1CYUA

Solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a human cystatin A variant, cystatin A2-98 M65L, by NMR spectroscopy. A possible role of the interactions between the N- and C-termini to maintain the inhibitory active form of cystatin A.
pubmed doi rcsb
molecule keywords CYSTATIN A
molecule tags Proteinase inhibitor (cysteine)
source organism Homo sapiens
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cyuA00
3PXMA 1PFPA 1LXEA 5LC6A 4N6TA 4CCVA 1MNLA 1IV9A 1ROAA 3KFQC 3K9MC 1MOLA 1G96A 1IV7A 2BO9B 1N5PA 1WNHA 1EQKA 5LC7A 4EYCA 1CYUA 5ELJA 4N6V0 1FUWA 2OCTA 3PS8A 4N6OB 3UL5A 1DVDA 1R4CA 1M9GA 4N6LA 1A67A 3L0RA 1A90A 1RN7A 4N6UA 3S67A 1CEWI 2W9PA 4TX4A 1FA3A 5EQLA 1YVBI 1N9JA 3KSED 2O9UX 4N6MA 2KXGA 3SVAA 1CYVA 5A0OB 1N5HA 3QRDA 3MWZA 1GD3A 2CH9A 1GD4A 3UL6A 1NB5I 3GAXA 4ZM8A 3NX0A 1STFI 4IT7A 4LZIA 1NB3I 5ELUA 4N6NB 1TIJA 3IMAB 1DVCA 3LH4A 1KWIA 3Q2PA 3PYJA 2W9QA
chains in the Genus database with same CATH superfamily
1SQWA 1UUGB 3PXMA 4K1VA 5JBSA 3F7SA 2XF3A 4I5QA 1W02A 2WGQA 3EX9A 4JRFA 1DETA 5LC6A 3DGYA 2JDIH 1O7GB 5TGNA 1BNEA 1GMPA 4LGQA 2IUJA 3CCR3 4AEQA 5IG4A 5BU4A 1BRGA 4XB5A 5HOHA 2V1LA 1GMQA 1GYBA 5G1KA 3X3ZA 3FSDA 1S723 1D6UA 1KQS2 2GBXB 1MWTA 1UI8A 3NM7A 1RRLA 3I0YA 1I70A 3OWSA 1GOUA 3CNXA 5IW9A 2R4IA 1G96A 2RSXA 2BO9B 6STDA 1ZS7A 3TDGA 1BRIA 1T3BA 1EQKA 1BSAA 3LXUX 2XSOB 4EYCA 2CFLA 1TP6A 2WOHA 5AYSC 3WDGB 4IPBA 1Q7Y4 4N6V0 4X2OA 2P0XA 3ZG5A 5IG3A 3EBTA 3FF0A 7RNTA 3JUPA 3CMA3 1QVF2 3LMLA 1GSPA 1JV2B 1W2ZA 4KZ1A 4FMCA 1IVVA 2CKFB 3F8XA 2ZHXB 4BL2A 1R4CA 4XBTA 1RKYA 3K7CA 1UUWB 3KN4A 4L8OA 1A67A 1PY3A 2OOVC 3ER7A 3D79A 2MC8A 3EF8A 5CF2A 2W6JH 1FZUA 2W56B 3SXXA 3CPOA 3EN1B 3BNEA 1YJW3 1JN5B 2IA7A 1JNQA 4XDVA 2P05A 2KF4A 5CF1A 1QALA 1VQN3 1BSBA 3CCE3 4BIRA 2Y74A 3GZRA 1UCIA 1JKGB 2Z7AA 4BTXA 1FA3A 4Q53A 1UCLA 3VGNA 1NWWA 4J9AA 2KF5A 1KSIA 1LQGC 2P0MA 2GU1A 3QK9A 3WOFB 1Y4KA 1Q814 2ML5A 2D42A 4N3VA 1B2MA 3DMCA 1AVLA 3WOEB 5M18A 3F40A 1Q824 4BTWA 3CNMA 5IENA 3EQQB 3S27A 3RGAA 4N6MA 4GB5A 2K3DA 4HM1B 3K63A 3DGNA 1AR0A 1QJGA 4GHOA 4AKYA 3F14A 1BU4A 1GOYA 3SVAA 3QRDA 5D83A 1SIHA 3LYGA 1GD3A 5A0OB 1VQ43 4HM7B 2JQ5A 3SEDA 1OGXA 3G6E3 2KF3A 4HM2B 3SYUA 1JBTA 3CC43 4KT3B 1OGZA 2RGQA 1NJI4 1C54A 1GOVA 4BU4A 4RBNA 1VQ53 2WGOA 1TUHA 2QA43 2WO0A 1MWSA 3NX0A 1DMQA 1EA2A 4OUQA 5KP3A 2CC3A 4LZIA 1BNGA 1RN1A 2BMOB 2C11A 1BRNL 2XGLA 3LTDA 1ZO2A 1V58A 2KCDA 4MMZB 5ELUA 3WA3A 1T5YA 5HGRA 1LRAA 3OX9A 3KZTA 1B2XA 1TIJA 2QEX3 1D6YA 2UGIA 3E99A 4NREA 2HMJB 2IY2A 2BHMA 3IMAB 4O02B 4XBXA 1UUVB 5AIHA 3LH4A 2BIRA 2YFIB 1YHQ3 1LOWA 3PYJA 4EC6A 3CU3A 1WTHA 4LSOA 2KRTA 2F86B 2QIYA 2W2CA 1ULJB 2PNCA 3DXOA 1VQK3 3FZWA 3KKGA 3ZFZA 1BOXA 3MG3A 1BNFA 1BNSA 2QGUA 4FCZA 1ASKA 2BU4A 2LYXA 2ZDJA 4WFOA 1EKMA 4N6TA 1TRQA 1Q42A 2HMKB 2OOVA 3V99A 6RNTA 2XH9A 4KVHA 1N8QA 1QAFA 4R4KA 2LQVA 1Q40A 1SJWA 3LTAA 1HU9A 3HZPA 1YGWA 2YFLB 1AV4A 2Z77A 3BNCA 1NDOB 3OV4A 1MOLA 2RBIA 3KIIA 3CCM3 2D1WA 1W7CA 3GZXB 9RNTA 2AAEA 4O3VA 3PCSA 3ROBA 1YGEA 1VQ63 3EE1A 4FCJA 1W01A 4RNYA 1YJ93 2B24B 3WHOA 4ILFA 3I563 5DREA 3NHXA 1TFOA 4G1MB 4MMYB 1IQYA 1VQQA 3O8YA 1YNVX 1QAKA 1IT7A 5AIFA 1RDSA 3Q1CA 1VZZA 4HBRA 4N6OB 2Z6BA 3K5TA 4HM4B 1HKXA 2BNGA 1Q864 1M9GA 1KD14 1IVXA 2XRXB 2C4BA 4N6LA 3NV0B 3CD63 3BNDA 2STDA 3LT9A 1T2IA 2BMQB 2W0QA 1HZ1A 1RN7A 2I9WA 3FG1A 2F5WA 4R9LA 1W00A 5G1LA 3SLUA 1UCKA 2AADA 1T2HA 2P38A 3DY5A 1RGFA 2W9PA 4FMAA 3D3LA 1PU4A 1Z1SA 4HAAA 3EC9A 3NXJA 2L4VA 2GU3A 2CW9A 3AGOA 1RMSA 1E97A 3HIGA 4EXRA 2CWUA 5EQLA 5STDA 2FNQA 4HKVB 3EBYA 3AHWA 5D82A 3X42A 3U1WA 1BSEA 3KSED 3F9SA 5G2GA 2K0MA 4BL3A 3K0ZA 1A2VA 4KFFA 1ISKA 2Q07A 2O9UX 5EEOA 4J5KA 2HMNB 3NQYA 4RNZA 2IUKA 5IERA 5AIIA 1N8R4 3D9RA 3D4AA 1FW7A 1BRKA 1N5HA 1I0VA 1ZGXA 2YFJB 5DRVA 1BUQA 2CH9A 1X1YA 3CXC2 1BNRA 1GD4A 4O8SA 4AKZA 1MWUA 3UL6A 1IT8A 3GAXA 2P09A 4NPBA 2UUGC 1BIRA 1RHLA 2BT3A 3IJEB 1OF5B 5JPPA 3CPW2 4K1UA 2HMMB 4IT7A 1RGKA 3DH2A 4ORLA 1CQSA 1RN4A 1NB3I 1BSDA 5CK6A 1NU3A 3MYTA 1DYUA 1O7PB 2PZVA 5IG5A 1B2ZA 1JB2A 3CCS3 2GBWB 1RCKA 1UI7A 1K41A 1YI23 1BNIA 3GSPA 3CCV3 1BRJA 4JF8A 1JRQA 3LTCA 4L8PA 3EN8A 3X40A 5IEOA 3EB8A 1BRSA 1VQ83 1U8CB 3GWRA 3G713 1B2SA 1FGOA 1UW1A 3B8LA 3DUKA 3AMOB 3WR2A 1GS3A 1RNTA 4R9KA 2OQEC 1OUNA 3MSOA 4PEJA 3MG2A 4FMBA 1DMMA 4HM8B 1TRPA 1BNJA 3NBBA 3N9HA 1TFKA 4K90B 2XSHB 3I553 1LQMB 3X41A 4EV5A 1JN5A 3JUMA 1IQ8A 4CCVA 1O7NB 1LOXA 1VQO3 3DM8A 8CHOA 3D5GA 1JKGA 3B4PA 1ROAA 1JBRA 4CDLA 2C10A 3KFQC 3NUVA 2H0HA 1GY7A 2L1SA 1TU5A 4KFDA 4MJDA 4H61A 3RDEA 3WMDA 2KAAA 3DGOA 1RCLA 1LNHA 3T8UA 1LVNA 3LOYA 1I8VA 1WMOA 4U13A 1K28A 1FGTA 3KCHA 1Q40B 3OXAA 5LC7A 4FR9A 1B27A 1TJDA 1Q7HA 3NBJA 3RGRA 1CYUA 3STDA 2GEYA 3A5EA 3GZBA 2CG1A 3V98A 5BVBA 3CC23 1W6YA 7GSPA 3CCJ3 1MGRA 1G02A 2OCTA 3CME3 4WYKA 4MMXB 5KP1A 3ALAA 3PS8A 1WMPA 1W5ZA 1X1UA 1DVDA 1IVUA 3BLZA 8RNTA 2CWVA 2KF6A 3S29A 2RFRA 3L0RA 3G0KA 4LEHA 1IVWA 1VQL3 4BTYA 1SIIA 2CK3H 4GSPA 1B20A 3S67A 3U97A 2CFWA 5IEPA 3X3XA 2RCDA 4EV2A 1KC84 1RTUA 1W6CA 3HX8A 4HVNA 1VQP3 3B7CA 1G0TA 3OWUA 2YX9A 3HI7A 3JVCA 2H0GA 1F8NA 1EG9B 1OHSA 1RGHA 4TX4A 4EBGA 4I4KA 5M19A 3VSYA 3GZYB 4R1KA 1O7MB 3AGNA 3F7XA 1GY5A 1V74A 3H51A 5RNTA 1VQM3 4WHAA 4HJLB 1YVBI 1N9JA 3G16A 1GY6A 1YIT3 2M7OA 2IMJA 1E3VA 3A76A 1PYLA 2GEXA 2FGTA 1BGSA 1RRHA 1UDII 3BIRA 1EEJA 3N8BA 1X1XA 3DGMA 2OQEA 5EVHA 1JBSA 4RZMA 1K734 3FLJA 3GRDA 3CCU3 5AYRB 2F56A 5KP4A 4HOHA 1IYYA 1UGIA 1O7WB 1RGGA 1C7HA 1ROVA 1BRHA 1JZDA 2O3OA 1MGWA 2SBLA 3MPHA 4WWUC 3KSPA 3CCL3 1M1K4 2OTJ3 2CFGA 3AHSA 1DE3A 5CXOA 1STFI 5D81A 5I97A 3NM2A 3CCQ3 3VF1A 4CPKA 4WP5A 1Q9EA 1JB4A 3LT8A 3RNTA 4N6NB 4HM3B 2HMLB 1WMNA 3HIIA 2R41A 3EHCA 3FG3A 4K61A 1JZOA 1I2EA 1IU7A 1OCVA 2RNTA 2Z76A 3V92A 1DVCA 2E2TA 2J8XB 2XR8B 3FG4A 2F98A 3Q3FA 1IK3A 1B3SA 1KWIA 1BUJA 3Q2PA 1AVKA 1ZX2A 3SOYA 1FYSA 3T8NA 4XM4A 3S5CA 4QWTA 2W9QA 1E3RA 2XGNA 1PFPA 3FF2A 3NV0A 1LXEA 1STDA 4OVMA 1AY7A 3BB9A 1B21A 4OK0A 2XFSA 1FGMA 2ZA4A 3PGBA 1FUSA 1LNIA 1OPYA 2CHCA 2ML6A 1MNLA 1OH0A 3B4OA 2HMOB 1IV9A 1SARA 3ZG0A 1S5AA 1X1WA 5M1AA 4XDWA 1LOYA 1BAOA 1LOVA 3K9MC 1VQ73 1V57A 1YVSA 3OWYA 4IIAA 3ECFA 3G8ZA 4FMDA 1N9EA 1NNVA 2SARA 2CIUA 1IV7A 1US1A 1O7HB 1N5PA 1I0XA 1WNHA 3FH1A 2BMRB 2XEPA 3H3HA 4HM6B 2CX1A 3X3YA 5ELJA 3OW22 1I3FA 3WA2X 2GSPA 3D5IA 3WODG 1FUWA 2W56A 3PZWA 1RSNA 2W04A 1A2KA 4HZBB 1UGHI 4DKIA 1OACA 1RGCA 3HK4A 3UL5A 3UB1A 3MKIA 1OF5A 2F5MA 1SPUA 1I3IA 2GXFA 1EUIC 3JUNA 4N6UA 3NBRA 2ZL8A 1A90A 5BIRA 1QVG2 4WYKB 1VQ93 1BSCA 3FCSB 3NQZA 4HYZA 3CC73 1A2PA 1CEWI 1M904 1YJN3 5AIGA 3Q90A 4R80A 1L5GB 1FGQA 2CWTA 3JUOA 3MG1A 4L7KA 3KE7A 5CLKA 1K9M4 2CFKA 4RNTA 3UJMA 4EW5A 1FUTA 1J2BA 3URPA 3MHEA 4H3UA 4J5GA 1GMRA 1W4NA 1HYFA 2E2UA 2W03A 1DMNA 3F8HA 4J8TA 2UX0A 3N54B 2INXA 3AMOA 2H0IA 2KXGA 2OTL3 4HM5B 3DGLA 1OHOA 2CX0A 3FKAA 2MF7A 1CYVA 5IG0A 1I2GA 3MWZA 3DZLA 3T0UA 3SX1A 1MWRA 3J7Yd 1JB5A 1IQXA 1R4YA 4GL6A 5FW5A 3LZAA 5BXQA 1NB5I 1YIJ3 3IPTA 2CFDA 1D6ZA 4HM0B 3HOHA 3LTBA 1W6GA 2FXTA 1TTOA 4ZM8A 1CH0A 3FGYA 1FGRA 4LMIA 4O2HA 1B2UA 2K54A 3S28A 1IDPA 4CJNA 5JPUA 3G4S3 1K8A4 1RGLA 1M1XB 1W2B2 4MEIA 1JJ22 2E2VA 3UNLA 2F4YA 2B1XB 1I2FA 1NO3A 5AI1A 3BNBA 7STDA 1RGEA 1ULIB 3EJVA 1AQZA 2Y73A 3JUQA 4XBYA 1UCJA 4STDA 4NHFA 2IYJA 1RLSA 2XFTA 5AEWB 5AEUB 3M8CA 1WQLB 3PCRA 4KFEA 1RGAA 1RJOA 2F99A 3BU4A 5GSPA 2HOHA 2OWPA 2A15A 4X2HA 3SOAA 1BANA 1RNBA 4HZ9B 1OHPA 1BVIA 2WOFA 1QMAA 4FCMA 1U5OA 2CG0A 6GSPA 5IF6A 4LYLB 5FGOA
chains in the Genus database with same CATH topology
1SQWA 3PXMA 5JBSA 4K1VA 3F7SA 2XF3A 1W02A 2WGQA 3EX9A 4JRFA 5LC6A 2JDIH 1O7GB 5TGNA 4LGQA 2IUJA 3CCR3 4AEQA 5IG4A 4XB5A 2V1LA 1GYBA 3X3ZA 3FSDA 1S723 1D6UA 1KQS2 2GBXB 1UI8A 3NM7A 1RRLA 3I0YA 3OWSA 3CNXA 5IW9A 2R4IA 1G96A 2RSXA 2BO9B 6STDA 3TDGA 1EQKA 3LXUX 2XSOB 4EYCA 2CFLA 1TP6A 2WOHA 5AYSC 3WDGB 4IPBA 1Q7Y4 4N6V0 4X2OA 2P0XA 5IG3A 3EBTA 3FF0A 3CMA3 3JUPA 1QVF2 3LMLA 1JV2B 1W2ZA 4KZ1A 4FMCA 1IVVA 2CKFB 3F8XA 1R4CA 4XBTA 1RKYA 3K7CA 1UUWB 3KN4A 4L8OA 1A67A 2OOVC 3ER7A 2MC8A 3EF8A 5CF2A 2W6JH 2W56B 3SXXA 3CPOA 3EN1B 3BNEA 1YJW3 1JN5B 2IA7A 1JNQA 4XDVA 2P05A 5CF1A 1QALA 1VQN3 3CCE3 2Y74A 3GZRA 2Z7AA 1JKGB 4BTXA 1FA3A 4Q53A 3VGNA 1NWWA 4J9AA 1KSIA 2P0MA 3QK9A 2GU1A 3WOFB 1Y4KA 1Q814 2ML5A 2D42A 4N3VA 3DMCA 1AVLA 3WOEB 3F40A 1Q824 4BTWA 3CNMA 5IENA 3EQQB 3S27A 3RGAA 4N6MA 4GB5A 4HM1B 3K63A 3DGNA 1AR0A 1QJGA 4AKYA 3F14A 3SVAA 5A0OB 3QRDA 5D83A 1SIHA 3LYGA 1GD3A 1VQ43 4HM7B 2JQ5A 3SEDA 1OGXA 3G6E3 4HM2B 3CC43 1OGZA 2RGQA 1NJI4 4RBNA 1VQ53 2WGOA 1TUHA 2QA43 2WO0A 3NX0A 1DMQA 1EA2A 4OUQA 5KP3A 2CC3A 4LZIA 2BMOB 2C11A 2XGLA 3LTDA 1ZO2A 2KCDA 4MMZB 5ELUA 3WA3A 1T5YA 5HGRA 3OX9A 3KZTA 1TIJA 2QEX3 1D6YA 3E99A 4NREA 2HMJB 4O02B 2BHMA 3IMAB 4XBXA 1UUVB 5AIHA 3LH4A 2YFIB 1YHQ3 3PYJA 4EC6A 3CU3A 1WTHA 4LSOA 2KRTA 2F86B 2QIYA 2W2CA 1ULJB 2PNCA 3DXOA 1VQK3 3FZWA 3KKGA 3MG3A 4FCZA 2QGUA 1ASKA 2LYXA 2ZDJA 4WFOA 1EKMA 4N6TA 1Q42A 2HMKB 2OOVA 3V99A 2XH9A 4KVHA 1N8QA 1QAFA 4R4KA 2LQVA 1Q40A 1SJWA 3LTAA 1HU9A 3HZPA 2YFLB 1AV4A 2Z77A 3BNCA 1NDOB 3OV4A 1MOLA 3KIIA 3CCM3 2D1WA 1W7CA 3GZXB 4O3VA 3PCSA 3ROBA 1YGEA 1VQ63 3EE1A 4FCJA 1W01A 4RNYA 1YJ93 2B24B 3I563 5DREA 3NHXA 1TFOA 4G1MB 4MMYB 1IQYA 3O8YA 1QAKA 1IT7A 5AIFA 3Q1CA 1VZZA 4HBRA 4N6OB 2Z6BA 3K5TA 4HM4B 1HKXA 2BNGA 1Q864 1M9GA 1KD14 1IVXA 2XRXB 4N6LA 3NV0B 3CD63 3BNDA 2STDA 3LT9A 2BMQB 2W0QA 1RN7A 2I9WA 3FG1A 4R9LA 1W00A 3SLUA 3DY5A 2P38A 2W9PA 4FMAA 3D3LA 1PU4A 1Z1SA 3EC9A 3NXJA 2L4VA 2GU3A 2CW9A 1E97A 3HIGA 4EXRA 2CWUA 5EQLA 5STDA 2FNQA 4HKVB 3EBYA 3X42A 5D82A 3U1WA 3KSED 3F9SA 5G2GA 2K0MA 3K0ZA 1A2VA 4KFFA 1ISKA 2Q07A 2O9UX 5EEOA 2HMNB 3NQYA 4RNZA 2IUKA 5IERA 5AIIA 1N8R4 3D9RA 1N5HA 5DRVA 2YFJB 1BUQA 2CH9A 3CXC2 1GD4A 4O8SA 4AKZA 3UL6A 1IT8A 3GAXA 2P09A 2BT3A 3IJEB 1OF5B 5JPPA 3CPW2 4K1UA 2HMMB 4IT7A 4ORLA 1CQSA 1NB3I 5CK6A 1NU3A 3MYTA 1DYUA 1O7PB 2PZVA 5IG5A 1JB2A 3CCS3 2GBWB 1UI7A 1K41A 1YI23 3CCV3 4JF8A 1JRQA 3LTCA 4L8PA 3EN8A 3X40A 5IEOA 3EB8A 1VQ83 1U8CB 3GWRA 3G713 1FGOA 1UW1A 3B8LA 3DUKA 3AMOB 1GS3A 4R9KA 2OQEC 1OUNA 3MSOA 4PEJA 3MG2A 4FMBA 1DMMA 4HM8B 3NBBA 3N9HA 1TFKA 4K90B 2XSHB 3I553 3X41A 4EV5A 1JN5A 3JUMA 1IQ8A 4CCVA 1O7NB 1LOXA 1VQO3 3DM8A 8CHOA 1JKGA 3B4PA 1ROAA 4CDLA 2C10A 3KFQC 3NUVA 1GY7A 1TU5A 4KFDA 4MJDA 4H61A 3RDEA 3WMDA 3DGOA 1LNHA 3T8UA 1LVNA 3LOYA 1WMOA 4U13A 1K28A 1FGTA 3OXAA 1Q40B 5LC7A 4FR9A 1CYUA 3NBJA 3RGRA 3STDA 2GEYA 3GZBA 2CG1A 3V98A 5BVBA 3CC23 1W6YA 3CCJ3 2OCTA 3CME3 4WYKA 4MMXB 5KP1A 3ALAA 3PS8A 1WMPA 1W5ZA 1DVDA 1IVUA 3BLZA 2CWVA 3S29A 2RFRA 3L0RA 3G0KA 4LEHA 1IVWA 1VQL3 4BTYA 1SIIA 2CK3H 3S67A 3U97A 2CFWA 5IEPA 3X3XA 2RCDA 4EV2A 1KC84 1W6CA 3HX8A 4HVNA 1VQP3 3B7CA 3CCU3 3OWUA 2YX9A 3HI7A 3JVCA 4EBGA 1F8NA 1EG9B 1OHSA 4TX4A 4I4KA 3VSYA 3GZYB 4R1KA 1O7MB 3F7XA 1GY5A 1V74A 3H51A 1VQM3 4WHAA 4HJLB 1YVBI 1N9JA 3G16A 1GY6A 1YIT3 2M7OA 2IMJA 1E3VA 3A76A 2GEXA 2FGTA 1RRHA 3N8BA 2OQEA 3DGMA 5EVHA 4RZMA 1K734 3FLJA 3GRDA 5AYRB 5KP4A 1O7WB 1ROVA 1C7HA 2O3OA 2SBLA 3MPHA 4WWUC 3KSPA 3CCL3 1M1K4 2OTJ3 2CFGA 5CXOA 1STFI 5D81A 5I97A 3NM2A 3CCQ3 3VF1A 4WP5A 1JB4A 3LT8A 4N6NB 4HM3B 2HMLB 1WMNA 3HIIA 3EHCA 3FG3A 4K61A 1IU7A 1OCVA 2Z76A 3V92A 1DVCA 2E2TA 2XR8B 3FG4A 1IK3A 2F98A 1KWIA 3Q2PA 1AVKA 1ZX2A 3SOYA 3T8NA 4XM4A 3S5CA 4QWTA 2W9QA 1E3RA 2XGNA 1PFPA 3FF2A 3NV0A 1LXEA 1STDA 4OVMA 3BB9A 4OK0A 2XFSA 1FGMA 3PGBA 1OPYA 2CHCA 2ML6A 1MNLA 1OH0A 3B4OA 2HMOB 1IV9A 1S5AA 4XDWA 3K9MC 1VQ73 3OWYA 4IIAA 3ECFA 3G8ZA 4FMDA 1N9EA 2CIUA 1IV7A 1US1A 1O7HB 1N5PA 1WNHA 3FH1A 2BMRB 2XEPA 3H3HA 4HM6B 3X3YA 5ELJA 3OW22 3WA2X 3WODG 1FUWA 2W56A 3PZWA 2W04A 1A2KA 4HZBB 1OACA 3HK4A 3UL5A 3UB1A 3MKIA 1OF5A 1SPUA 2GXFA 3JUNA 4N6UA 3NBRA 2ZL8A 1A90A 1QVG2 4WYKB 1VQ93 3FCSB 3NQZA 4HYZA 3CC73 1CEWI 1M904 1YJN3 5AIGA 3Q90A 4R80A 1L5GB 1FGQA 2CWTA 3JUOA 3MG1A 4L7KA 3KE7A 5CLKA 1K9M4 2CFKA 3UJMA 1J2BA 3MHEA 4H3UA 1W4NA 2W03A 2E2UA 1DMNA 3F8HA 4J8TA 2UX0A 3N54B 2INXA 3AMOA 2KXGA 2OTL3 4HM5B 3DGLA 1OHOA 3FKAA 2MF7A 1CYVA 5IG0A 3MWZA 3DZLA 3T0UA 3SX1A 3J7Yd 1JB5A 1IQXA 4GL6A 5FW5A 3LZAA 5BXQA 1NB5I 1YIJ3 3IPTA 2CFDA 1D6ZA 4HM0B 3LTBA 1W6GA 2FXTA 4ZM8A 3FGYA 1FGRA 4LMIA 4O2HA 3S28A 2K54A 5JPUA 1IDPA 3G4S3 1K8A4 1M1XB 1W2B2 4MEIA 1JJ22 2E2VA 3UNLA 2B1XB 1NO3A 5AI1A 3BNBA 7STDA 1ULIB 3EJVA 4XBYA 2Y73A 3JUQA 4STDA 4NHFA 2XFTA 5AEWB 5AEUB 3M8CA 1WQLB 3PCRA 4KFEA 1RJOA 2F99A 2OWPA 2A15A 4X2HA 3SOAA 4HZ9B 1OHPA 2WOFA 1QMAA 4FCMA 1U5OA 2CG0A 5IF6A 5FGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXM A;  1PFP A;  1LXE A;  5LC6 A;  4N6T A;  4CCV A;  1MNL A;  1IV9 A;  1ROA A;  3KFQ C;  3K9M C;  1MOL A;  1G96 A;  1IV7 A;  2BO9 B;  1N5P A;  1WNH A;  1EQK A;  5LC7 A;  4EYC A;  1CYU A;  5ELJ A;  4N6V 0;  1FUW A;  2OCT A;  3PS8 A;  4N6O B;  3UL5 A;  1DVD A;  1R4C A;  1M9G A;  4N6L A;  1A67 A;  3L0R A;  1A90 A;  1RN7 A;  4N6U A;  3S67 A;  1CEW I;  2W9P A;  4TX4 A;  1FA3 A;  5EQL A;  1YVB I;  1N9J A;  3KSE D;  2O9U X;  4N6M A;  2KXG A;  3SVA A;  1CYV A;  5A0O B;  1N5H A;  3QRD A;  3MWZ A;  1GD3 A;  2CH9 A;  1GD4 A;  3UL6 A;  1NB5 I;  3GAX A;  4ZM8 A;  3NX0 A;  1STF I;  4IT7 A;  4LZI A;  1NB3 I;  5ELU A;  4N6N B;  1TIJ A;  3IMA B;  1DVC A;  3LH4 A;  1KWI A;  3Q2P A;  3PYJ A;  2W9Q A; 
#chains in the Genus database with same CATH topology
 1SQW A;  1UUG B;  3PXM A;  4K1V A;  5JBS A;  3F7S A;  2XF3 A;  4I5Q A;  1W02 A;  2WGQ A;  3EX9 A;  4JRF A;  1DET A;  5LC6 A;  3DGY A;  2JDI H;  1O7G B;  5TGN A;  1BNE A;  1GMP A;  4LGQ A;  2IUJ A;  3CCR 3;  4AEQ A;  5IG4 A;  5BU4 A;  1BRG A;  4XB5 A;  5HOH A;  2V1L A;  1GMQ A;  1GYB A;  5G1K A;  3X3Z A;  3FSD A;  1S72 3;  1D6U A;  1KQS 2;  2GBX B;  1MWT A;  1UI8 A;  3NM7 A;  1RRL A;  3I0Y A;  1I70 A;  3OWS A;  1GOU A;  3CNX A;  5IW9 A;  2R4I A;  1G96 A;  2RSX A;  2BO9 B;  6STD A;  1ZS7 A;  3TDG A;  1BRI A;  1T3B A;  1EQK A;  1BSA A;  3LXU X;  2XSO B;  4EYC A;  2CFL A;  1TP6 A;  2WOH A;  5AYS C;  3WDG B;  4IPB A;  1Q7Y 4;  4N6V 0;  4X2O A;  2P0X A;  3ZG5 A;  5IG3 A;  3EBT A;  3FF0 A;  7RNT A;  3JUP A;  3CMA 3;  1QVF 2;  3LML A;  1GSP A;  1JV2 B;  1W2Z A;  4KZ1 A;  4FMC A;  1IVV A;  2CKF B;  3F8X A;  2ZHX B;  4BL2 A;  1R4C A;  4XBT A;  1RKY A;  3K7C A;  1UUW B;  3KN4 A;  4L8O A;  1A67 A;  1PY3 A;  2OOV C;  3ER7 A;  3D79 A;  2MC8 A;  3EF8 A;  5CF2 A;  2W6J H;  1FZU A;  2W56 B;  3SXX A;  3CPO A;  3EN1 B;  3BNE A;  1YJW 3;  1JN5 B;  2IA7 A;  1JNQ A;  4XDV A;  2P05 A;  2KF4 A;  5CF1 A;  1QAL A;  1VQN 3;  1BSB A;  3CCE 3;  4BIR A;  2Y74 A;  3GZR A;  1UCI A;  1JKG B;  2Z7A A;  4BTX A;  1FA3 A;  4Q53 A;  1UCL A;  3VGN A;  1NWW A;  4J9A A;  2KF5 A;  1KSI A;  1LQG C;  2P0M A;  2GU1 A;  3QK9 A;  3WOF B;  1Y4K A;  1Q81 4;  2ML5 A;  2D42 A;  4N3V A;  1B2M A;  3DMC A;  1AVL A;  3WOE B;  5M18 A;  3F40 A;  1Q82 4;  4BTW A;  3CNM A;  5IEN A;  3EQQ B;  3S27 A;  3RGA A;  4N6M A;  4GB5 A;  2K3D A;  4HM1 B;  3K63 A;  3DGN A;  1AR0 A;  1QJG A;  4GHO A;  4AKY A;  3F14 A;  1BU4 A;  1GOY A;  3SVA A;  3QRD A;  5D83 A;  1SIH A;  3LYG A;  1GD3 A;  5A0O B;  1VQ4 3;  4HM7 B;  2JQ5 A;  3SED A;  1OGX A;  3G6E 3;  2KF3 A;  4HM2 B;  3SYU A;  1JBT A;  3CC4 3;  4KT3 B;  1OGZ A;  2RGQ A;  1NJI 4;  1C54 A;  1GOV A;  4BU4 A;  4RBN A;  1VQ5 3;  2WGO A;  1TUH A;  2QA4 3;  2WO0 A;  1MWS A;  3NX0 A;  1DMQ A;  1EA2 A;  4OUQ A;  5KP3 A;  2CC3 A;  4LZI A;  1BNG A;  1RN1 A;  2BMO B;  2C11 A;  1BRN L;  2XGL A;  3LTD A;  1ZO2 A;  1V58 A;  2KCD A;  4MMZ B;  5ELU A;  3WA3 A;  1T5Y A;  5HGR A;  1LRA A;  3OX9 A;  3KZT A;  1B2X A;  1TIJ A;  2QEX 3;  1D6Y A;  2UGI A;  3E99 A;  4NRE A;  2HMJ B;  2IY2 A;  2BHM A;  3IMA B;  4O02 B;  4XBX A;  1UUV B;  5AIH A;  3LH4 A;  2BIR A;  2YFI B;  1YHQ 3;  1LOW A;  3PYJ A;  4EC6 A;  3CU3 A;  1WTH A;  4LSO A;  2KRT A;  2F86 B;  2QIY A;  2W2C A;  1ULJ B;  2PNC A;  3DXO A;  1VQK 3;  3FZW A;  3KKG A;  3ZFZ A;  1BOX A;  3MG3 A;  1BNF A;  1BNS A;  2QGU A;  4FCZ A;  1ASK A;  2BU4 A;  2LYX A;  2ZDJ A;  4WFO A;  1EKM A;  4N6T A;  1TRQ A;  1Q42 A;  2HMK B;  2OOV A;  3V99 A;  6RNT A;  2XH9 A;  4KVH A;  1N8Q A;  1QAF A;  4R4K A;  2LQV A;  1Q40 A;  1SJW A;  3LTA A;  1HU9 A;  3HZP A;  1YGW A;  2YFL B;  1AV4 A;  2Z77 A;  3BNC A;  1NDO B;  3OV4 A;  1MOL A;  2RBI A;  3KII A;  3CCM 3;  2D1W A;  1W7C A;  3GZX B;  9RNT A;  2AAE A;  4O3V A;  3PCS A;  3ROB A;  1YGE A;  1VQ6 3;  3EE1 A;  4FCJ A;  1W01 A;  4RNY A;  1YJ9 3;  2B24 B;  3WHO A;  4ILF A;  3I56 3;  5DRE A;  3NHX A;  1TFO A;  4G1M B;  4MMY B;  1IQY A;  1VQQ A;  3O8Y A;  1YNV X;  1QAK A;  1IT7 A;  5AIF A;  1RDS A;  3Q1C A;  1VZZ A;  4HBR A;  4N6O B;  2Z6B A;  3K5T A;  4HM4 B;  1HKX A;  2BNG A;  1Q86 4;  1M9G A;  1KD1 4;  1IVX A;  2XRX B;  2C4B A;  4N6L A;  3NV0 B;  3CD6 3;  3BND A;  2STD A;  3LT9 A;  1T2I A;  2BMQ B;  2W0Q A;  1HZ1 A;  1RN7 A;  2I9W A;  3FG1 A;  2F5W A;  4R9L A;  1W00 A;  5G1L A;  3SLU A;  1UCK A;  2AAD A;  1T2H A;  2P38 A;  3DY5 A;  1RGF A;  2W9P A;  4FMA A;  3D3L A;  1PU4 A;  1Z1S A;  4HAA A;  3EC9 A;  3NXJ A;  2L4V A;  2GU3 A;  2CW9 A;  3AGO A;  1RMS A;  1E97 A;  3HIG A;  4EXR A;  2CWU A;  5EQL A;  5STD A;  2FNQ A;  4HKV B;  3EBY A;  3AHW A;  5D82 A;  3X42 A;  3U1W A;  1BSE A;  3KSE D;  3F9S A;  5G2G A;  2K0M A;  4BL3 A;  3K0Z A;  1A2V A;  4KFF A;  1ISK A;  2Q07 A;  2O9U X;  5EEO A;  4J5K A;  2HMN B;  3NQY A;  4RNZ A;  2IUK A;  5IER A;  5AII A;  1N8R 4;  3D9R A;  3D4A A;  1FW7 A;  1BRK A;  1N5H A;  1I0V A;  1ZGX A;  2YFJ B;  5DRV A;  1BUQ A;  2CH9 A;  1X1Y A;  3CXC 2;  1BNR A;  1GD4 A;  4O8S A;  4AKZ A;  1MWU A;  3UL6 A;  1IT8 A;  3GAX A;  2P09 A;  4NPB A;  2UUG C;  1BIR A;  1RHL A;  2BT3 A;  3IJE B;  1OF5 B;  5JPP A;  3CPW 2;  4K1U A;  2HMM B;  4IT7 A;  1RGK A;  3DH2 A;  4ORL A;  1CQS A;  1RN4 A;  1NB3 I;  1BSD A;  5CK6 A;  1NU3 A;  3MYT A;  1DYU A;  1O7P B;  2PZV A;  5IG5 A;  1B2Z A;  1JB2 A;  3CCS 3;  2GBW B;  1RCK A;  1UI7 A;  1K41 A;  1YI2 3;  1BNI A;  3GSP A;  3CCV 3;  1BRJ A;  4JF8 A;  1JRQ A;  3LTC A;  4L8P A;  3EN8 A;  3X40 A;  5IEO A;  3EB8 A;  1BRS A;  1VQ8 3;  1U8C B;  3GWR A;  3G71 3;  1B2S A;  1FGO A;  1UW1 A;  3B8L A;  3DUK A;  3AMO B;  3WR2 A;  1GS3 A;  1RNT A;  4R9K A;  2OQE C;  1OUN A;  3MSO A;  4PEJ A;  3MG2 A;  4FMB A;  1DMM A;  4HM8 B;  1TRP A;  1BNJ A;  3NBB A;  3N9H A;  1TFK A;  4K90 B;  2XSH B;  3I55 3;  1LQM B;  3X41 A;  4EV5 A;  1JN5 A;  3JUM A;  1IQ8 A;  4CCV A;  1O7N B;  1LOX A;  1VQO 3;  3DM8 A;  8CHO A;  3D5G A;  1JKG A;  3B4P A;  1ROA A;  1JBR A;  4CDL A;  2C10 A;  3KFQ C;  3NUV A;  2H0H A;  1GY7 A;  2L1S A;  1TU5 A;  4KFD A;  4MJD A;  4H61 A;  3RDE A;  3WMD A;  2KAA A;  3DGO A;  1RCL A;  1LNH A;  3T8U A;  1LVN A;  3LOY A;  1I8V A;  1WMO A;  4U13 A;  1K28 A;  1FGT A;  3KCH A;  1Q40 B;  3OXA A;  5LC7 A;  4FR9 A;  1B27 A;  1TJD A;  1Q7H A;  3NBJ A;  3RGR A;  1CYU A;  3STD A;  2GEY A;  3A5E A;  3GZB A;  2CG1 A;  3V98 A;  5BVB A;  3CC2 3;  1W6Y A;  7GSP A;  3CCJ 3;  1MGR A;  1G02 A;  2OCT A;  3CME 3;  4WYK A;  4MMX B;  5KP1 A;  3ALA A;  3PS8 A;  1WMP A;  1W5Z A;  1X1U A;  1DVD A;  1IVU A;  3BLZ A;  8RNT A;  2CWV A;  2KF6 A;  3S29 A;  2RFR A;  3L0R A;  3G0K A;  4LEH A;  1IVW A;  1VQL 3;  4BTY A;  1SII A;  2CK3 H;  4GSP A;  1B20 A;  3S67 A;  3U97 A;  2CFW A;  5IEP A;  3X3X A;  2RCD A;  4EV2 A;  1KC8 4;  1RTU A;  1W6C A;  3HX8 A;  4HVN A;  1VQP 3;  3B7C A;  1G0T A;  3OWU A;  2YX9 A;  3HI7 A;  3JVC A;  2H0G A;  1F8N A;  1EG9 B;  1OHS A;  1RGH A;  4TX4 A;  4EBG A;  4I4K A;  5M19 A;  3VSY A;  3GZY B;  4R1K A;  1O7M B;  3AGN A;  3F7X A;  1GY5 A;  1V74 A;  3H51 A;  5RNT A;  1VQM 3;  4WHA A;  4HJL B;  1YVB I;  1N9J A;  3G16 A;  1GY6 A;  1YIT 3;  2M7O A;  2IMJ A;  1E3V A;  3A76 A;  1PYL A;  2GEX A;  2FGT A;  1BGS A;  1RRH A;  1UDI I;  3BIR A;  1EEJ A;  3N8B A;  1X1X A;  3DGM A;  2OQE A;  5EVH A;  1JBS A;  4RZM A;  1K73 4;  3FLJ A;  3GRD A;  3CCU 3;  5AYR B;  2F56 A;  5KP4 A;  4HOH A;  1IYY A;  1UGI A;  1O7W B;  1RGG A;  1C7H A;  1ROV A;  1BRH A;  1JZD A;  2O3O A;  1MGW A;  2SBL A;  3MPH A;  4WWU C;  3KSP A;  3CCL 3;  1M1K 4;  2OTJ 3;  2CFG A;  3AHS A;  1DE3 A;  5CXO A;  1STF I;  5D81 A;  5I97 A;  3NM2 A;  3CCQ 3;  3VF1 A;  4CPK A;  4WP5 A;  1Q9E A;  1JB4 A;  3LT8 A;  3RNT A;  4N6N B;  4HM3 B;  2HML B;  1WMN A;  3HII A;  2R41 A;  3EHC A;  3FG3 A;  4K61 A;  1JZO A;  1I2E A;  1IU7 A;  1OCV A;  2RNT A;  2Z76 A;  3V92 A;  1DVC A;  2E2T A;  2J8X B;  2XR8 B;  3FG4 A;  2F98 A;  3Q3F A;  1IK3 A;  1B3S A;  1KWI A;  1BUJ A;  3Q2P A;  1AVK A;  1ZX2 A;  3SOY A;  1FYS A;  3T8N A;  4XM4 A;  3S5C A;  4QWT A;  2W9Q A;  1E3R A;  2XGN A;  1PFP A;  3FF2 A;  3NV0 A;  1LXE A;  1STD A;  4OVM A;  1AY7 A;  3BB9 A;  1B21 A;  4OK0 A;  2XFS A;  1FGM A;  2ZA4 A;  3PGB A;  1FUS A;  1LNI A;  1OPY A;  2CHC A;  2ML6 A;  1MNL A;  1OH0 A;  3B4O A;  2HMO B;  1IV9 A;  1SAR A;  3ZG0 A;  1S5A A;  1X1W A;  5M1A A;  4XDW A;  1LOY A;  1BAO A;  1LOV A;  3K9M C;  1VQ7 3;  1V57 A;  1YVS A;  3OWY A;  4IIA A;  3ECF A;  3G8Z A;  4FMD A;  1N9E A;  1NNV A;  2SAR A;  2CIU A;  1IV7 A;  1US1 A;  1O7H B;  1N5P A;  1I0X A;  1WNH A;  3FH1 A;  2BMR B;  2XEP A;  3H3H A;  4HM6 B;  2CX1 A;  3X3Y A;  5ELJ A;  3OW2 2;  1I3F A;  3WA2 X;  2GSP A;  3D5I A;  3WOD G;  1FUW A;  2W56 A;  3PZW A;  1RSN A;  2W04 A;  1A2K A;  4HZB B;  1UGH I;  4DKI A;  1OAC A;  1RGC A;  3HK4 A;  3UL5 A;  3UB1 A;  3MKI A;  1OF5 A;  2F5M A;  1SPU A;  1I3I A;  2GXF A;  1EUI C;  3JUN A;  4N6U A;  3NBR A;  2ZL8 A;  1A90 A;  5BIR A;  1QVG 2;  4WYK B;  1VQ9 3;  1BSC A;  3FCS B;  3NQZ A;  4HYZ A;  3CC7 3;  1A2P A;  1CEW I;  1M90 4;  1YJN 3;  5AIG A;  3Q90 A;  4R80 A;  1L5G B;  1FGQ A;  2CWT A;  3JUO A;  3MG1 A;  4L7K A;  3KE7 A;  5CLK A;  1K9M 4;  2CFK A;  4RNT A;  3UJM A;  4EW5 A;  1FUT A;  1J2B A;  3URP A;  3MHE A;  4H3U A;  4J5G A;  1GMR A;  1W4N A;  1HYF A;  2E2U A;  2W03 A;  1DMN A;  3F8H A;  4J8T A;  2UX0 A;  3N54 B;  2INX A;  3AMO A;  2H0I A;  2KXG A;  2OTL 3;  4HM5 B;  3DGL A;  1OHO A;  2CX0 A;  3FKA A;  2MF7 A;  1CYV A;  5IG0 A;  1I2G A;  3MWZ A;  3DZL A;  3T0U A;  3SX1 A;  1MWR A;  3J7Y d;  1JB5 A;  1IQX A;  1R4Y A;  4GL6 A;  5FW5 A;  3LZA A;  5BXQ A;  1NB5 I;  1YIJ 3;  3IPT A;  2CFD A;  1D6Z A;  4HM0 B;  3HOH A;  3LTB A;  1W6G A;  2FXT A;  1TTO A;  4ZM8 A;  1CH0 A;  3FGY A;  1FGR A;  4LMI A;  4O2H A;  1B2U A;  2K54 A;  3S28 A;  1IDP A;  4CJN A;  5JPU A;  3G4S 3;  1K8A 4;  1RGL A;  1M1X B;  1W2B 2;  4MEI A;  1JJ2 2;  2E2V A;  3UNL A;  2F4Y A;  2B1X B;  1I2F A;  1NO3 A;  5AI1 A;  3BNB A;  7STD A;  1RGE A;  1ULI B;  3EJV A;  1AQZ A;  2Y73 A;  3JUQ A;  4XBY A;  1UCJ A;  4STD A;  4NHF A;  2IYJ A;  1RLS A;  2XFT A;  5AEW B;  5AEU B;  3M8C A;  1WQL B;  3PCR A;  4KFE A;  1RGA A;  1RJO A;  2F99 A;  3BU4 A;  5GSP A;  2HOH A;  2OWP A;  2A15 A;  4X2H A;  3SOA A;  1BAN A;  1RNB A;  4HZ9 B;  1OHP A;  1BVI A;  2WOF A;  1QMA A;  4FCM A;  1U5O A;  2CG0 A;  6GSP A;  5IF6 A;  4LYL B;  5FGO A; 
#chains in the Genus database with same CATH homology
 1SQW A;  3PXM A;  5JBS A;  4K1V A;  3F7S A;  2XF3 A;  1W02 A;  2WGQ A;  3EX9 A;  4JRF A;  5LC6 A;  2JDI H;  1O7G B;  5TGN A;  4LGQ A;  2IUJ A;  3CCR 3;  4AEQ A;  5IG4 A;  4XB5 A;  2V1L A;  1GYB A;  3X3Z A;  3FSD A;  1S72 3;  1D6U A;  1KQS 2;  2GBX B;  1UI8 A;  3NM7 A;  1RRL A;  3I0Y A;  3OWS A;  3CNX A;  5IW9 A;  2R4I A;  1G96 A;  2RSX A;  2BO9 B;  6STD A;  3TDG A;  1EQK A;  3LXU X;  2XSO B;  4EYC A;  2CFL A;  1TP6 A;  2WOH A;  5AYS C;  3WDG B;  4IPB A;  1Q7Y 4;  4N6V 0;  4X2O A;  2P0X A;  5IG3 A;  3EBT A;  3FF0 A;  3CMA 3;  3JUP A;  1QVF 2;  3LML A;  1JV2 B;  1W2Z A;  4KZ1 A;  4FMC A;  1IVV A;  2CKF B;  3F8X A;  1R4C A;  4XBT A;  1RKY A;  3K7C A;  1UUW B;  3KN4 A;  4L8O A;  1A67 A;  2OOV C;  3ER7 A;  2MC8 A;  3EF8 A;  5CF2 A;  2W6J H;  2W56 B;  3SXX A;  3CPO A;  3EN1 B;  3BNE A;  1YJW 3;  1JN5 B;  2IA7 A;  1JNQ A;  4XDV A;  2P05 A;  5CF1 A;  1QAL A;  1VQN 3;  3CCE 3;  2Y74 A;  3GZR A;  2Z7A A;  1JKG B;  4BTX A;  1FA3 A;  4Q53 A;  3VGN A;  1NWW A;  4J9A A;  1KSI A;  2P0M A;  3QK9 A;  2GU1 A;  3WOF B;  1Y4K A;  1Q81 4;  2ML5 A;  2D42 A;  4N3V A;  3DMC A;  1AVL A;  3WOE B;  3F40 A;  1Q82 4;  4BTW A;  3CNM A;  5IEN A;  3EQQ B;  3S27 A;  3RGA A;  4N6M A;  4GB5 A;  4HM1 B;  3K63 A;  3DGN A;  1AR0 A;  1QJG A;  4AKY A;  3F14 A;  3SVA A;  5A0O B;  3QRD A;  5D83 A;  1SIH A;  3LYG A;  1GD3 A;  1VQ4 3;  4HM7 B;  2JQ5 A;  3SED A;  1OGX A;  3G6E 3;  4HM2 B;  3CC4 3;  1OGZ A;  2RGQ A;  1NJI 4;  4RBN A;  1VQ5 3;  2WGO A;  1TUH A;  2QA4 3;  2WO0 A;  3NX0 A;  1DMQ A;  1EA2 A;  4OUQ A;  5KP3 A;  2CC3 A;  4LZI A;  2BMO B;  2C11 A;  2XGL A;  3LTD A;  1ZO2 A;  2KCD A;  4MMZ B;  5ELU A;  3WA3 A;  1T5Y A;  5HGR A;  3OX9 A;  3KZT A;  1TIJ A;  2QEX 3;  1D6Y A;  3E99 A;  4NRE A;  2HMJ B;  4O02 B;  2BHM A;  3IMA B;  4XBX A;  1UUV B;  5AIH A;  3LH4 A;  2YFI B;  1YHQ 3;  3PYJ A;  4EC6 A;  3CU3 A;  1WTH A;  4LSO A;  2KRT A;  2F86 B;  2QIY A;  2W2C A;  1ULJ B;  2PNC A;  3DXO A;  1VQK 3;  3FZW A;  3KKG A;  3MG3 A;  4FCZ A;  2QGU A;  1ASK A;  2LYX A;  2ZDJ A;  4WFO A;  1EKM A;  4N6T A;  1Q42 A;  2HMK B;  2OOV A;  3V99 A;  2XH9 A;  4KVH A;  1N8Q A;  1QAF A;  4R4K A;  2LQV A;  1Q40 A;  1SJW A;  3LTA A;  1HU9 A;  3HZP A;  2YFL B;  1AV4 A;  2Z77 A;  3BNC A;  1NDO B;  3OV4 A;  1MOL A;  3KII A;  3CCM 3;  2D1W A;  1W7C A;  3GZX B;  4O3V A;  3PCS A;  3ROB A;  1YGE A;  1VQ6 3;  3EE1 A;  4FCJ A;  1W01 A;  4RNY A;  1YJ9 3;  2B24 B;  3I56 3;  5DRE A;  3NHX A;  1TFO A;  4G1M B;  4MMY B;  1IQY A;  3O8Y A;  1QAK A;  1IT7 A;  5AIF A;  3Q1C A;  1VZZ A;  4HBR A;  4N6O B;  2Z6B A;  3K5T A;  4HM4 B;  1HKX A;  2BNG A;  1Q86 4;  1M9G A;  1KD1 4;  1IVX A;  2XRX B;  4N6L A;  3NV0 B;  3CD6 3;  3BND A;  2STD A;  3LT9 A;  2BMQ B;  2W0Q A;  1RN7 A;  2I9W A;  3FG1 A;  4R9L A;  1W00 A;  3SLU A;  3DY5 A;  2P38 A;  2W9P A;  4FMA A;  3D3L A;  1PU4 A;  1Z1S A;  3EC9 A;  3NXJ A;  2L4V A;  2GU3 A;  2CW9 A;  1E97 A;  3HIG A;  4EXR A;  2CWU A;  5EQL A;  5STD A;  2FNQ A;  4HKV B;  3EBY A;  3X42 A;  5D82 A;  3U1W A;  3KSE D;  3F9S A;  5G2G A;  2K0M A;  3K0Z A;  1A2V A;  4KFF A;  1ISK A;  2Q07 A;  2O9U X;  5EEO A;  2HMN B;  3NQY A;  4RNZ A;  2IUK A;  5IER A;  5AII A;  1N8R 4;  3D9R A;  1N5H A;  5DRV A;  2YFJ B;  1BUQ A;  2CH9 A;  3CXC 2;  1GD4 A;  4O8S A;  4AKZ A;  3UL6 A;  1IT8 A;  3GAX A;  2P09 A;  2BT3 A;  3IJE B;  1OF5 B;  5JPP A;  3CPW 2;  4K1U A;  2HMM B;  4IT7 A;  4ORL A;  1CQS A;  1NB3 I;  5CK6 A;  1NU3 A;  3MYT A;  1DYU A;  1O7P B;  2PZV A;  5IG5 A;  1JB2 A;  3CCS 3;  2GBW B;  1UI7 A;  1K41 A;  1YI2 3;  3CCV 3;  4JF8 A;  1JRQ A;  3LTC A;  4L8P A;  3EN8 A;  3X40 A;  5IEO A;  3EB8 A;  1VQ8 3;  1U8C B;  3GWR A;  3G71 3;  1FGO A;  1UW1 A;  3B8L A;  3DUK A;  3AMO B;  1GS3 A;  4R9K A;  2OQE C;  1OUN A;  3MSO A;  4PEJ A;  3MG2 A;  4FMB A;  1DMM A;  4HM8 B;  3NBB A;  3N9H A;  1TFK A;  4K90 B;  2XSH B;  3I55 3;  3X41 A;  4EV5 A;  1JN5 A;  3JUM A;  1IQ8 A;  4CCV A;  1O7N B;  1LOX A;  1VQO 3;  3DM8 A;  8CHO A;  1JKG A;  3B4P A;  1ROA A;  4CDL A;  2C10 A;  3KFQ C;  3NUV A;  1GY7 A;  1TU5 A;  4KFD A;  4MJD A;  4H61 A;  3RDE A;  3WMD A;  3DGO A;  1LNH A;  3T8U A;  1LVN A;  3LOY A;  1WMO A;  4U13 A;  1K28 A;  1FGT A;  3OXA A;  1Q40 B;  5LC7 A;  4FR9 A;  1CYU A;  3NBJ A;  3RGR A;  3STD A;  2GEY A;  3GZB A;  2CG1 A;  3V98 A;  5BVB A;  3CC2 3;  1W6Y A;  3CCJ 3;  2OCT A;  3CME 3;  4WYK A;  4MMX B;  5KP1 A;  3ALA A;  3PS8 A;  1WMP A;  1W5Z A;  1DVD A;  1IVU A;  3BLZ A;  2CWV A;  3S29 A;  2RFR A;  3L0R A;  3G0K A;  4LEH A;  1IVW A;  1VQL 3;  4BTY A;  1SII A;  2CK3 H;  3S67 A;  3U97 A;  2CFW A;  5IEP A;  3X3X A;  2RCD A;  4EV2 A;  1KC8 4;  1W6C A;  3HX8 A;  4HVN A;  1VQP 3;  3B7C A;  3CCU 3;  3OWU A;  2YX9 A;  3HI7 A;  3JVC A;  4EBG A;  1F8N A;  1EG9 B;  1OHS A;  4TX4 A;  4I4K A;  3VSY A;  3GZY B;  4R1K A;  1O7M B;  3F7X A;  1GY5 A;  1V74 A;  3H51 A;  1VQM 3;  4WHA A;  4HJL B;  1YVB I;  1N9J A;  3G16 A;  1GY6 A;  1YIT 3;  2M7O A;  2IMJ A;  1E3V A;  3A76 A;  2GEX A;  2FGT A;  1RRH A;  3N8B A;  2OQE A;  3DGM A;  5EVH A;  4RZM A;  1K73 4;  3FLJ A;  3GRD A;  5AYR B;  5KP4 A;  1O7W B;  1ROV A;  1C7H A;  2O3O A;  2SBL A;  3MPH A;  4WWU C;  3KSP A;  3CCL 3;  1M1K 4;  2OTJ 3;  2CFG A;  5CXO A;  1STF I;  5D81 A;  5I97 A;  3NM2 A;  3CCQ 3;  3VF1 A;  4WP5 A;  1JB4 A;  3LT8 A;  4N6N B;  4HM3 B;  2HML B;  1WMN A;  3HII A;  3EHC A;  3FG3 A;  4K61 A;  1IU7 A;  1OCV A;  2Z76 A;  3V92 A;  1DVC A;  2E2T A;  2XR8 B;  3FG4 A;  1IK3 A;  2F98 A;  1KWI A;  3Q2P A;  1AVK A;  1ZX2 A;  3SOY A;  3T8N A;  4XM4 A;  3S5C A;  4QWT A;  2W9Q A;  1E3R A;  2XGN A;  1PFP A;  3FF2 A;  3NV0 A;  1LXE A;  1STD A;  4OVM A;  3BB9 A;  4OK0 A;  2XFS A;  1FGM A;  3PGB A;  1OPY A;  2CHC A;  2ML6 A;  1MNL A;  1OH0 A;  3B4O A;  2HMO B;  1IV9 A;  1S5A A;  4XDW A;  3K9M C;  1VQ7 3;  3OWY A;  4IIA A;  3ECF A;  3G8Z A;  4FMD A;  1N9E A;  2CIU A;  1IV7 A;  1US1 A;  1O7H B;  1N5P A;  1WNH A;  3FH1 A;  2BMR B;  2XEP A;  3H3H A;  4HM6 B;  3X3Y A;  5ELJ A;  3OW2 2;  3WA2 X;  3WOD G;  1FUW A;  2W56 A;  3PZW A;  2W04 A;  1A2K A;  4HZB B;  1OAC A;  3HK4 A;  3UL5 A;  3UB1 A;  3MKI A;  1OF5 A;  1SPU A;  2GXF A;  3JUN A;  4N6U A;  3NBR A;  2ZL8 A;  1A90 A;  1QVG 2;  4WYK B;  1VQ9 3;  3FCS B;  3NQZ A;  4HYZ A;  3CC7 3;  1CEW I;  1M90 4;  1YJN 3;  5AIG A;  3Q90 A;  4R80 A;  1L5G B;  1FGQ A;  2CWT A;  3JUO A;  3MG1 A;  4L7K A;  3KE7 A;  5CLK A;  1K9M 4;  2CFK A;  3UJM A;  1J2B A;  3MHE A;  4H3U A;  1W4N A;  2W03 A;  2E2U A;  1DMN A;  3F8H A;  4J8T A;  2UX0 A;  3N54 B;  2INX A;  3AMO A;  2KXG A;  2OTL 3;  4HM5 B;  3DGL A;  1OHO A;  3FKA A;  2MF7 A;  1CYV A;  5IG0 A;  3MWZ A;  3DZL A;  3T0U A;  3SX1 A;  3J7Y d;  1JB5 A;  1IQX A;  4GL6 A;  5FW5 A;  3LZA A;  5BXQ A;  1NB5 I;  1YIJ 3;  3IPT A;  2CFD A;  1D6Z A;  4HM0 B;  3LTB A;  1W6G A;  2FXT A;  4ZM8 A;  3FGY A;  1FGR A;  4LMI A;  4O2H A;  3S28 A;  2K54 A;  5JPU A;  1IDP A;  3G4S 3;  1K8A 4;  1M1X B;  1W2B 2;  4MEI A;  1JJ2 2;  2E2V A;  3UNL A;  2B1X B;  1NO3 A;  5AI1 A;  3BNB A;  7STD A;  1ULI B;  3EJV A;  4XBY A;  2Y73 A;  3JUQ A;  4STD A;  4NHF A;  2XFT A;  5AEW B;  5AEU B;  3M8C A;  1WQL B;  3PCR A;  4KFE A;  1RJO A;  2F99 A;  2OWP A;  2A15 A;  4X2H A;  3SOA A;  4HZ9 B;  1OHP A;  2WOF A;  1QMA A;  4FCM A;  1U5O A;  2CG0 A;  5IF6 A;  5FGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...