1CYUA

Solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN A
publication title Solution structure of a human cystatin A variant, cystatin A2-98 M65L, by NMR spectroscopy. A possible role of the interactions between the N- and C-termini to maintain the inhibitory active form of cystatin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteinase inhibitor (cysteine)
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cyuA00
1GD4A 3S67A 1A90A 1EQKA 3MWZA 1KWIA 1NB5I 5LC6A 1CYVA 2BO9B 4CCVA 1LXEA 1N5PA 2CH9A 1M9GA 1FA3A 1G96A 4LZIA 1DVDA 3PYJA 3KSED 3UL5A 5ELUA 2OCTA 3PXMA 1N5HA 1R4CA 5EQLA 1RN7A 4TX4A 3SVAA 4N6V0 1N9JA 1CEWI 4N6UA 1GD3A 3NX0A 3LH4A 4ZM8A 3KFQC 4N6LA 1CYUA 4IT7A 1TIJA 3PS8A 2W9PA 2KXGA 1ROAA 5ELJA 3IMAB 3L0RA 1STFI 4N6TA 1IV7A 2W9QA 4N6MA 5A0OB 1PFPA 4N6OB 3Q2PA 3UL6A 5LC7A 1DVCA 3QRDA 4EYCA 1WNHA 1NB3I 2O9UX 1A67A 1FUWA 3GAXA 4N6NB 1IV9A 1MOLA 3K9MC 1YVBI 1MNLA
chains in the Genus database with same CATH superfamily
1GD4A 1N8QA 3GSPA 1FGTA 3KKGA 1LNHA 2F86B 5JPPA 3BIRA 2W03A 3JUPA 2KF4A 1T3BA 1Z1SA 3CCS3 2KF3A 2GEYA 1PYLA 1UCLA 2ML5A 5IERA 5IG4A 4XBXA 1TTOA 2E2TA 3NHXA 4G1MB 4HM8B 4L7KA 3NBBA 5LC6A 5IG5A 1TU5A 2CFDA 1RRLA 3AGOA 1CYVA 3CNMA 1B2XA 1IVXA 1DYUA 1FUSA 1RJOA 3D5IA 5KP3A 1SIIA 3NQYA 2CW9A 1RRHA 2BO9B 3LXUX 1LXEA 3H51A 1GY6A 1BSCA 1AVKA 1N5PA 2CH9A 2IUJA 3SEDA 1BRHA 2K0MA 1J2BA 7RNTA 1JRQA 1UCKA 3OX9A 3LT8A 3X40A 5HOHA 2FXTA 1FA3A 4HM2B 1FGQA 1NO3A 1JB5A 1JV2B 1BU4A 2STDA 1IYYA 2M7OA 1GOVA 1JZDA 1GY7A 1EKMA 3IJEB 4OK0A 2KAAA 1ZO2A 2QGUA 2XGLA 4R9LA 3PYJA 2PZVA 4GL6A 1IQXA 5ELUA 3ECFA 3NXJA 4RNZA 3H3HA 1W7CA 3K0ZA 4AKZA 3AMOA 2H0HA 3JUQA 1R4CA 3BLZA 1RNBA 2YFIB 3DGNA 4LGQA 4XDWA 3LYGA 1MGRA 4HBRA 3EBYA 3NUVA 1Q814 1YGEA 2BU4A 4TX4A 2CIUA 3QK9A 1NWWA 2UGIA 3AHWA 2I9WA 4HVNA 1QAFA 1W6YA 1Q40A 3ZG0A 4WYKA 1W5ZA 1MWUA 3EF8A 3HX8A 1X1UA 4K1VA 3CNXA 5AIHA 4HM0B 1LRAA 3LH4A 1RHLA 2Z77A 1LOXA 1UGHI 3EBTA 3Q90A 3F7XA 1K28A 5CXOA 2CKFB 3DM8A 3LMLA 1Q42A 4X2OA 3CCE3 3DGMA 4NREA 1FGOA 1O7PB 2E2VA 3B7CA 5M19A 3CXC2 4GHOA 4J5KA 3WA3A 5D83A 1E3RA 3LT9A 2P05A 4FCMA 4HZBB 1OHOA 1TFOA 2L1SA 2OQEA 1N8R4 2UUGC 1HU9A 1ROAA 1I70A 2HOHA 3DMCA 1OUNA 3IMAB 1STFI 3X42A 5TGNA 4N6TA 2INXA 1JBRA 2ZHXB 3G0KA 2LQVA 5EVHA 3K7CA 4HM5B 3CCV3 4N6MA 3O8YA 4R80A 4ILFA 1PFPA 1LOVA 3Q2PA 4N6OB 4RZMA 4IPBA 4EC6A 5IW9A 4HM1B 2W2CA 4EYCA 3AHSA 3G713 2ZA4A 3JUNA 3CME3 1BAOA 5I97A 1NB3I 1G0TA 1BSEA 1CQSA 3WOFB 2FNQA 1YIJ3 2L4VA 1O7HB 2P38A 3E99A 1ISKA 1RTUA 4N6NB 2CX0A 2MF7A 3K9MC 2P0XA 3LOYA 1QVF2 3GRDA 1BIRA 1KSIA 1FYSA 1MNLA 1RGLA 1VQK3 2ZL8A 1Q864 2UX0A 4KFEA 1GSPA 4LYLB 1A90A 5BXQA 3KSPA 1VQ73 3B4PA 1WMPA 1LQGC 2OQEC 3NV0A 4LSOA 1KWIA 1YJW3 1BUJA 3NM7A 5FW5A 3BNBA 4K1UA 5AYSC 2W04A 1FZUA 1K9M4 2GSPA 1VQO3 3S5CA 1SQWA 1JN5B 1B21A 1VQ53 4RBNA 1B2ZA 2CWTA 3AGNA 3FKAA 1QMAA 1VQL3 1EA2A 1Q7HA 1LNIA 2Z76A 1V58A 1VQQA 1GY5A 1I3IA 3EN8A 1M9GA 1K41A 3T0UA 1AR0A 2KF6A 3N8BA 1L5GB 1PU4A 3LTAA 3TDGA 3N54B 1EG9B 4L8OA 2AADA 1N9EA 1VQ63 3MG1A 5IEPA 1RGAA 1TFKA 2D42A 3KN4A 4IIAA 1OH0A 3GZRA 3ROBA 1IU7A 3KSED 1JKGA 4FMAA 3MSOA 7GSPA 2IA7A 3F14A 4STDA 2CG0A 2IUKA 4K61A 1X1XA 2OCTA 2XGNA 5STDA 2CFWA 3VSYA 3LZAA 3UJMA 1GMPA 2YFJB 1FGRA 3S27A 1BGSA 2GEXA 1IQYA 3D79A 2GBXB 3EB8A 4I5QA 1IVVA 1RN7A 1IVWA 1Q7Y4 4FMCA 1QVG2 1VQN3 3FZWA 3KCHA 4N6V0 3STDA 3GWRA 1X1WA 2R4IA 4CPKA 1B20A 1BUQA 4RNTA 1S723 1KD14 1YVSA 1ASKA 3B4OA 1RNTA 3CCJ3 1KC84 1BNGA 1T2HA 4BTYA 1M1XB 1NNVA 4XM4A 3J7Yd 3EHCA 3SX1A 6GSPA 1OPYA 2XEPA 1BNJA 4HJLB 3B8LA 4JF8A 3DH2A 1TIJA 1QALA 4HM4B 4MJDA 3Q1CA 5FGOA 3SOYA 4J8TA 1I2GA 5IENA 2WOHA 4BTXA 2W9PA 2QEX3 1Q9EA 1X1YA 8RNTA 1US1A 3A5EA 3JUMA 2WO0A 3U97A 1JBTA 1ZX2A 1PY3A 3BB9A 3KZTA 3HK4A 2BT3A 5AI1A 1EUIC 4FCJA 4EXRA 1DVCA 3QRDA 2O3OA 1BNSA 2WGOA 3EJVA 4WP5A 1TP6A 4FCZA 1NDOB 2Y73A 1M1K4 1HZ1A 1FUWA 4AKYA 1BRSA 1RMSA 1QAKA 3FG4A 3EX9A 4XB5A 3CD63 2XSOB 5JPUA 5RNTA 3PGBA 1UCIA 1IT7A 3CU3A 4HYZA 4MMZB 3T8NA 4FMDA 2WGQA 3I563 5AEWB 1ZGXA 1CH0A 5BIRA 1IDPA 1Q40B 3S67A 4WYKB 4PEJA 1LVNA 4QWTA 4H3UA 1RGEA 2RSXA 4WHAA 1IK3A 3JUOA 1STDA 1OCVA 3D9RA 3D4AA 4HM3B 2C11A 1SIHA 2RBIA 1I2EA 3CPOA 2OOVA 5KP4A 1BRKA 2GBWB 5D82A 1YIT3 3F7SA 3HOHA 1A2KA 2GU1A 2BIRA 4XBTA 1VZZA 4CCVA 2XR8B 1IQ8A 4HKVB 3VGNA 3CCR3 4RNYA 5AEUB 2SBLA 1DETA 2W56A 4WFOA 1FGMA 2V1LA 1UI7A 3NBRA 3NBJA 2C10A 3RNTA 3URPA 1IVUA 2MC8A 1M904 1BANA 4HAAA 4EBGA 1E97A 1DVDA 3OV4A 3DGYA 4O02B 1UW1A 2BMOB 2HMNB 3G16A 3CMA3 1BSBA 4KT3B 4CDLA 1WTHA 3GZXB 1BNRA 2KF5A 4FR9A 4Q53A 3EN1B 2HMOB 4HM7B 1ROVA 1RCLA 3PXMA 3X3YA 3CCM3 3FLJA 1LQMB 2IYJA 3CCQ3 4ORLA 2CC3A 1VQ83 2GU3A 1RN1A 1YJN3 2YFLB 3RGAA 2FGTA 1W02A 2BNGA 3ZG5A 1W00A 5EQLA 3FG1A 1OF5A 2XH9A 4BL2A 1JJ22 2OOVC 1RGKA 1AVLA 3K5TA 4BTWA 3I0YA 2H0IA 3SVAA 2IMJA 1CEWI 4OUQA 1K8A4 1MWTA 2CFLA 3JVCA 1WQLB 4EV2A 1TRPA 3D3LA 2R41A 2P09A 1MWRA 3ZFZA 3CCL3 4KFDA 3X41A 2JQ5A 1W2ZA 5M1AA 1ULIB 1RGFA 1GYBA 1I3FA 1YGWA 2F4YA 4OVMA 3WMDA 1YHQ3 1A2PA 3PCRA 4N6LA 4H61A 4R4KA 3DY5A 1CYUA 2XRXB 3WOEB 3F40A 1RGCA 1B2SA 1UCJA 2KRTA 3PCSA 4O3VA 5DRVA 4IT7A 4J9AA 3SYUA 3WR2A 5IEOA 3WODG 4EV5A 4GB5A 3ER7A 4N3VA 1NU3A 2F5MA 4O2HA 4KFFA 1GMRA 4HZ9B 1IV7A 1RKYA 1V57A 4MMYB 1UUGB 1W6GA 4JRFA 2OWPA 2W9QA 9RNTA 3OWSA 5A0OB 2CK3H 2HMLB 3FH1A 3BNEA 1GOUA 3KE7A 3WDGB 5G1KA 2CWUA 2Q07A 2ZDJA 5LC7A 1JKGB 3U1WA 2C4BA 5CF2A 1TJDA 1HYFA 1WNHA 2W0QA 1B2MA 3F9SA 3T8UA 3UNLA 2WOFA 4MMXB 1B27A 1A67A 2F56A 4AEQA 5AYRB 2OTJ3 3EQQB 1OHSA 1D6UA 3G8ZA 1FUTA 1DE3A 1OGZA 1QJGA 3OXAA 1MOLA 3MHEA 1VQM3 1O7MB 2P0MA 4X2HA 5CF1A 4WWUC 3SLUA 5KP1A 1BSDA 1IT8A 3KIIA 3X3XA 1JNQA 7STDA 1ULJB 2BMQB 3F8HA 1OGXA 1EQKA 1GOYA 5BU4A 3MWZA 3DXOA 4HOHA 3EC9A 2F99A 2ML6A 4O8SA 4GSPA 3S29A 1Q824 1JBSA 4DKIA 3ALAA 1NB5I 3HIGA 2KCDA 3GZYB 4NPBA 1BOXA 5EEOA 5M18A 1OACA 3FF0A 1D6YA 1Y4KA 4EW5A 3DGOA 2F5WA 1AQZA 3OWUA 1RN4A 2AAEA 5IG0A 3AMOB 4BIRA 3CC73 2XSHB 1BNFA 4XBYA 1RDSA 1SARA 1WMNA 6STDA 5IG3A 3RDEA 1YJ93 2JDIH 3NM2A 2K54A 2HMMB 3CPW2 1BVIA 4J5GA 1I2FA 6RNTA 1TUHA 2CFGA 1HKXA 1G96A 3BNDA 4LZIA 1ZS7A 4XDVA 3SXXA 3HZPA 3F8XA 1G02A 1UUVB 5DREA 1BRNL 1MWSA 1VQ93 8CHOA 3I553 3CCU3 2RCDA 3EE1A 3UL5A 1FW7A 1YNVX 1W01A 1MGWA 3WA2X 1LOWA 2BHMA 3MKIA 1BRIA 5D81A 3V92A 1N5HA 2CFKA 2W6JH 4BU4A 5IF6A 1T2IA 3GZBA 1W4NA 2HMJB 1E3VA 1RSNA 4FMBA 2GXFA 2YX9A 3WHOA 3M8CA 2CX1A 1DMMA 3D5GA 2CHCA 3K63A 1UUWB 2F98A 3S28A 3LTDA 5G2GA 2XFSA 1N9JA 1C7HA 4LMIA 2D1WA 3DUKA 2RGQA 2RNTA 4N6UA 3Q3FA 4KZ1A 2SARA 3NQZA 1O7GB 1GD3A 3A76A 3HI7A 4BL3A 1UI8A 3NX0A 1F8NA 4R1KA 4CJNA 4ZM8A 3FSDA 2QIYA 3G6E3 2LYXA 1B2UA 3MYTA 1BSAA 1BNIA 1JN5A 3BNCA 3IPTA 3KFQC 5CK6A 5CLKA 1K734 4MEIA 4HM6B 3G4S3 3N9HA 4LEHA 1JZOA 1RLSA 3VF1A 1RCKA 1SPUA 1GS3A 1UDII 1OHPA 2RFRA 3LTCA 1SJWA 1AV4A 1RGGA 2IY2A 5JBSA 1DMQA 1I0VA 1YI23 3UB1A 2W56B 3FGYA 5AIFA 3MPHA 3MG3A 1U5OA 4U13A 3PS8A 5G1LA 1BRJA 1O7NB 3V99A 2KXGA 4I4KA 1EEJA 4K90B 5ELJA 2QA43 3DGLA 3L0RA 1NJI4 1A2VA 5AIGA 3MG2A 1AY7A 3FF2A 2CG1A 4R9KA 1O7WB 2E2UA 1UGIA 2J8XB 1V74A 1BNEA 3HIIA 1W2B2 1I0XA 2H0GA 1GMQA 1JB4A 2XF3A 3RGRA 4KVHA 1U8CB 1VQ43 4NHFA 3NV0B 3OW22 3UL6A 1WMOA 1KQS2 1C54A 1RGHA 3SOAA 2B1XB 4L8PA 1I8VA 2CWVA 1JB2A 3FG3A 1VQP3 2OTL3 2PNCA 5HGRA 2B24B 2O9UX 3V98A 1BRGA 3X3ZA 1D6ZA 2Z6BA 2BMRB 1LOYA 3DZLA 5BVBA 1T5YA 1W6CA 3GAXA 1TRQA 1B3SA 3PZWA 1OF5B 2HMKB 1IV9A 2Y74A 1DMNA 1S5AA 2A15A 2Z7AA 5GSPA 1YVBI 2K3DA 3BU4A 3CC23 3CC43 3LTBA 1R4YA 3OWYA 2XFTA 5AIIA 3FCSB
chains in the Genus database with same CATH topology
1GD4A 1N8QA 3KKGA 1FGTA 1LNHA 2F86B 5JPPA 2W03A 3JUPA 1Z1SA 3CCS3 2GEYA 2ML5A 5IERA 5IG4A 4XBXA 2E2TA 3NHXA 4G1MB 4HM8B 4L7KA 5IG5A 3NBBA 5LC6A 1TU5A 2CFDA 1RRLA 1CYVA 3CNMA 1IVXA 1DYUA 1RJOA 5KP3A 1SIIA 3NQYA 2CW9A 1RRHA 2BO9B 3LXUX 1LXEA 3H51A 1GY6A 1AVKA 1N5PA 2CH9A 2IUJA 3SEDA 2K0MA 1J2BA 1JRQA 3OX9A 3LT8A 3X40A 2FXTA 1FA3A 4HM2B 1FGQA 1NO3A 1JB5A 1JV2B 2STDA 2M7OA 1GY7A 1EKMA 3IJEB 4OK0A 1ZO2A 2QGUA 2XGLA 4R9LA 3PYJA 2PZVA 4GL6A 1IQXA 5ELUA 3ECFA 3NXJA 4RNZA 3H3HA 1W7CA 3K0ZA 4AKZA 3AMOA 3JUQA 1R4CA 3BLZA 2YFIB 3DGNA 4LGQA 4XDWA 3LYGA 4HBRA 3EBYA 3NUVA 1Q814 1YGEA 4TX4A 2CIUA 3QK9A 1NWWA 2I9WA 4HVNA 1QAFA 1W6YA 1Q40A 4WYKA 1W5ZA 3EF8A 3HX8A 4K1VA 3CNXA 5AIHA 4HM0B 3LH4A 2Z77A 1LOXA 3EBTA 3Q90A 3F7XA 1K28A 5CXOA 2CKFB 3DM8A 3LMLA 1Q42A 4X2OA 3CCE3 3DGMA 4NREA 1FGOA 1O7PB 2E2VA 3B7CA 3CXC2 3WA3A 5D83A 1E3RA 3LT9A 2P05A 4FCMA 4HZBB 1OHOA 1TFOA 2OQEA 1N8R4 1HU9A 1ROAA 3X42A 3DMCA 3IMAB 1OUNA 1STFI 5TGNA 4N6TA 2INXA 3G0KA 2LQVA 5EVHA 3K7CA 4HM5B 3CCV3 4N6MA 3O8YA 4R80A 1PFPA 4N6OB 3Q2PA 4RZMA 5IW9A 4IPBA 4EC6A 4HM1B 2W2CA 4EYCA 3G713 3JUNA 3CME3 5I97A 1NB3I 1CQSA 3WOFB 2FNQA 1YIJ3 2L4VA 1O7HB 2P38A 3E99A 1ISKA 4N6NB 2MF7A 3K9MC 2P0XA 3LOYA 1QVF2 3GRDA 1KSIA 1MNLA 1VQK3 2ZL8A 1Q864 2UX0A 4KFEA 1A90A 5BXQA 3KSPA 1VQ73 3B4PA 1WMPA 2OQEC 3NV0A 4LSOA 1YJW3 1KWIA 3NM7A 5FW5A 3BNBA 4K1UA 5AYSC 2W04A 1K9M4 1VQO3 3S5CA 1SQWA 1JN5B 1VQ53 4RBNA 2CWTA 3FKAA 1QMAA 1VQL3 1EA2A 2Z76A 1GY5A 3EN8A 1M9GA 1K41A 3T0UA 1AR0A 3N8BA 1L5GB 1PU4A 3LTAA 3TDGA 3N54B 1EG9B 4L8OA 1N9EA 1VQ63 3MG1A 5IEPA 1TFKA 2D42A 3KN4A 4IIAA 1OH0A 3GZRA 3ROBA 1IU7A 3KSED 1JKGA 4FMAA 3MSOA 2IA7A 3F14A 4STDA 2CG0A 2IUKA 4K61A 2OCTA 2XGNA 5STDA 2CFWA 3VSYA 3LZAA 3UJMA 2YFJB 1FGRA 3S27A 2GEXA 1IQYA 2GBXB 3EB8A 1IVVA 1RN7A 1IVWA 1Q7Y4 4FMCA 1QVG2 1VQN3 3FZWA 4N6V0 3STDA 3GWRA 2R4IA 1BUQA 1S723 1KD14 3B4OA 1ASKA 3CCJ3 1KC84 4BTYA 1M1XB 4XM4A 3J7Yd 3EHCA 3SX1A 1OPYA 2XEPA 4HJLB 4JF8A 3B8LA 1TIJA 1QALA 4HM4B 4MJDA 3Q1CA 5FGOA 3SOYA 4J8TA 5IENA 2WOHA 4BTXA 2W9PA 2QEX3 1US1A 3JUMA 2WO0A 3U97A 1ZX2A 3BB9A 3KZTA 2BT3A 5AI1A 4FCJA 4EXRA 1DVCA 3QRDA 2O3OA 2WGOA 3EJVA 4WP5A 1TP6A 4FCZA 1NDOB 2Y73A 1M1K4 1FUWA 4AKYA 1QAKA 3FG4A 3EX9A 4XB5A 3CD63 2XSOB 5JPUA 3PGBA 1IT7A 3CU3A 4HYZA 4MMZB 3T8NA 4FMDA 2WGQA 3I563 5AEWB 1IDPA 1Q40B 3S67A 4WYKB 4PEJA 1LVNA 4QWTA 4H3UA 2RSXA 4WHAA 1IK3A 3JUOA 1STDA 1OCVA 3D9RA 4HM3B 2C11A 1SIHA 3CPOA 2OOVA 5KP4A 2GBWB 5D82A 1YIT3 3F7SA 1A2KA 2GU1A 4XBTA 1VZZA 4CCVA 2XR8B 1IQ8A 4HKVB 3VGNA 3CCR3 4RNYA 5AEUB 2SBLA 2W56A 4WFOA 1FGMA 2V1LA 1UI7A 3NBRA 3NBJA 2C10A 1IVUA 2MC8A 1M904 4EBGA 1E97A 1DVDA 3OV4A 4O02B 1UW1A 2BMOB 2HMNB 3G16A 3CMA3 4CDLA 1WTHA 3GZXB 4FR9A 4Q53A 3EN1B 2HMOB 4HM7B 1ROVA 3PXMA 3X3YA 3CCM3 3FLJA 3CCQ3 4ORLA 2CC3A 1VQ83 2GU3A 1YJN3 2YFLB 3RGAA 2FGTA 1W02A 2BNGA 1W00A 5EQLA 3FG1A 1OF5A 2XH9A 1JJ22 2OOVC 3K5TA 1AVLA 4BTWA 3I0YA 3SVAA 2IMJA 1CEWI 4OUQA 1K8A4 2CFLA 3JVCA 1WQLB 4EV2A 3D3LA 2P09A 3CCL3 4KFDA 3X41A 2JQ5A 1W2ZA 1ULIB 1GYBA 3WMDA 4OVMA 1YHQ3 3PCRA 4N6LA 4H61A 4R4KA 3DY5A 1CYUA 2XRXB 3WOEB 3F40A 4O3VA 3PCSA 2KRTA 5DRVA 4IT7A 4J9AA 4EV5A 5IEOA 3WODG 4GB5A 3ER7A 4N3VA 1NU3A 4O2HA 4KFFA 4HZ9B 1IV7A 1RKYA 4MMYB 1W6GA 4JRFA 2OWPA 2W9QA 3OWSA 5A0OB 2CK3H 2HMLB 3FH1A 3BNEA 3KE7A 3WDGB 2CWUA 2Q07A 2ZDJA 5LC7A 1JKGB 3U1WA 5CF2A 1WNHA 2W0QA 3F9SA 3T8UA 3UNLA 2WOFA 4MMXB 1A67A 4AEQA 5AYRB 2OTJ3 3EQQB 1OHSA 1D6UA 3G8ZA 1OGZA 1QJGA 3OXAA 1MOLA 3MHEA 1VQM3 1O7MB 2P0MA 4X2HA 5CF1A 4WWUC 3SLUA 5KP1A 1IT8A 3KIIA 3X3XA 1JNQA 7STDA 1ULJB 2BMQB 3F8HA 1OGXA 1EQKA 3MWZA 3DXOA 3EC9A 2F99A 2ML6A 4O8SA 3S29A 1Q824 3ALAA 1NB5I 3HIGA 2KCDA 3GZYB 5EEOA 1OACA 3FF0A 1D6YA 1Y4KA 3DGOA 3OWUA 5IG0A 3AMOB 3CC73 2XSHB 4XBYA 1WMNA 6STDA 5IG3A 3RDEA 1YJ93 2JDIH 3NM2A 2K54A 2HMMB 3CPW2 1TUHA 2CFGA 1HKXA 1G96A 3BNDA 4LZIA 4XDVA 3SXXA 3HZPA 3F8XA 1UUVB 5DREA 1VQ93 8CHOA 3I553 3CCU3 2RCDA 3EE1A 3UL5A 1W01A 3WA2X 3MKIA 2BHMA 3V92A 5D81A 1N5HA 2CFKA 2W6JH 5IF6A 3GZBA 1W4NA 2HMJB 1E3VA 4FMBA 2GXFA 2YX9A 3M8CA 1DMMA 2CHCA 3K63A 1UUWB 2F98A 3S28A 3LTDA 5G2GA 2XFSA 1N9JA 1C7HA 4LMIA 2D1WA 3DUKA 2RGQA 4N6UA 4KZ1A 3NQZA 1O7GB 1GD3A 3A76A 3HI7A 1UI8A 3NX0A 1F8NA 4R1KA 4ZM8A 3G6E3 3FSDA 2QIYA 2LYXA 3MYTA 1JN5A 3BNCA 3IPTA 3KFQC 5CLKA 5CK6A 1K734 4MEIA 4HM6B 3G4S3 3N9HA 4LEHA 3VF1A 1SPUA 1GS3A 1OHPA 2RFRA 3LTCA 1SJWA 1AV4A 5JBSA 1YI23 1DMQA 3UB1A 2W56B 3FGYA 5AIFA 3MPHA 3MG3A 1U5OA 4U13A 3PS8A 1O7NB 3V99A 2KXGA 4I4KA 4K90B 5ELJA 2QA43 3DGLA 3L0RA 1NJI4 1A2VA 5AIGA 3MG2A 2CG1A 3FF2A 4R9KA 1O7WB 2E2UA 1V74A 3HIIA 1W2B2 1JB4A 2XF3A 3RGRA 4KVHA 1U8CB 1VQ43 4NHFA 3NV0B 3OW22 3UL6A 1WMOA 1KQS2 3SOAA 2B1XB 4L8PA 2CWVA 1JB2A 3FG3A 1VQP3 2OTL3 2PNCA 5HGRA 2B24B 2O9UX 3V98A 3X3ZA 1D6ZA 2Z6BA 2BMRB 3DZLA 5BVBA 1T5YA 1W6CA 3GAXA 3PZWA 1OF5B 2Z7AA 2Y74A 1IV9A 1DMNA 1S5AA 2A15A 2HMKB 1YVBI 3CC23 3CC43 3LTBA 3HK4A 3OWYA 2XFTA 5AIIA 3FCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD4 A;  3S67 A;  1A90 A;  1EQK A;  3MWZ A;  1KWI A;  1NB5 I;  5LC6 A;  1CYV A;  2BO9 B;  4CCV A;  1LXE A;  1N5P A;  2CH9 A;  1M9G A;  1FA3 A;  1G96 A;  4LZI A;  1DVD A;  3PYJ A;  3KSE D;  3UL5 A;  5ELU A;  2OCT A;  3PXM A;  1N5H A;  1R4C A;  5EQL A;  1RN7 A;  4TX4 A;  3SVA A;  4N6V 0;  1N9J A;  1CEW I;  4N6U A;  1GD3 A;  3NX0 A;  3LH4 A;  4ZM8 A;  3KFQ C;  4N6L A;  1CYU A;  4IT7 A;  1TIJ A;  3PS8 A;  2W9P A;  2KXG A;  1ROA A;  5ELJ A;  3IMA B;  3L0R A;  1STF I;  4N6T A;  1IV7 A;  2W9Q A;  4N6M A;  5A0O B;  1PFP A;  4N6O B;  3Q2P A;  3UL6 A;  5LC7 A;  1DVC A;  3QRD A;  4EYC A;  1WNH A;  1NB3 I;  2O9U X;  1A67 A;  1FUW A;  3GAX A;  4N6N B;  1IV9 A;  1MOL A;  3K9M C;  1YVB I;  1MNL A; 
#chains in the Genus database with same CATH topology
 1GD4 A;  1N8Q A;  3GSP A;  1FGT A;  3KKG A;  1LNH A;  2F86 B;  5JPP A;  3BIR A;  2W03 A;  3JUP A;  2KF4 A;  1T3B A;  1Z1S A;  3CCS 3;  2KF3 A;  2GEY A;  1PYL A;  1UCL A;  2ML5 A;  5IER A;  5IG4 A;  4XBX A;  1TTO A;  2E2T A;  3NHX A;  4G1M B;  4HM8 B;  4L7K A;  3NBB A;  5LC6 A;  5IG5 A;  1TU5 A;  2CFD A;  1RRL A;  3AGO A;  1CYV A;  3CNM A;  1B2X A;  1IVX A;  1DYU A;  1FUS A;  1RJO A;  3D5I A;  5KP3 A;  1SII A;  3NQY A;  2CW9 A;  1RRH A;  2BO9 B;  3LXU X;  1LXE A;  3H51 A;  1GY6 A;  1BSC A;  1AVK A;  1N5P A;  2CH9 A;  2IUJ A;  3SED A;  1BRH A;  2K0M A;  1J2B A;  7RNT A;  1JRQ A;  1UCK A;  3OX9 A;  3LT8 A;  3X40 A;  5HOH A;  2FXT A;  1FA3 A;  4HM2 B;  1FGQ A;  1NO3 A;  1JB5 A;  1JV2 B;  1BU4 A;  2STD A;  1IYY A;  2M7O A;  1GOV A;  1JZD A;  1GY7 A;  1EKM A;  3IJE B;  4OK0 A;  2KAA A;  1ZO2 A;  2QGU A;  2XGL A;  4R9L A;  3PYJ A;  2PZV A;  4GL6 A;  1IQX A;  5ELU A;  3ECF A;  3NXJ A;  4RNZ A;  3H3H A;  1W7C A;  3K0Z A;  4AKZ A;  3AMO A;  2H0H A;  3JUQ A;  1R4C A;  3BLZ A;  1RNB A;  2YFI B;  3DGN A;  4LGQ A;  4XDW A;  3LYG A;  1MGR A;  4HBR A;  3EBY A;  3NUV A;  1Q81 4;  1YGE A;  2BU4 A;  4TX4 A;  2CIU A;  3QK9 A;  1NWW A;  2UGI A;  3AHW A;  2I9W A;  4HVN A;  1QAF A;  1W6Y A;  1Q40 A;  3ZG0 A;  4WYK A;  1W5Z A;  1MWU A;  3EF8 A;  3HX8 A;  1X1U A;  4K1V A;  3CNX A;  5AIH A;  4HM0 B;  1LRA A;  3LH4 A;  1RHL A;  2Z77 A;  1LOX A;  1UGH I;  3EBT A;  3Q90 A;  3F7X A;  1K28 A;  5CXO A;  2CKF B;  3DM8 A;  3LML A;  1Q42 A;  4X2O A;  3CCE 3;  3DGM A;  4NRE A;  1FGO A;  1O7P B;  2E2V A;  3B7C A;  5M19 A;  3CXC 2;  4GHO A;  4J5K A;  3WA3 A;  5D83 A;  1E3R A;  3LT9 A;  2P05 A;  4FCM A;  4HZB B;  1OHO A;  1TFO A;  2L1S A;  2OQE A;  1N8R 4;  2UUG C;  1HU9 A;  1ROA A;  1I70 A;  2HOH A;  3DMC A;  1OUN A;  3IMA B;  1STF I;  3X42 A;  5TGN A;  4N6T A;  2INX A;  1JBR A;  2ZHX B;  3G0K A;  2LQV A;  5EVH A;  3K7C A;  4HM5 B;  3CCV 3;  4N6M A;  3O8Y A;  4R80 A;  4ILF A;  1PFP A;  1LOV A;  3Q2P A;  4N6O B;  4RZM A;  4IPB A;  4EC6 A;  5IW9 A;  4HM1 B;  2W2C A;  4EYC A;  3AHS A;  3G71 3;  2ZA4 A;  3JUN A;  3CME 3;  1BAO A;  5I97 A;  1NB3 I;  1G0T A;  1BSE A;  1CQS A;  3WOF B;  2FNQ A;  1YIJ 3;  2L4V A;  1O7H B;  2P38 A;  3E99 A;  1ISK A;  1RTU A;  4N6N B;  2CX0 A;  2MF7 A;  3K9M C;  2P0X A;  3LOY A;  1QVF 2;  3GRD A;  1BIR A;  1KSI A;  1FYS A;  1MNL A;  1RGL A;  1VQK 3;  2ZL8 A;  1Q86 4;  2UX0 A;  4KFE A;  1GSP A;  4LYL B;  1A90 A;  5BXQ A;  3KSP A;  1VQ7 3;  3B4P A;  1WMP A;  1LQG C;  2OQE C;  3NV0 A;  4LSO A;  1KWI A;  1YJW 3;  1BUJ A;  3NM7 A;  5FW5 A;  3BNB A;  4K1U A;  5AYS C;  2W04 A;  1FZU A;  1K9M 4;  2GSP A;  1VQO 3;  3S5C A;  1SQW A;  1JN5 B;  1B21 A;  1VQ5 3;  4RBN A;  1B2Z A;  2CWT A;  3AGN A;  3FKA A;  1QMA A;  1VQL 3;  1EA2 A;  1Q7H A;  1LNI A;  2Z76 A;  1V58 A;  1VQQ A;  1GY5 A;  1I3I A;  3EN8 A;  1M9G A;  1K41 A;  3T0U A;  1AR0 A;  2KF6 A;  3N8B A;  1L5G B;  1PU4 A;  3LTA A;  3TDG A;  3N54 B;  1EG9 B;  4L8O A;  2AAD A;  1N9E A;  1VQ6 3;  3MG1 A;  5IEP A;  1RGA A;  1TFK A;  2D42 A;  3KN4 A;  4IIA A;  1OH0 A;  3GZR A;  3ROB A;  1IU7 A;  3KSE D;  1JKG A;  4FMA A;  3MSO A;  7GSP A;  2IA7 A;  3F14 A;  4STD A;  2CG0 A;  2IUK A;  4K61 A;  1X1X A;  2OCT A;  2XGN A;  5STD A;  2CFW A;  3VSY A;  3LZA A;  3UJM A;  1GMP A;  2YFJ B;  1FGR A;  3S27 A;  1BGS A;  2GEX A;  1IQY A;  3D79 A;  2GBX B;  3EB8 A;  4I5Q A;  1IVV A;  1RN7 A;  1IVW A;  1Q7Y 4;  4FMC A;  1QVG 2;  1VQN 3;  3FZW A;  3KCH A;  4N6V 0;  3STD A;  3GWR A;  1X1W A;  2R4I A;  4CPK A;  1B20 A;  1BUQ A;  4RNT A;  1S72 3;  1KD1 4;  1YVS A;  1ASK A;  3B4O A;  1RNT A;  3CCJ 3;  1KC8 4;  1BNG A;  1T2H A;  4BTY A;  1M1X B;  1NNV A;  4XM4 A;  3J7Y d;  3EHC A;  3SX1 A;  6GSP A;  1OPY A;  2XEP A;  1BNJ A;  4HJL B;  3B8L A;  4JF8 A;  3DH2 A;  1TIJ A;  1QAL A;  4HM4 B;  4MJD A;  3Q1C A;  5FGO A;  3SOY A;  4J8T A;  1I2G A;  5IEN A;  2WOH A;  4BTX A;  2W9P A;  2QEX 3;  1Q9E A;  1X1Y A;  8RNT A;  1US1 A;  3A5E A;  3JUM A;  2WO0 A;  3U97 A;  1JBT A;  1ZX2 A;  1PY3 A;  3BB9 A;  3KZT A;  3HK4 A;  2BT3 A;  5AI1 A;  1EUI C;  4FCJ A;  4EXR A;  1DVC A;  3QRD A;  2O3O A;  1BNS A;  2WGO A;  3EJV A;  4WP5 A;  1TP6 A;  4FCZ A;  1NDO B;  2Y73 A;  1M1K 4;  1HZ1 A;  1FUW A;  4AKY A;  1BRS A;  1RMS A;  1QAK A;  3FG4 A;  3EX9 A;  4XB5 A;  3CD6 3;  2XSO B;  5JPU A;  5RNT A;  3PGB A;  1UCI A;  1IT7 A;  3CU3 A;  4HYZ A;  4MMZ B;  3T8N A;  4FMD A;  2WGQ A;  3I56 3;  5AEW B;  1ZGX A;  1CH0 A;  5BIR A;  1IDP A;  1Q40 B;  3S67 A;  4WYK B;  4PEJ A;  1LVN A;  4QWT A;  4H3U A;  1RGE A;  2RSX A;  4WHA A;  1IK3 A;  3JUO A;  1STD A;  1OCV A;  3D9R A;  3D4A A;  4HM3 B;  2C11 A;  1SIH A;  2RBI A;  1I2E A;  3CPO A;  2OOV A;  5KP4 A;  1BRK A;  2GBW B;  5D82 A;  1YIT 3;  3F7S A;  3HOH A;  1A2K A;  2GU1 A;  2BIR A;  4XBT A;  1VZZ A;  4CCV A;  2XR8 B;  1IQ8 A;  4HKV B;  3VGN A;  3CCR 3;  4RNY A;  5AEU B;  2SBL A;  1DET A;  2W56 A;  4WFO A;  1FGM A;  2V1L A;  1UI7 A;  3NBR A;  3NBJ A;  2C10 A;  3RNT A;  3URP A;  1IVU A;  2MC8 A;  1M90 4;  1BAN A;  4HAA A;  4EBG A;  1E97 A;  1DVD A;  3OV4 A;  3DGY A;  4O02 B;  1UW1 A;  2BMO B;  2HMN B;  3G16 A;  3CMA 3;  1BSB A;  4KT3 B;  4CDL A;  1WTH A;  3GZX B;  1BNR A;  2KF5 A;  4FR9 A;  4Q53 A;  3EN1 B;  2HMO B;  4HM7 B;  1ROV A;  1RCL A;  3PXM A;  3X3Y A;  3CCM 3;  3FLJ A;  1LQM B;  2IYJ A;  3CCQ 3;  4ORL A;  2CC3 A;  1VQ8 3;  2GU3 A;  1RN1 A;  1YJN 3;  2YFL B;  3RGA A;  2FGT A;  1W02 A;  2BNG A;  3ZG5 A;  1W00 A;  5EQL A;  3FG1 A;  1OF5 A;  2XH9 A;  4BL2 A;  1JJ2 2;  2OOV C;  1RGK A;  1AVL A;  3K5T A;  4BTW A;  3I0Y A;  2H0I A;  3SVA A;  2IMJ A;  1CEW I;  4OUQ A;  1K8A 4;  1MWT A;  2CFL A;  3JVC A;  1WQL B;  4EV2 A;  1TRP A;  3D3L A;  2R41 A;  2P09 A;  1MWR A;  3ZFZ A;  3CCL 3;  4KFD A;  3X41 A;  2JQ5 A;  1W2Z A;  5M1A A;  1ULI B;  1RGF A;  1GYB A;  1I3F A;  1YGW A;  2F4Y A;  4OVM A;  3WMD A;  1YHQ 3;  1A2P A;  3PCR A;  4N6L A;  4H61 A;  4R4K A;  3DY5 A;  1CYU A;  2XRX B;  3WOE B;  3F40 A;  1RGC A;  1B2S A;  1UCJ A;  2KRT A;  3PCS A;  4O3V A;  5DRV A;  4IT7 A;  4J9A A;  3SYU A;  3WR2 A;  5IEO A;  3WOD G;  4EV5 A;  4GB5 A;  3ER7 A;  4N3V A;  1NU3 A;  2F5M A;  4O2H A;  4KFF A;  1GMR A;  4HZ9 B;  1IV7 A;  1RKY A;  1V57 A;  4MMY B;  1UUG B;  1W6G A;  4JRF A;  2OWP A;  2W9Q A;  9RNT A;  3OWS A;  5A0O B;  2CK3 H;  2HML B;  3FH1 A;  3BNE A;  1GOU A;  3KE7 A;  3WDG B;  5G1K A;  2CWU A;  2Q07 A;  2ZDJ A;  5LC7 A;  1JKG B;  3U1W A;  2C4B A;  5CF2 A;  1TJD A;  1HYF A;  1WNH A;  2W0Q A;  1B2M A;  3F9S A;  3T8U A;  3UNL A;  2WOF A;  4MMX B;  1B27 A;  1A67 A;  2F56 A;  4AEQ A;  5AYR B;  2OTJ 3;  3EQQ B;  1OHS A;  1D6U A;  3G8Z A;  1FUT A;  1DE3 A;  1OGZ A;  1QJG A;  3OXA A;  1MOL A;  3MHE A;  1VQM 3;  1O7M B;  2P0M A;  4X2H A;  5CF1 A;  4WWU C;  3SLU A;  5KP1 A;  1BSD A;  1IT8 A;  3KII A;  3X3X A;  1JNQ A;  7STD A;  1ULJ B;  2BMQ B;  3F8H A;  1OGX A;  1EQK A;  1GOY A;  5BU4 A;  3MWZ A;  3DXO A;  4HOH A;  3EC9 A;  2F99 A;  2ML6 A;  4O8S A;  4GSP A;  3S29 A;  1Q82 4;  1JBS A;  4DKI A;  3ALA A;  1NB5 I;  3HIG A;  2KCD A;  3GZY B;  4NPB A;  1BOX A;  5EEO A;  5M18 A;  1OAC A;  3FF0 A;  1D6Y A;  1Y4K A;  4EW5 A;  3DGO A;  2F5W A;  1AQZ A;  3OWU A;  1RN4 A;  2AAE A;  5IG0 A;  3AMO B;  4BIR A;  3CC7 3;  2XSH B;  1BNF A;  4XBY A;  1RDS A;  1SAR A;  1WMN A;  6STD A;  5IG3 A;  3RDE A;  1YJ9 3;  2JDI H;  3NM2 A;  2K54 A;  2HMM B;  3CPW 2;  1BVI A;  4J5G A;  1I2F A;  6RNT A;  1TUH A;  2CFG A;  1HKX A;  1G96 A;  3BND A;  4LZI A;  1ZS7 A;  4XDV A;  3SXX A;  3HZP A;  3F8X A;  1G02 A;  1UUV B;  5DRE A;  1BRN L;  1MWS A;  1VQ9 3;  8CHO A;  3I55 3;  3CCU 3;  2RCD A;  3EE1 A;  3UL5 A;  1FW7 A;  1YNV X;  1W01 A;  1MGW A;  3WA2 X;  1LOW A;  2BHM A;  3MKI A;  1BRI A;  5D81 A;  3V92 A;  1N5H A;  2CFK A;  2W6J H;  4BU4 A;  5IF6 A;  1T2I A;  3GZB A;  1W4N A;  2HMJ B;  1E3V A;  1RSN A;  4FMB A;  2GXF A;  2YX9 A;  3WHO A;  3M8C A;  2CX1 A;  1DMM A;  3D5G A;  2CHC A;  3K63 A;  1UUW B;  2F98 A;  3S28 A;  3LTD A;  5G2G A;  2XFS A;  1N9J A;  1C7H A;  4LMI A;  2D1W A;  3DUK A;  2RGQ A;  2RNT A;  4N6U A;  3Q3F A;  4KZ1 A;  2SAR A;  3NQZ A;  1O7G B;  1GD3 A;  3A76 A;  3HI7 A;  4BL3 A;  1UI8 A;  3NX0 A;  1F8N A;  4R1K A;  4CJN A;  4ZM8 A;  3FSD A;  2QIY A;  3G6E 3;  2LYX A;  1B2U A;  3MYT A;  1BSA A;  1BNI A;  1JN5 A;  3BNC A;  3IPT A;  3KFQ C;  5CK6 A;  5CLK A;  1K73 4;  4MEI A;  4HM6 B;  3G4S 3;  3N9H A;  4LEH A;  1JZO A;  1RLS A;  3VF1 A;  1RCK A;  1SPU A;  1GS3 A;  1UDI I;  1OHP A;  2RFR A;  3LTC A;  1SJW A;  1AV4 A;  1RGG A;  2IY2 A;  5JBS A;  1DMQ A;  1I0V A;  1YI2 3;  3UB1 A;  2W56 B;  3FGY A;  5AIF A;  3MPH A;  3MG3 A;  1U5O A;  4U13 A;  3PS8 A;  5G1L A;  1BRJ A;  1O7N B;  3V99 A;  2KXG A;  4I4K A;  1EEJ A;  4K90 B;  5ELJ A;  2QA4 3;  3DGL A;  3L0R A;  1NJI 4;  1A2V A;  5AIG A;  3MG2 A;  1AY7 A;  3FF2 A;  2CG1 A;  4R9K A;  1O7W B;  2E2U A;  1UGI A;  2J8X B;  1V74 A;  1BNE A;  3HII A;  1W2B 2;  1I0X A;  2H0G A;  1GMQ A;  1JB4 A;  2XF3 A;  3RGR A;  4KVH A;  1U8C B;  1VQ4 3;  4NHF A;  3NV0 B;  3OW2 2;  3UL6 A;  1WMO A;  1KQS 2;  1C54 A;  1RGH A;  3SOA A;  2B1X B;  4L8P A;  1I8V A;  2CWV A;  1JB2 A;  3FG3 A;  1VQP 3;  2OTL 3;  2PNC A;  5HGR A;  2B24 B;  2O9U X;  3V98 A;  1BRG A;  3X3Z A;  1D6Z A;  2Z6B A;  2BMR B;  1LOY A;  3DZL A;  5BVB A;  1T5Y A;  1W6C A;  3GAX A;  1TRQ A;  1B3S A;  3PZW A;  1OF5 B;  2HMK B;  1IV9 A;  2Y74 A;  1DMN A;  1S5A A;  2A15 A;  2Z7A A;  5GSP A;  1YVB I;  2K3D A;  3BU4 A;  3CC2 3;  3CC4 3;  3LTB A;  1R4Y A;  3OWY A;  2XFT A;  5AII A;  3FCS B; 
#chains in the Genus database with same CATH homology
 1GD4 A;  1N8Q A;  3KKG A;  1FGT A;  1LNH A;  2F86 B;  5JPP A;  2W03 A;  3JUP A;  1Z1S A;  3CCS 3;  2GEY A;  2ML5 A;  5IER A;  5IG4 A;  4XBX A;  2E2T A;  3NHX A;  4G1M B;  4HM8 B;  4L7K A;  5IG5 A;  3NBB A;  5LC6 A;  1TU5 A;  2CFD A;  1RRL A;  1CYV A;  3CNM A;  1IVX A;  1DYU A;  1RJO A;  5KP3 A;  1SII A;  3NQY A;  2CW9 A;  1RRH A;  2BO9 B;  3LXU X;  1LXE A;  3H51 A;  1GY6 A;  1AVK A;  1N5P A;  2CH9 A;  2IUJ A;  3SED A;  2K0M A;  1J2B A;  1JRQ A;  3OX9 A;  3LT8 A;  3X40 A;  2FXT A;  1FA3 A;  4HM2 B;  1FGQ A;  1NO3 A;  1JB5 A;  1JV2 B;  2STD A;  2M7O A;  1GY7 A;  1EKM A;  3IJE B;  4OK0 A;  1ZO2 A;  2QGU A;  2XGL A;  4R9L A;  3PYJ A;  2PZV A;  4GL6 A;  1IQX A;  5ELU A;  3ECF A;  3NXJ A;  4RNZ A;  3H3H A;  1W7C A;  3K0Z A;  4AKZ A;  3AMO A;  3JUQ A;  1R4C A;  3BLZ A;  2YFI B;  3DGN A;  4LGQ A;  4XDW A;  3LYG A;  4HBR A;  3EBY A;  3NUV A;  1Q81 4;  1YGE A;  4TX4 A;  2CIU A;  3QK9 A;  1NWW A;  2I9W A;  4HVN A;  1QAF A;  1W6Y A;  1Q40 A;  4WYK A;  1W5Z A;  3EF8 A;  3HX8 A;  4K1V A;  3CNX A;  5AIH A;  4HM0 B;  3LH4 A;  2Z77 A;  1LOX A;  3EBT A;  3Q90 A;  3F7X A;  1K28 A;  5CXO A;  2CKF B;  3DM8 A;  3LML A;  1Q42 A;  4X2O A;  3CCE 3;  3DGM A;  4NRE A;  1FGO A;  1O7P B;  2E2V A;  3B7C A;  3CXC 2;  3WA3 A;  5D83 A;  1E3R A;  3LT9 A;  2P05 A;  4FCM A;  4HZB B;  1OHO A;  1TFO A;  2OQE A;  1N8R 4;  1HU9 A;  1ROA A;  3X42 A;  3DMC A;  3IMA B;  1OUN A;  1STF I;  5TGN A;  4N6T A;  2INX A;  3G0K A;  2LQV A;  5EVH A;  3K7C A;  4HM5 B;  3CCV 3;  4N6M A;  3O8Y A;  4R80 A;  1PFP A;  4N6O B;  3Q2P A;  4RZM A;  5IW9 A;  4IPB A;  4EC6 A;  4HM1 B;  2W2C A;  4EYC A;  3G71 3;  3JUN A;  3CME 3;  5I97 A;  1NB3 I;  1CQS A;  3WOF B;  2FNQ A;  1YIJ 3;  2L4V A;  1O7H B;  2P38 A;  3E99 A;  1ISK A;  4N6N B;  2MF7 A;  3K9M C;  2P0X A;  3LOY A;  1QVF 2;  3GRD A;  1KSI A;  1MNL A;  1VQK 3;  2ZL8 A;  1Q86 4;  2UX0 A;  4KFE A;  1A90 A;  5BXQ A;  3KSP A;  1VQ7 3;  3B4P A;  1WMP A;  2OQE C;  3NV0 A;  4LSO A;  1YJW 3;  1KWI A;  3NM7 A;  5FW5 A;  3BNB A;  4K1U A;  5AYS C;  2W04 A;  1K9M 4;  1VQO 3;  3S5C A;  1SQW A;  1JN5 B;  1VQ5 3;  4RBN A;  2CWT A;  3FKA A;  1QMA A;  1VQL 3;  1EA2 A;  2Z76 A;  1GY5 A;  3EN8 A;  1M9G A;  1K41 A;  3T0U A;  1AR0 A;  3N8B A;  1L5G B;  1PU4 A;  3LTA A;  3TDG A;  3N54 B;  1EG9 B;  4L8O A;  1N9E A;  1VQ6 3;  3MG1 A;  5IEP A;  1TFK A;  2D42 A;  3KN4 A;  4IIA A;  1OH0 A;  3GZR A;  3ROB A;  1IU7 A;  3KSE D;  1JKG A;  4FMA A;  3MSO A;  2IA7 A;  3F14 A;  4STD A;  2CG0 A;  2IUK A;  4K61 A;  2OCT A;  2XGN A;  5STD A;  2CFW A;  3VSY A;  3LZA A;  3UJM A;  2YFJ B;  1FGR A;  3S27 A;  2GEX A;  1IQY A;  2GBX B;  3EB8 A;  1IVV A;  1RN7 A;  1IVW A;  1Q7Y 4;  4FMC A;  1QVG 2;  1VQN 3;  3FZW A;  4N6V 0;  3STD A;  3GWR A;  2R4I A;  1BUQ A;  1S72 3;  1KD1 4;  3B4O A;  1ASK A;  3CCJ 3;  1KC8 4;  4BTY A;  1M1X B;  4XM4 A;  3J7Y d;  3EHC A;  3SX1 A;  1OPY A;  2XEP A;  4HJL B;  4JF8 A;  3B8L A;  1TIJ A;  1QAL A;  4HM4 B;  4MJD A;  3Q1C A;  5FGO A;  3SOY A;  4J8T A;  5IEN A;  2WOH A;  4BTX A;  2W9P A;  2QEX 3;  1US1 A;  3JUM A;  2WO0 A;  3U97 A;  1ZX2 A;  3BB9 A;  3KZT A;  2BT3 A;  5AI1 A;  4FCJ A;  4EXR A;  1DVC A;  3QRD A;  2O3O A;  2WGO A;  3EJV A;  4WP5 A;  1TP6 A;  4FCZ A;  1NDO B;  2Y73 A;  1M1K 4;  1FUW A;  4AKY A;  1QAK A;  3FG4 A;  3EX9 A;  4XB5 A;  3CD6 3;  2XSO B;  5JPU A;  3PGB A;  1IT7 A;  3CU3 A;  4HYZ A;  4MMZ B;  3T8N A;  4FMD A;  2WGQ A;  3I56 3;  5AEW B;  1IDP A;  1Q40 B;  3S67 A;  4WYK B;  4PEJ A;  1LVN A;  4QWT A;  4H3U A;  2RSX A;  4WHA A;  1IK3 A;  3JUO A;  1STD A;  1OCV A;  3D9R A;  4HM3 B;  2C11 A;  1SIH A;  3CPO A;  2OOV A;  5KP4 A;  2GBW B;  5D82 A;  1YIT 3;  3F7S A;  1A2K A;  2GU1 A;  4XBT A;  1VZZ A;  4CCV A;  2XR8 B;  1IQ8 A;  4HKV B;  3VGN A;  3CCR 3;  4RNY A;  5AEU B;  2SBL A;  2W56 A;  4WFO A;  1FGM A;  2V1L A;  1UI7 A;  3NBR A;  3NBJ A;  2C10 A;  1IVU A;  2MC8 A;  1M90 4;  4EBG A;  1E97 A;  1DVD A;  3OV4 A;  4O02 B;  1UW1 A;  2BMO B;  2HMN B;  3G16 A;  3CMA 3;  4CDL A;  1WTH A;  3GZX B;  4FR9 A;  4Q53 A;  3EN1 B;  2HMO B;  4HM7 B;  1ROV A;  3PXM A;  3X3Y A;  3CCM 3;  3FLJ A;  3CCQ 3;  4ORL A;  2CC3 A;  1VQ8 3;  2GU3 A;  1YJN 3;  2YFL B;  3RGA A;  2FGT A;  1W02 A;  2BNG A;  1W00 A;  5EQL A;  3FG1 A;  1OF5 A;  2XH9 A;  1JJ2 2;  2OOV C;  3K5T A;  1AVL A;  4BTW A;  3I0Y A;  3SVA A;  2IMJ A;  1CEW I;  4OUQ A;  1K8A 4;  2CFL A;  3JVC A;  1WQL B;  4EV2 A;  3D3L A;  2P09 A;  3CCL 3;  4KFD A;  3X41 A;  2JQ5 A;  1W2Z A;  1ULI B;  1GYB A;  3WMD A;  4OVM A;  1YHQ 3;  3PCR A;  4N6L A;  4H61 A;  4R4K A;  3DY5 A;  1CYU A;  2XRX B;  3WOE B;  3F40 A;  4O3V A;  3PCS A;  2KRT A;  5DRV A;  4IT7 A;  4J9A A;  4EV5 A;  5IEO A;  3WOD G;  4GB5 A;  3ER7 A;  4N3V A;  1NU3 A;  4O2H A;  4KFF A;  4HZ9 B;  1IV7 A;  1RKY A;  4MMY B;  1W6G A;  4JRF A;  2OWP A;  2W9Q A;  3OWS A;  5A0O B;  2CK3 H;  2HML B;  3FH1 A;  3BNE A;  3KE7 A;  3WDG B;  2CWU A;  2Q07 A;  2ZDJ A;  5LC7 A;  1JKG B;  3U1W A;  5CF2 A;  1WNH A;  2W0Q A;  3F9S A;  3T8U A;  3UNL A;  2WOF A;  4MMX B;  1A67 A;  4AEQ A;  5AYR B;  2OTJ 3;  3EQQ B;  1OHS A;  1D6U A;  3G8Z A;  1OGZ A;  1QJG A;  3OXA A;  1MOL A;  3MHE A;  1VQM 3;  1O7M B;  2P0M A;  4X2H A;  5CF1 A;  4WWU C;  3SLU A;  5KP1 A;  1IT8 A;  3KII A;  3X3X A;  1JNQ A;  7STD A;  1ULJ B;  2BMQ B;  3F8H A;  1OGX A;  1EQK A;  3MWZ A;  3DXO A;  3EC9 A;  2F99 A;  2ML6 A;  4O8S A;  3S29 A;  1Q82 4;  3ALA A;  1NB5 I;  3HIG A;  2KCD A;  3GZY B;  5EEO A;  1OAC A;  3FF0 A;  1D6Y A;  1Y4K A;  3DGO A;  3OWU A;  5IG0 A;  3AMO B;  3CC7 3;  2XSH B;  4XBY A;  1WMN A;  6STD A;  5IG3 A;  3RDE A;  1YJ9 3;  2JDI H;  3NM2 A;  2K54 A;  2HMM B;  3CPW 2;  1TUH A;  2CFG A;  1HKX A;  1G96 A;  3BND A;  4LZI A;  4XDV A;  3SXX A;  3HZP A;  3F8X A;  1UUV B;  5DRE A;  1VQ9 3;  8CHO A;  3I55 3;  3CCU 3;  2RCD A;  3EE1 A;  3UL5 A;  1W01 A;  3WA2 X;  3MKI A;  2BHM A;  3V92 A;  5D81 A;  1N5H A;  2CFK A;  2W6J H;  5IF6 A;  3GZB A;  1W4N A;  2HMJ B;  1E3V A;  4FMB A;  2GXF A;  2YX9 A;  3M8C A;  1DMM A;  2CHC A;  3K63 A;  1UUW B;  2F98 A;  3S28 A;  3LTD A;  5G2G A;  2XFS A;  1N9J A;  1C7H A;  4LMI A;  2D1W A;  3DUK A;  2RGQ A;  4N6U A;  4KZ1 A;  3NQZ A;  1O7G B;  1GD3 A;  3A76 A;  3HI7 A;  1UI8 A;  3NX0 A;  1F8N A;  4R1K A;  4ZM8 A;  3G6E 3;  3FSD A;  2QIY A;  2LYX A;  3MYT A;  1JN5 A;  3BNC A;  3IPT A;  3KFQ C;  5CLK A;  5CK6 A;  1K73 4;  4MEI A;  4HM6 B;  3G4S 3;  3N9H A;  4LEH A;  3VF1 A;  1SPU A;  1GS3 A;  1OHP A;  2RFR A;  3LTC A;  1SJW A;  1AV4 A;  5JBS A;  1YI2 3;  1DMQ A;  3UB1 A;  2W56 B;  3FGY A;  5AIF A;  3MPH A;  3MG3 A;  1U5O A;  4U13 A;  3PS8 A;  1O7N B;  3V99 A;  2KXG A;  4I4K A;  4K90 B;  5ELJ A;  2QA4 3;  3DGL A;  3L0R A;  1NJI 4;  1A2V A;  5AIG A;  3MG2 A;  2CG1 A;  3FF2 A;  4R9K A;  1O7W B;  2E2U A;  1V74 A;  3HII A;  1W2B 2;  1JB4 A;  2XF3 A;  3RGR A;  4KVH A;  1U8C B;  1VQ4 3;  4NHF A;  3NV0 B;  3OW2 2;  3UL6 A;  1WMO A;  1KQS 2;  3SOA A;  2B1X B;  4L8P A;  2CWV A;  1JB2 A;  3FG3 A;  1VQP 3;  2OTL 3;  2PNC A;  5HGR A;  2B24 B;  2O9U X;  3V98 A;  3X3Z A;  1D6Z A;  2Z6B A;  2BMR B;  3DZL A;  5BVB A;  1T5Y A;  1W6C A;  3GAX A;  3PZW A;  1OF5 B;  2Z7A A;  2Y74 A;  1IV9 A;  1DMN A;  1S5A A;  2A15 A;  2HMK B;  1YVB I;  3CC2 3;  3CC4 3;  3LTB A;  3HK4 A;  3OWY A;  2XFT A;  5AII A;  3FCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...