4;  1NB5 I;  3Q90 A;  2INX A;  3DH2 A;  3RNT A;  2BHM A;  2WOH A;  3F9S A;  4J5K A;  2IMJ A;  4BTX A;  2XF3 A;  3QK9 A;  1JN5 B;  1RN7 A;  2FXT A;  3CCJ 3;  1B2M A;  1W5Z A;  1X1W A;  4FMB A;  3IJE B;  4LMI A;  3CPW 2;  1UCK A;  2ZDJ A;  3UL6 A;  1TJD A;  2W2C A;  1T2H A;  1BRH A;  4HM7 B;  4U13 A;  1I2G A;  2OTJ 3;  1BGS A;  5IF6 A;  3ZFZ A;  1WNH A;  4J8T A;  2SBL A;  1DVD A;  1US1 A;  1YNV X;  1YGE A;  2F86 B;  4R80 A;  1RGE A;  1TU5 A;  4R9L A;  4HM3 B;  4HZ9 B;  1D6U A;  5D83 A;  1GY6 A;  1OGX A;  3JUM A;  1Q7Y 4;  4FCM A;  1UUW B;  1QAL A;  1ZX2 A;  2F98 A;  4EC6 A;  1JN5 A;  2XGN A;  5HGR A;  3PCR A;  3SX1 A;  1KWI A;  1LOY A;  5IG4 A;  4H61 A;  6RNT A;  1VQO 3;  1G96 A;  3K9M C;  1HKX A;  1N5P A;  3SLU A;  3AMO B;  3WMD A;  1W2Z A;  4N6U A;  3K7C A;  3MPH A;  2QEX 3;  2L4V A;  1SPU A;  1T5Y A;  1UCL A;  1LOX A;  2RFR A;  1UUV B;  3BNB A;  1JNQ A;  5JPU A;  3IMA B;  4O02 B;  2QIY A;  3X40 A;  1YJN 3;  1BIR A;  3ALA A;  1EA2 A;  4J5G A;  1B2S A;  1AY7 A;  1TIJ A;  1TRP A;  1BVI A;  3MWZ A;  3BNC A;  3V92 A;  3CME 3;  5HOH A;  2HMJ B;  1TFK A;  5AYS C;  2E2U A;  2KCD A;  3NXJ A;  5LC7 A;  3T8U A;  1BRN L;  2YFJ B;  1GOY A;  3FF0 A;  1B2Z A;  1I3I A;  2XR8 B;  5AII A;  2Z6B A;  1VQ7 3;  3D5I A;  2C11 A;  1KD1 4;  3N9H A;  4HOH A;  1UGH I;  5G1L A;  1SIH A;  3EN1 B;  4X2H A;  3V99 A;  4LEH A;  1B27 A;  5M19 A;  3PGB A;  1OCV A;  1S72 3;  1OHS A;  3TDG A;  3NX0 A;  3DY5 A;  3CNM A;  3URP A;  1FUT A;  1GOU A;  2BIR A;  2ML6 A;  3FSD A;  3WDG B;  2CG1 A;  2HML B;  4EW5 A;  5BVB A;  8RNT A;  1N8R 4;  1CYU A;  3H51 A;  3PXM A;  3OW2 2;  1Q40 B;  5AEW B;  1AQZ A;  2E2V A;  1GSP A;  1FGR A;  3N8B A;  3Q2P A;  1DET A;  4AKZ A;  1ISK A;  3Q3F A;  3G8Z A;  4DKI A;  3F40 A;  1GD4 A;  3CCQ 3;  4X2O A;  1I0X A;  1VQ6 3;  3X3Y A;  5RNT A;  1EUI C;  4OVM A;  1K41 A;  1EQK A;  2AAD A;  1D6Y A;  3NBB A;  1RN1 A;  3LOY A;  2YX9 A;  1HYF A;  1TFO A;  5CLK A;  1E3V A;  2L1S A;  2H0G A;  2K3D A;  3DGO A;  3KSE D;  2OOV A;  1MWR A;  3MSO A;  5DRE A;  1LQM B;  1QJG A;  5CF1 A;  1O7P B;  3K63 A;  1X1U A;  3X3Z A;  2BMQ B;  4GL6 A;  5M18 A;  2J8X B;  4TX4 A;  4K1U A;  3VSY A;  3V98 A;  4JRF A;  3BND A;  2GEY A;  5AEU B;  1N9E A;  1DMM A;  3WOF B;  3EQQ B;  3KKG A;  4LSO A;  4HJL B;  1FZU A;  3LYG A;  5IG0 A;  3FG3 A;  4EXR A;  3CCM 3;  1ZGX A;  2BMO B;  3O8Y A;  5BIR A;  1K73 4;  2R4I A;  4MMY B;  4BTW A;  5G1K A;  1RMS A;  1NJI 4;  1LOW A;  1W01 A;  2KAA A;  3T8N A;  3HII A;  1BSE A;  4FCZ A;  3CNX A;  3DGN A;  1BNG A;  1UW1 A;  3RGA A;  1M90 4;  1ULJ B;  1I2E A;  1LVN A;  2XFS A;  1PFP A;  1GOV A;  1YIJ 3;  1OF5 A;  1W6C A;  2BNG A;  1WQL B;  5LC6 A;  2CX0 A;  2B24 B;  1I70 A;  3ER7 A;  1EKM A;  3EF8 A;  1RGG A;  4HM6 B;  4MMZ B;  3HI7 A;  3A5E A;  4R9K A;  5CXO A;  5KP1 A;  3CCE 3;  1W02 A;  5DRV A;  2JQ5 A;  4WFO A;  5GSP A;  3X41 A;  3EBY A;  3GAX A;  3PCS A;  1IT8 A;  1L5G B;  3UJM A;  1C54 A;  3EN8 A;  3SVA A;  1SQW A;  1BAO A;  2STD A;  2UUG C;  3CPO A;  4NHF A;  2XEP A;  3AGO A;  4HM0 B;  1JBT A;  3CU3 A;  4KFE A;  2D42 A;  3EC9 A;  1CQS A;  1RDS A;  5EVH A;  1WMO A;  2WGO A;  2CK3 H;  1RGK A;  1W7C A;  1KSI A;  3K5T A;  3SED A;  1FW7 A;  1FUS A;  1RNT A;  2I9W A;  3BB9 A;  3DGY A;  5IEP A;  5TGN A;  1WMP A;  1FGM A;  2OQE C;  7GSP A;  2O3O A;  3VF1 A;  1IQ8 A;  2HMK B;  4FMD A;  1NB3 I;  3LTD A;  3D4A A;  1I0V A;  1X1X A;  4FCJ A;  1DMN A;  4BTY A;  1VQN 3;  1I3F A;  3B4P A;  2LYX A; 
#chains in the Genus database with same CATH homology
 1GS3 A;  4G1M B;  1NO3 A;  1ROV A;  4MMX B;  3NUV A;  3FH1 A;  1JV2 B;  4WP5 A;  3T0U A;  4K90 B;  1W6Y A;  4FMC A;  3LH4 A;  3OWS A;  2W0Q A;  2O9U X;  2BT3 A;  1O7H B;  3CXC 2;  2Q07 A;  4XB5 A;  4EBG A;  2Z7A A;  2W9P A;  4O3V A;  1FA3 A;  2RSX A;  2CC3 A;  3FG4 A;  4XBT A;  4LZI A;  3SOY A;  5IW9 A;  2W56 B;  1GYB A;  3HX8 A;  4XDV A;  1GY5 A;  3WA3 A;  1DMQ A;  1ROA A;  3I55 3;  1HU9 A;  5FW5 A;  2A15 A;  3OXA A;  2CH9 A;  3N54 B;  4PEJ A;  1RRH A;  4N6O B;  2XSO B;  3ECF A;  2IA7 A;  1A2K A;  1ASK A;  5AI1 A;  1UI8 A;  4L8O A;  4AEQ A;  1WMN A;  3GZX B;  2IUK A;  1D6Z A;  3GWR A;  2GU1 A;  1DYU A;  1C7H A;  3J7Y d;  1OF5 B;  4RNY A;  4HM4 B;  1VQK 3;  1IU7 A;  3NQZ A;  1Q81 4;  1IVV A;  2XFT A;  4KFD A;  3LTC A;  3UL5 A;  3EE1 A;  4N6N B;  2CWU A;  3F8X A;  4OUQ A;  4L8P A;  3JVC A;  3DUK A;  1W00 A;  1IVX A;  3AMO A;  1AVK A;  3HZP A;  3DGM A;  3LXU X;  1IV7 A;  1K9M 4;  3F7S A;  2B1X B;  3CCV 3;  3EB8 A;  3FKA A;  5STD A;  4KZ1 A;  1YVB I;  1U8C B;  3I0Y A;  2GU3 A;  4RBN A;  1JJ2 2;  1GD3 A;  1VQM 3;  3F7X A;  1RKY A;  5ELU A;  5CF2 A;  3FZW A;  3M8C A;  2KRT A;  2KXG A;  4RNZ A;  2GBW B;  5IEN A;  2WGQ A;  3FGY A;  3HK4 A;  3K0Z A;  3U97 A;  2F99 A;  2CWV A;  3S27 A;  3LT9 A;  4MJD A;  3LT8 A;  4HKV B;  1OPY A;  1YI2 3;  4HZB B;  5CK6 A;  1M9G A;  1WTH A;  1V74 A;  4IT7 A;  4LGQ A;  2P05 A;  2W04 A;  3WOE B;  3JUP A;  2HMO B;  4HM5 B;  4WYK B;  1Q42 A;  2V1L A;  3LTA A;  2E2T A;  4JF8 A;  3STD A;  3GRD A;  1KC8 4;  1JKG B;  3DGL A;  1MOL A;  3E99 A;  3MKI A;  2ML5 A;  5AIF A;  1IT7 A;  4OK0 A;  4H3U A;  3F14 A;  3DM8 A;  1A2V A;  1VQL 3;  3JUQ A;  2CIU A;  2XSH B;  3D3L A;  2MF7 A;  1M1X B;  1S5A A;  2XH9 A;  3CCS 3;  2RCD A;  3DZL A;  2CFD A;  2YFL B;  1JB4 A;  4IPB A;  3CCL 3;  3JUN A;  3OWU A;  2FGT A;  2QGU A;  3DXO A;  3B8L A;  3D9R A;  3G4S 3;  1ZO2 A;  1J2B A;  4WYK A;  3KSP A;  1FGQ A;  5AIH A;  3MG1 A;  3KII A;  4HVN A;  3HIG A;  3G0K A;  4J9A A;  1E97 A;  1STD A;  1IQY A;  3X3X A;  4CDL A;  1W4N A;  2W03 A;  5IG5 A;  1FUW A;  3RGR A;  2PNC A;  4ORL A;  3MHE A;  1E3R A;  1AR0 A;  3G16 A;  3WOD G;  3CCR 3;  2P09 A;  1R4C A;  1FGO A;  3X42 A;  5AIG A;  4EV2 A;  5JPP A;  1BUQ A;  5ELJ A;  2CW9 A;  4WHA A;  4O2H A;  3NQY A;  1IVU A;  3CMA 3;  3CCU 3;  3KE7 A;  5KP3 A;  2CFL A;  1JB2 A;  1TUH A;  1CEW I;  4N6M A;  2W6J H;  1OH0 A;  6STD A;  3PYJ A;  4N6T A;  3EHC A;  4FMA A;  3OWY A;  3BNE A;  4STD A;  1N5H A;  1O7N B;  1Q86 4;  3B4O A;  1Z1S A;  1OUN A;  3I56 3;  1UI7 A;  1W2B 2;  4WWU C;  3UB1 A;  4K61 A;  1QAK A;  4MEI A;  1AVL A;  4RZM A;  4XDW A;  5BXQ A;  1JRQ A;  2OQE A;  2LQV A;  3NBJ A;  2Z77 A;  2W9Q A;  1VQ9 3;  4EV5 A;  1VQ4 3;  3FF2 A;  4N6V 0;  1W6G A;  2CFW A;  1RJO A;  2JDI H;  3L0R A;  2OCT A;  2P0M A;  1YIT 3;  1SJW A;  1STF I;  3MG3 A;  1PU4 A;  4IIA A;  3G71 3;  2C10 A;  3GZY B;  1A90 A;  5D82 A;  1OAC A;  1A67 A;  5IEO A;  3SOA A;  4HBR A;  4HM8 B;  1FGT A;  3LZA A;  4AKY A;  4XBY A;  2CHC A;  1AV4 A;  3H3H A;  3CC7 3;  1EG9 B;  2GEX A;  2OOV C;  4O8S A;  5I97 A;  3LTB A;  4HM2 B;  1N9J A;  4Q53 A;  5AYR B;  3KZT A;  3S28 A;  2OWP A;  4EYC A;  2HMM B;  1LNH A;  2HMN B;  3FG1 A;  1QAF A;  1YJ9 3;  2ZL8 A;  3MG2 A;  1DVC A;  3OX9 A;  2RGQ A;  3EX9 A;  1YHQ 3;  1IDP A;  3CD6 3;  4XBX A;  1LXE A;  5A0O B;  3NM7 A;  2XRX B;  1RRL A;  3B7C A;  3NV0 A;  3G6E 3;  2XGL A;  3SXX A;  1OHO A;  3EJV A;  3KN4 A;  4HYZ A;  1QVG 2;  3EBT A;  1MNL A;  2GBX B;  3PZW A;  3IPT A;  1OGZ A;  3FCS B;  3F8H A;  1KQS 2;  3GZB A;  1VZZ A;  1ULI B;  2WO0 A;  3MYT A;  2OTL 3;  1QVF 2;  4NRE A;  1Y4K A;  2IUJ A;  3OV4 A;  1JKG A;  1VQP 3;  1Q40 A;  4KVH A;  5IER A;  3BLZ A;  2YFI B;  3U1W A;  3NV0 B;  4KFF A;  1F8N A;  1IVW A;  3NM2 A;  3UNL A;  1IK3 A;  4K1V A;  2WOF A;  4N3V A;  1NU3 A;  2D1W A;  1JB5 A;  4CCV A;  1CYV A;  3CC4 3;  2Y73 A;  2CKF B;  1QMA A;  1IV9 A;  1IQX A;  3RDE A;  4I4K A;  5KP4 A;  1NWW A;  4XM4 A;  3LML A;  1VQ8 3;  4R4K A;  2QA4 3;  1SII A;  1OHP A;  7STD A;  2CWT A;  3NHX A;  3FLJ A;  3DMC A;  3S29 A;  1VQ5 3;  3CC2 3;  2CFK A;  3VGN A;  1O7G B;  1O7M B;  1U5O A;  2UX0 A;  2Y74 A;  2K54 A;  3S5C A;  8CHO A;  1TP6 A;  3PS8 A;  2CG0 A;  2FNQ A;  3WA2 X;  4L7K A;  4ZM8 A;  3GZR A;  5D81 A;  3NBR A;  1Q82 4;  1GY7 A;  3QRD A;  3JUO A;  1NDO B;  4HM1 B;  1O7W B;  2BMR B;  3Q1C A;  1M1K 4;  1YJW 3;  2M7O A;  4QWT A;  5EEO A;  5JBS A;  1N8Q A;  2GXF A;  4FR9 A;  1K28 A;  4GB5 A;  2Z76 A;  4N6L A;  2K0M A;  4R1K A;  2BO9 B;  3KFQ C;  5G2G A;  2P0X A;  2PZV A;  5EQL A;  3S67 A;  3ROB A;  5IG3 A;  5FGO A;  2CFG A;  2P38 A;  3A76 A;  2W56 A;  2MC8 A;  1K8A 4;  1NB5 I;  3Q90 A;  2INX A;  2BHM A;  2WOH A;  3F9S A;  2IMJ A;  4BTX A;  2XF3 A;  3QK9 A;  1JN5 B;  1RN7 A;  2FXT A;  3CCJ 3;  1W5Z A;  4FMB A;  3IJE B;  4LMI A;  3CPW 2;  2ZDJ A;  3UL6 A;  2W2C A;  4HM7 B;  4U13 A;  2OTJ 3;  5IF6 A;  1WNH A;  4J8T A;  2SBL A;  1DVD A;  1US1 A;  1YGE A;  2F86 B;  4R80 A;  1TU5 A;  4R9L A;  4HM3 B;  4HZ9 B;  1D6U A;  5D83 A;  1GY6 A;  1OGX A;  3JUM A;  1Q7Y 4;  4FCM A;  1UUW B;  1QAL A;  1ZX2 A;  2F98 A;  4EC6 A;  1JN5 A;  2XGN A;  5HGR A;  3PCR A;  3SX1 A;  1KWI A;  5IG4 A;  4H61 A;  1VQO 3;  1G96 A;  3K9M C;  1HKX A;  1N5P A;  3SLU A;  3AMO B;  3WMD A;  1W2Z A;  4N6U A;  3K7C A;  3MPH A;  2QEX 3;  2L4V A;  1SPU A;  1T5Y A;  1LOX A;  2RFR A;  1UUV B;  3BNB A;  1JNQ A;  5JPU A;  3IMA B;  4O02 B;  2QIY A;  3X40 A;  1YJN 3;  3ALA A;  1EA2 A;  1TIJ A;  3MWZ A;  3V92 A;  3BNC A;  3CME 3;  2HMJ B;  1TFK A;  5AYS C;  2E2U A;  2KCD A;  3NXJ A;  5LC7 A;  3T8U A;  2YFJ B;  3FF0 A;  2XR8 B;  5AII A;  2Z6B A;  1VQ7 3;  2C11 A;  1KD1 4;  3N9H A;  1SIH A;  3EN1 B;  4X2H A;  3V99 A;  4LEH A;  1S72 3;  3PGB A;  1OCV A;  1OHS A;  3TDG A;  3NX0 A;  3DY5 A;  3CNM A;  2ML6 A;  3FSD A;  3WDG B;  5BVB A;  2CG1 A;  2HML B;  1N8R 4;  1CYU A;  3H51 A;  3PXM A;  3OW2 2;  1Q40 B;  5AEW B;  2E2V A;  1FGR A;  3N8B A;  3Q2P A;  4AKZ A;  1ISK A;  3G8Z A;  3F40 A;  1GD4 A;  3CCQ 3;  4X2O A;  1VQ6 3;  3X3Y A;  4OVM A;  1EQK A;  1K41 A;  1D6Y A;  3NBB A;  3LOY A;  2YX9 A;  1TFO A;  5CLK A;  1E3V A;  3DGO A;  3KSE D;  2OOV A;  3MSO A;  5DRE A;  5CF1 A;  1QJG A;  1O7P B;  3K63 A;  3X3Z A;  2BMQ B;  4GL6 A;  4TX4 A;  4K1U A;  3VSY A;  3V98 A;  4JRF A;  3BND A;  2GEY A;  5AEU B;  1N9E A;  1DMM A;  3WOF B;  3EQQ B;  3KKG A;  4LSO A;  4HJL B;  3LYG A;  5IG0 A;  3FG3 A;  4EXR A;  3CCM 3;  2BMO B;  3O8Y A;  1K73 4;  2R4I A;  4MMY B;  4BTW A;  1NJI 4;  1W01 A;  3T8N A;  3HII A;  4FCZ A;  3CNX A;  3DGN A;  1UW1 A;  3RGA A;  1M90 4;  1LVN A;  1ULJ B;  2XFS A;  1PFP A;  1YIJ 3;  1OF5 A;  1W6C A;  2BNG A;  1WQL B;  5LC6 A;  2B24 B;  3ER7 A;  1EKM A;  3EF8 A;  4HM6 B;  4MMZ B;  3HI7 A;  4R9K A;  5CXO A;  5KP1 A;  3CCE 3;  1W02 A;  5DRV A;  2JQ5 A;  4WFO A;  3X41 A;  3EBY A;  3GAX A;  3PCS A;  1IT8 A;  1L5G B;  3UJM A;  3EN8 A;  3SVA A;  1SQW A;  2STD A;  4NHF A;  3CPO A;  2XEP A;  4HM0 B;  3CU3 A;  4KFE A;  2D42 A;  3EC9 A;  1CQS A;  5EVH A;  1WMO A;  2WGO A;  2CK3 H;  1W7C A;  1KSI A;  3K5T A;  3SED A;  3BB9 A;  2I9W A;  5IEP A;  5TGN A;  1WMP A;  1FGM A;  2OQE C;  2O3O A;  3VF1 A;  1IQ8 A;  2HMK B;  4FMD A;  1NB3 I;  3LTD A;  4FCJ A;  1DMN A;  4BTY A;  1VQN 3;  3B4P A;  2LYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...