5ELJA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
ENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAKVWVKGLTNWKLGMNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-Affirmer-S2D5
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
total genus 17
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eljA00
4N6NB 3KSED 1LXEA 1ROAA 5ELJA 1G96A 2W9QA 1M9GA 2KXGA 1N5HA 2CH9A 1FUWA 1YVBI 3S67A 1CYUA 1IV9A 5ELUA 5A0OB 3PXMA 1RN7A 3PS8A 1CYVA 4EYCA 4N6LA 1A90A 3Q2PA 1GD4A 1R4CA 4IT7A 1PFPA 1A67A 4LZIA 1WNHA 3L0RA 3UL5A 1DVDA 1FA3A 1EQKA 3SVAA 4N6TA 2W9PA 3PYJA 2BO9B 1TIJA 1N5PA 1NB3I 2O9UX 1GD3A 4N6UA 1MOLA 1MNLA 1DVCA 4ZM8A 1NB5I 1IV7A 3MWZA 5LC7A 5LC6A 5EQLA 3UL6A 2OCTA 3IMAB 3NX0A 1N9JA 3LH4A 4N6V0 4CCVA 3K9MC 4N6OB 3GAXA 4TX4A 3QRDA 1CEWI 1STFI 4N6MA 3KFQC 1KWIA
chains in the Genus database with same CATH superfamily
3DY5A 3B4PA 2GU3A 3FGYA 4HM8B 2XSOB 3X41A 7STDA 3KSED 3VF1A 1UCJA 3JUMA 4BIRA 3V98A 2W56B 5STDA 3B7CA 1BUJA 2K0MA 3D4AA 1FW7A 3LOYA 3GWRA 1BNJA 4HYZA 3KCHA 3BIRA 3WA2X 4LGQA 1NO3A 1UGIA 1FUWA 1US1A 5CF1A 3PCRA 3O8YA 3TDGA 1OF5A 3EJVA 5M1AA 1IV9A 1RTUA 2F56A 3SOAA 9RNTA 1JKGA 3SXXA 1RJOA 2CFDA 1Q42A 3D3LA 1O7WB 4LSOA 3FCSB 5BU4A 1YIJ3 1UGHI 1Z1SA 4I4KA 2GXFA 3AMOB 3KZTA 1I2FA 1TTOA 5KP4A 1WMOA 1YJN3 4OVMA 2XSHB 5FGOA 2XFSA 1BRNL 1ZGXA 3UJMA 4EXRA 1UI7A 1DVDA 1ROVA 3JUPA 5D82A 3S28A 1EQKA 5CK6A 4N6TA 2IMJA 4CPKA 1MWSA 1NWWA 1IT7A 1QAFA 1RGEA 4G1MB 4HM1B 3EB8A 1EUIC 2GEXA 1PU4A 1WMNA 4U13A 1RKYA 3LTBA 5IEPA 2CFWA 3CXC2 2MC8A 1FGMA 3KSPA 3CC43 5D83A 1HZ1A 2XFTA 1DMQA 1OACA 1LRAA 3CMA3 2PNCA 3DH2A 1I2GA 1ZX2A 4HZ9B 3X3ZA 2Z6BA 1BRGA 3FH1A 1Q824 1QAKA 4R1KA 1ASKA 4AEQA 3GZBA 1MNLA 3AHSA 3UB1A 2Y74A 1JJ22 4RNZA 3F14A 4ORLA 2C4BA 1JNQA 3CME3 3MWZA 3G4S3 2CFLA 2CC3A 1GYBA 2BT3A 3CNMA 3Q3FA 4FMDA 1O7NB 3DXOA 4J5GA 4EV5A 1I3FA 1TUHA 4IPBA 1OCVA 2CWVA 4FCMA 3E99A 5IEOA 2L4VA 4GHOA 2CWUA 1BNSA 3X42A 1OHOA 1FGOA 1KSIA 4K90B 1RNBA 1JN5B 2OCTA 4FMAA 3WDGB 1V58A 1IYYA 5RNTA 3MPHA 2I9WA 1N8QA 3CC73 1LQMB 3CU3A 3DGMA 3NUVA 1RGLA 1IT8A 1W7CA 2BIRA 3ALAA 1JZDA 2IY2A 1IU7A 4PEJA 1RGHA 3WHOA 2RGQA 1PY3A 4CDLA 3G16A 1IVWA 1TU5A 1D6UA 2BNGA 2QEX3 3VGNA 1B2XA 5AYRB 7GSPA 2F99A 2Z77A 3HX8A 4HM2B 1C7HA 1IK3A 2GBWB 1AY7A 2CX0A 3M8CA 4HZBB 4AKYA 3X40A 1UCKA 3CCQ3 3GAXA 1IVUA 4TX4A 5FW5A 2UX0A 1ULJB 3BB9A 4N6MA 1QALA 3KFQC 3A5EA 4J8TA 3SX1A 1VQ83 5EEOA 1RGKA 4K1VA 1KWIA 5EVHA 4LYLB 1JV2B 2C10A 2D1WA 3ZFZA 2WGOA 3CCL3 1B2UA 5G1LA 4O3VA 3LTDA 2RBIA 2FXTA 4HAAA 1BVIA 1G96A 2XRXB 2SARA 1O7MB 1M9GA 4CJNA 3A76A 5G2GA 2KF3A 1M1XB 3MKIA 2KF5A 2ML5A 5AEUB 2CH9A 1ZS7A 3FZWA 4RNTA 4L8OA 1HKXA 5AIIA 3OWUA 3RGRA 1FGQA 2F5MA 1CYUA 2CIUA 4KT3B 5ELUA 1BRHA 4DKIA 1JB5A 1J2BA 1CYVA 3LYGA 5CXOA 4EYCA 1A2KA 2WO0A 3V92A 1YGWA 5IENA 2GSPA 1A90A 2P09A 3Q2PA 3CCJ3 1GD4A 3D5GA 1BSCA 3GSPA 1R4CA 1OGXA 2BMRB 3HIIA 3RNTA 3SYUA 1UI8A 4EBGA 3FKAA 1G0TA 1PFPA 1Q40B 1ZO2A 3WODG 1EA2A 2XEPA 4JRFA 3CD63 3LT8A 1VQ53 2W2CA 1B20A 1GMQA 2JDIH 2R41A 4KFFA 2OQEC 3MG1A 4MMZB 1LNHA 3KN4A 3MG2A 6GSPA 1BNIA 1BRSA 1ULIB 1BOXA 3ER7A 1QMAA 3HOHA 3SVAA 4HKVB 1RSNA 2GEYA 1BUQA 4WP5A 1I3IA 3AGOA 3OV4A 1FZUA 1JBSA 1LOWA 1W6YA 4R80A 1M1K4 3PCSA 1D6ZA 1VQ93 1CH0A 1R4YA 2CW9A 2XR8B 1W5ZA 5AI1A 2ZL8A 1RN1A 1BSDA 1LNIA 2O9UX 2UUGC 1TRQA 1B2ZA 1GD3A 4O02B 5IG0A 2CK3H 5D81A 1Q7Y4 2XGLA 1SPUA 1OPYA 1YI23 3NM7A 1GOYA 1W01A 4ZM8A 3I0YA 1NB5I 1Q40A 4HJLB 1RGAA 1BRJA 2D42A 3QK9A 1AVKA 2W56A 3N54B 3EQQB 3G6E3 1VQO3 1A2VA 3FG1A 3HI7A 1S5AA 2ML6A 1JZOA 2WGQA 1NU3A 1JBRA 3T0UA 4LMIA 1VQ73 2E2TA 2RNTA 2IYJA 2W03A 3DGNA 1SARA 1IQ8A 2AAEA 2CFKA 1LOXA 1UUWB 1RRHA 2P38A 1GOUA 2H0IA 5DRVA 3UNLA 2FNQA 3F40A 3FLJA 1VQ63 4XB5A 3WR2A 5JPUA 3EN1B 2B24B 1I0VA 3V99A 4GL6A 2XF3A 1CQSA 1JB4A 3AMOA 1E97A 4R4KA 3OWYA 4RZMA 1OGZA 3G713 4MMXB 1AR0A 4MMYB 2GU1A 1VQK3 4JF8A 1EKMA 1O7HB 3CPOA 1W6GA 1GY5A 1OUNA 4KFEA 3DUKA 2ZA4A 4K1UA 2BMOB 2QA43 4KFDA 2AADA 3OXAA 4J9AA 2PZVA 4XM4A 1B3SA 1EEJA 5AIFA 3LTAA 3ROBA 1K8A4 1CEWI 4XBYA 3EBTA 5KP1A 5M18A 1PYLA 1B27A 2BMQB 3K7CA 3B8LA 2WOHA 1VZZA 1UCLA 1YVSA 3KIIA 2CHCA 1UW1A 8RNTA 1VQL3 2QIYA 4R9KA 1F8NA 2C11A 1AV4A 5BXQA 1KQS2 1LXEA 1ROAA 2Z7AA 2OOVA 5ELJA 3NBJA 2W9QA 4MEIA 4BTWA 2KXGA 5IG4A 4J5KA 2KAAA 1B21A 1N8R4 4WYKB 4X2HA 3CCR3 1YJW3 3HIGA 3IJEB 2JQ5A 3NV0B 1DYUA 5GSPA 5BIRA 2A15A 4RNYA 2BU4A 2F5WA 1RLSA 3S67A 1VQM3 5AYSC 5A0OB 4XBTA 1MWTA 3CCM3 2RFRA 4FCZA 1K28A 1RN7A 3JUQA 3WMDA 3X3YA 1BANA 3F8XA 2HMJB 3D9RA 3BNBA 1I2EA 3F8HA 4WFOA 3G8ZA 2H0HA 1M904 3LTCA 1JN5A 1VQP3 1KD14 5AIGA 2RCDA 3GZXB 5BVBA 3CNXA 2OOVC 4OK0A 4EC6A 3K5TA 3NHXA 1WNHA 4LZIA 1QVG2 3H3HA 3ECFA 3UL5A 1FA3A 3T8NA 2OQEA 3DM8A 1T3BA 3S27A 3EE1A 6RNTA 4BTXA 2CG0A 3Q1CA 1L5GB 1E3RA 1MWUA 2W9PA 3DZLA 3Q90A 4Q53A 3MYTA 3IPTA 2SBLA 3PYJA 4ILFA 2E2VA 1UUVB 4NREA 3CCS3 4KVHA 2CWTA 4HM7B 1C54A 1O7PB 2YX9A 1V74A 1U8CB 1AQZA 1LVNA 1TIJA 1RMSA 1N5PA 2CFGA 1BNGA 1MGRA 3RDEA 4XDVA 1RDSA 2E2UA 3NM2A 4NHFA 2BHMA 1U5OA 3MHEA 1BRIA 3HK4A 1GMPA 1OHPA 5CLKA 1N9EA 4N6UA 2CKFB 1GMRA 3S5CA 1GSPA 1TFKA 1MOLA 3NQZA 2KRTA 1DVCA 1RCLA 3H51A 4HM4B 1IV7A 1SQWA 1OF5B 1OH0A 2W0QA 1MWRA 3FG4A 1Y4KA 1D6YA 1RCKA 1STDA 3SEDA 3BNEA 5LC7A 5M19A 4HM0B 3K63A 3JUNA 4MJDA 1BNFA 3FG3A 2Z76A 4NPBA 1GY6A 3OX9A 1UCIA 3J7Yd 5EQLA 1GS3A 3UL6A 3GZYB 4O8SA 1RGCA 7RNTA 1BU4A 3FSDA 3IMAB 3EBYA 1W6CA 4FCJA 2ZDJA 4O2HA 3ZG0A 2OTJ3 2P0MA 1BRKA 1Q814 3DGOA 2Q07A 2HOHA 3N8BA 1IVVA 1N9JA 2KF4A 3GRDA 3LH4A 1K41A 1DETA 4N6V0 2HMNB 8CHOA 3DGYA 3D79A 3LT9A 3BNDA 4CCVA 3CPW2 2K54A 3K9MC 3CCE3 3MG3A 5AIHA 2LQVA 1Q864 1YGEA 4STDA 1EG9B 3SLUA 1QJGA 2INXA 4HBRA 3EX9A 1E3VA 3NXJA 3EN8A 1NJI4 1O7GB 1HU9A 3F7SA 1TRPA 1SJWA 1VQQA 3FF2A 1K9M4 4L8PA 4N6NB 1QVF2 1RN4A 4IIAA 1BGSA 5IERA 2HMOB 3U1WA 1IQXA 1VQ43 1B2SA 3I553 1KC84 1X1YA 3KKGA 1K734 1YHQ3 1N5HA 2YFIB 3K0ZA 3B4OA 4I5QA 1WQLB 1FUTA 4FR9A 2STDA 2P05A 1W2ZA 1GY7A 1I70A 1YVBI 4K61A 2B1XB 3JUOA 1YJ93 4H61A 1Q7HA 2CX1A 1I8VA 3PXMA 5HOHA 3D5IA 3PS8A 2IA7A 4N6LA 2IUJA 1SIIA 2HMMB 4HM5B 3ZG5A 2F98A 1DMMA 4IT7A 3STDA 1FYSA 2FGTA 4BL3A 3CC23 2P0XA 1ISKA 1MGWA 1RGGA 3T8UA 3WOEB 3DGLA 1A67A 3SOYA 1W2B2 2QGUA 3L0RA 4N3VA 2XH9A 4HOHA 1AVLA 1BSBA 3AHWA 3PGBA 5HGRA 3BLZA 1BNRA 4X2OA 2W04A 5IG3A 1DE3A 2XGNA 3LZAA 1X1XA 1X1WA 4R9LA 4GSPA 1WTHA 2HMLB 4WWUC 1IQYA 3S29A 4WHAA 3OWSA 4RBNA 3BU4A 1LOVA 2H0GA 2J8XB 2UGIA 1W00A 3NBBA 1TFOA 5KP3A 5JBSA 1A2PA 2W6JH 2OTL3 1VQN3 4BU4A 1LOYA 1NNVA 2BO9B 1W02A 5I97A 4GB5A 1NB3I 1W4NA 3FF0A 5CF2A 2RSXA 3VSYA 3CCU3 3LXUX 3AGNA 1BIRA 1IDPA 4BL2A 5IG5A 3NBRA 1JRQA 3EF8A 3F7XA 1RNTA 4HVNA 1V57A 2HMKB 1T5YA 3BNCA 2KCDA 3OW22 1RHLA 1GOVA 3WOFB 1RGFA 1OHSA 1BSEA 3U97A 3WA3A 2MF7A 1JB2A 3PZWA 4OUQA 1SIHA 2OWPA 3LMLA 5LC6A 1HYFA 2YFLB 4FMCA 1G02A 4H3UA 1IVXA 2YFJB 1UDII 4LEHA 4WYKA 1S723 3HZPA 3N9HA 2F4YA 2O3OA 3NV0A 4XBXA 5DREA 3G0KA 3CCV3 1BSAA 1JBTA 1TP6A 3JVCA 3RGAA 4EV2A 2IUKA 2F86B 3EC9A 1TJDA 1T2HA 1DMNA 2CG1A 3GZRA 3NX0A 4XDWA 4L7KA 5IW9A 4EW5A 2M7OA 1FGRA 2L1SA 5TGNA 1T2IA 1UUGB 6STDA 3MSOA 1YIT3 1Q9EA 1RRLA 2R4IA 1LQGC 1B2MA 1BNEA 3EHCA 3F9SA 4KZ1A 5JPPA 2K3DA 3KE7A 3URPA 4BTYA 5AEWB 4N6OB 1WMPA 1NDOB 1YNVX 2V1LA 3DMCA 2KF6A 2LYXA 1JKGB 4HM3B 5IF6A 3NQYA 3QRDA 1FGTA 1STFI 4HM6B 3X3XA 1I0XA 2GBXB 1BAOA 4QWTA 2WOFA 5G1KA 4AKZA 1X1UA 3I563 1FUSA 2Y73A 4FMBA 2ZHXB
chains in the Genus database with same CATH topology
3DY5A 3B4PA 2GU3A 3FGYA 4HM8B 2XSOB 3X41A 7STDA 3KSED 3VF1A 3JUMA 3V98A 2W56B 5STDA 3B7CA 2K0MA 3LOYA 3GWRA 4HYZA 3WA2X 4LGQA 1NO3A 1FUWA 1US1A 5CF1A 3PCRA 3O8YA 3TDGA 1OF5A 3EJVA 1IV9A 3SOAA 1JKGA 3SXXA 1RJOA 2CFDA 1Q42A 3D3LA 1O7WB 4LSOA 3FCSB 1YIJ3 1Z1SA 4I4KA 2GXFA 3AMOB 3KZTA 5KP4A 1WMOA 1YJN3 4OVMA 2XSHB 5FGOA 2XFSA 3UJMA 4EXRA 1UI7A 1DVDA 1ROVA 3JUPA 5D82A 3S28A 1EQKA 5CK6A 4N6TA 2IMJA 1NWWA 1IT7A 1QAFA 4G1MB 4HM1B 3EB8A 2GEXA 1PU4A 1WMNA 4U13A 1RKYA 3LTBA 5IEPA 2CFWA 2MC8A 1FGMA 3KSPA 3CC43 5D83A 2XFTA 1DMQA 1OACA 3CMA3 2PNCA 1ZX2A 4HZ9B 3X3ZA 2Z6BA 3FH1A 1Q824 1QAKA 4R1KA 1ASKA 4AEQA 3GZBA 1MNLA 3UB1A 1JJ22 4RNZA 3F14A 4ORLA 3CME3 1JNQA 3MWZA 3G4S3 2CFLA 2CC3A 1GYBA 2BT3A 3CNMA 4FMDA 5G2GA 1O7NB 3DXOA 4EV5A 1TUHA 4IPBA 1OCVA 2CWVA 4FCMA 3E99A 5IEOA 2L4VA 2CWUA 3X42A 1OHOA 1FGOA 1KSIA 4K90B 1JN5B 2OCTA 4FMAA 3WDGB 3MPHA 2I9WA 1N8QA 3CC73 3CU3A 3DGMA 3NUVA 1IT8A 1W7CA 3ALAA 1IU7A 4PEJA 2RGQA 4CDLA 3G16A 1IVWA 1TU5A 1D6UA 2BNGA 2QEX3 3VGNA 5AYRB 2F99A 2Z77A 3HX8A 4HM2B 1C7HA 1IK3A 2GBWB 3M8CA 4HZBB 4AKYA 3X40A 3CCQ3 3GAXA 1IVUA 4TX4A 5FW5A 2UX0A 1ULJB 3BB9A 4N6MA 1QALA 3KFQC 4J8TA 3SX1A 1VQ83 5EEOA 4K1VA 1KWIA 5EVHA 1JV2B 2C10A 2D1WA 2WGOA 3CCL3 4O3VA 3LTDA 2FXTA 1G96A 2XRXB 1O7MB 1M9GA 3A76A 1M1XB 3MKIA 2ML5A 5AEUB 2CH9A 3FZWA 4L8OA 1HKXA 5AIIA 3OWUA 3RGRA 1FGQA 1CYUA 2CIUA 5ELUA 1JB5A 1J2BA 1CYVA 3LYGA 5CXOA 4EYCA 1A2KA 2WO0A 3V92A 5IENA 1A90A 2P09A 3Q2PA 3CCJ3 1GD4A 1R4CA 1OGXA 2BMRB 3HIIA 1UI8A 4EBGA 3FKAA 1PFPA 1Q40B 3WODG 1ZO2A 1EA2A 2XEPA 4JRFA 3CD63 3LT8A 1VQ53 2W2CA 2JDIH 4KFFA 2OQEC 3MG1A 4MMZB 1LNHA 3KN4A 3MG2A 3ER7A 1ULIB 3SVAA 1BUQA 1QMAA 4HKVB 2GEYA 4WP5A 3OV4A 1M1K4 1W6YA 4R80A 3PCSA 1D6ZA 1VQ93 2CW9A 2XR8B 1W5ZA 5AI1A 2ZL8A 2O9UX 1GD3A 4O02B 5IG0A 2CK3H 5D81A 1Q7Y4 2XGLA 1SPUA 1OPYA 1YI23 3NM7A 1W01A 4ZM8A 3I0YA 1NB5I 1Q40A 4HJLB 2D42A 3QK9A 1AVKA 2W56A 3N54B 3EQQB 3G6E3 1VQO3 1A2VA 3FG1A 3HI7A 1S5AA 2ML6A 2WGQA 1NU3A 3T0UA 4LMIA 1VQ73 2E2TA 3DGNA 2W03A 2Y74A 1IQ8A 2CFKA 2P38A 1LOXA 1UUWB 1RRHA 3UNLA 3CXC2 5DRVA 2FNQA 3F40A 3FLJA 1VQ63 4XB5A 5JPUA 3EN1B 2B24B 3V99A 4GL6A 2XF3A 1CQSA 1JB4A 3AMOA 1E97A 4R4KA 3OWYA 4RZMA 1OGZA 3G713 4MMXB 1AR0A 4MMYB 2GU1A 1VQK3 4JF8A 1EKMA 1O7HB 3CPOA 1W6GA 1GY5A 1OUNA 4KFEA 3DUKA 4K1UA 2BMOB 2QA43 4KFDA 3U1WA 3OXAA 4J9AA 2PZVA 4XM4A 3ROBA 5AIFA 3LTAA 1K8A4 1CEWI 4XBYA 3EBTA 5KP1A 2BMQB 3K7CA 3B8LA 2WOHA 1VZZA 3KIIA 2CHCA 1UW1A 1VQL3 2QIYA 4R9KA 1F8NA 2C11A 1AV4A 5BXQA 1KQS2 1LXEA 1ROAA 2Z7AA 2OOVA 5ELJA 3NBJA 2W9QA 4MEIA 4BTWA 2KXGA 5IG4A 1N8R4 4WYKB 4X2HA 3CCR3 1YJW3 3HIGA 3IJEB 2JQ5A 3NV0B 1DYUA 2A15A 4RNYA 3S67A 1VQM3 5AYSC 5A0OB 4XBTA 3CCM3 2RFRA 4FCZA 1K28A 1RN7A 3JUQA 3WMDA 3X3YA 3F8XA 2HMJB 3D9RA 3BNBA 3F8HA 4WFOA 3G8ZA 1M904 3LTCA 1JN5A 1VQP3 1KD14 5AIGA 2RCDA 3GZXB 5BVBA 3CNXA 2OOVC 4OK0A 4EC6A 3K5TA 3NHXA 1WNHA 4LZIA 1QVG2 3H3HA 3ECFA 3UL5A 1FA3A 3T8NA 2OQEA 3DM8A 3S27A 3EE1A 4BTXA 2CG0A 3Q1CA 1L5GB 1E3RA 2W9PA 3DZLA 3Q90A 4Q53A 3MYTA 3IPTA 2SBLA 3PYJA 2E2VA 1UUVB 4NREA 3CCS3 4KVHA 2CWTA 4HM7B 1O7PB 2YX9A 1V74A 1U8CB 1LVNA 1TIJA 2CFGA 1N5PA 3RDEA 4XDVA 2E2UA 3NM2A 4NHFA 2BHMA 1U5OA 3MHEA 3HK4A 1OHPA 5CLKA 1N9EA 4N6UA 2CKFB 3S5CA 1TFKA 1MOLA 3NQZA 2KRTA 1DVCA 4HM4B 3H51A 1IV7A 1SQWA 1OF5B 1OH0A 2W0QA 3FG4A 1Y4KA 1D6YA 1STDA 3SEDA 3BNEA 5LC7A 4HM0B 3K63A 3JUNA 4MJDA 3FG3A 2Z76A 1GY6A 3OX9A 3J7Yd 5EQLA 1GS3A 3UL6A 3GZYB 4O8SA 3FSDA 3IMAB 3EBYA 1W6CA 4FCJA 2ZDJA 4O2HA 2OTJ3 2P0MA 1Q814 3DGOA 2Q07A 3N8BA 1IVVA 1N9JA 3GRDA 3LH4A 1K41A 8CHOA 4N6V0 2HMNB 3LT9A 3BNDA 4CCVA 3CPW2 2K54A 3K9MC 3CCE3 3MG3A 5AIHA 2LQVA 1Q864 1YGEA 4STDA 1EG9B 3SLUA 1QJGA 2INXA 4HBRA 3EX9A 1E3VA 3NXJA 3EN8A 1NJI4 1O7GB 1HU9A 3F7SA 1SJWA 3FF2A 1K9M4 4L8PA 4N6NB 1QVF2 4IIAA 5IERA 2HMOB 1VQ43 1IQXA 3I553 1KC84 3KKGA 1K734 1YHQ3 1N5HA 2YFIB 3K0ZA 3B4OA 1WQLB 4FR9A 2STDA 2P05A 1W2ZA 1GY7A 1YVBI 4K61A 2B1XB 3JUOA 1YJ93 4H61A 3PXMA 3PS8A 2IA7A 4N6LA 2IUJA 1SIIA 2HMMB 2F98A 1DMMA 4IT7A 3STDA 2FGTA 3CC23 2P0XA 1ISKA 3T8UA 3WOEB 3DGLA 1A67A 3SOYA 1W2B2 2QGUA 3L0RA 4N3VA 2XH9A 1AVLA 3PGBA 5HGRA 3BLZA 4X2OA 2W04A 5IG3A 2XGNA 3LZAA 4R9LA 1WTHA 2HMLB 4WWUC 1IQYA 3S29A 4WHAA 3OWSA 4RBNA 5KP3A 3NBBA 5JBSA 1W00A 1TFOA 2W6JH 2OTL3 1VQN3 2BO9B 1W02A 5I97A 4GB5A 1NB3I 1W4NA 3FF0A 5CF2A 2RSXA 3VSYA 3CCU3 3LXUX 1IDPA 5IG5A 3NBRA 1JRQA 3EF8A 3F7XA 4HVNA 2HMKB 1T5YA 3BNCA 2KCDA 3OW22 3WOFB 1OHSA 3WA3A 3U97A 2MF7A 1JB2A 3PZWA 4OUQA 1SIHA 2OWPA 3LMLA 5LC6A 2YFLB 4FMCA 4H3UA 1IVXA 2YFJB 4LEHA 4WYKA 1S723 3HZPA 3N9HA 2O3OA 3NV0A 4XBXA 5DREA 3G0KA 3CCV3 1TP6A 3JVCA 3RGAA 4EV2A 2IUKA 2F86B 3EC9A 1DMNA 2CG1A 3GZRA 3NX0A 4XDWA 4L7KA 5IW9A 2M7OA 1FGRA 5TGNA 6STDA 3MSOA 1YIT3 1RRLA 2R4IA 3F9SA 3EHCA 4KZ1A 5JPPA 3KE7A 4BTYA 5AEWB 4N6OB 1WMPA 1NDOB 2V1LA 5IF6A 3DMCA 2LYXA 1JKGB 4HM3B 3NQYA 3QRDA 1FGTA 1STFI 4HM6B 3X3XA 2GBXB 4QWTA 2WOFA 4AKZA 3I563 2Y73A 4FMBA 4HM5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6N B;  3KSE D;  1LXE A;  1ROA A;  5ELJ A;  1G96 A;  2W9Q A;  1M9G A;  2KXG A;  1N5H A;  2CH9 A;  1FUW A;  1YVB I;  3S67 A;  1CYU A;  1IV9 A;  5ELU A;  5A0O B;  3PXM A;  1RN7 A;  3PS8 A;  1CYV A;  4EYC A;  4N6L A;  1A90 A;  3Q2P A;  1GD4 A;  1R4C A;  4IT7 A;  1PFP A;  1A67 A;  4LZI A;  1WNH A;  3L0R A;  3UL5 A;  1DVD A;  1FA3 A;  1EQK A;  3SVA A;  4N6T A;  2W9P A;  3PYJ A;  2BO9 B;  1TIJ A;  1N5P A;  1NB3 I;  2O9U X;  1GD3 A;  4N6U A;  1MOL A;  1MNL A;  1DVC A;  4ZM8 A;  1NB5 I;  1IV7 A;  3MWZ A;  5LC7 A;  5LC6 A;  5EQL A;  3UL6 A;  2OCT A;  3IMA B;  3NX0 A;  1N9J A;  3LH4 A;  4N6V 0;  4CCV A;  3K9M C;  4N6O B;  3GAX A;  4TX4 A;  3QRD A;  1CEW I;  1STF I;  4N6M A;  3KFQ C;  1KWI A; 
#chains in the Genus database with same CATH topology
 3DY5 A;  3B4P A;  2GU3 A;  3FGY A;  4HM8 B;  2XSO B;  3X41 A;  7STD A;  3KSE D;  3VF1 A;  1UCJ A;  3JUM A;  4BIR A;  3V98 A;  2W56 B;  5STD A;  3B7C A;  1BUJ A;  2K0M A;  3D4A A;  1FW7 A;  3LOY A;  3GWR A;  1BNJ A;  4HYZ A;  3KCH A;  3BIR A;  3WA2 X;  4LGQ A;  1NO3 A;  1UGI A;  1FUW A;  1US1 A;  5CF1 A;  3PCR A;  3O8Y A;  3TDG A;  1OF5 A;  3EJV A;  5M1A A;  1IV9 A;  1RTU A;  2F56 A;  3SOA A;  9RNT A;  1JKG A;  3SXX A;  1RJO A;  2CFD A;  1Q42 A;  3D3L A;  1O7W B;  4LSO A;  3FCS B;  5BU4 A;  1YIJ 3;  1UGH I;  1Z1S A;  4I4K A;  2GXF A;  3AMO B;  3KZT A;  1I2F A;  1TTO A;  5KP4 A;  1WMO A;  1YJN 3;  4OVM A;  2XSH B;  5FGO A;  2XFS A;  1BRN L;  1ZGX A;  3UJM A;  4EXR A;  1UI7 A;  1DVD A;  1ROV A;  3JUP A;  5D82 A;  3S28 A;  1EQK A;  5CK6 A;  4N6T A;  2IMJ A;  4CPK A;  1MWS A;  1NWW A;  1IT7 A;  1QAF A;  1RGE A;  4G1M B;  4HM1 B;  3EB8 A;  1EUI C;  2GEX A;  1PU4 A;  1WMN A;  4U13 A;  1RKY A;  3LTB A;  5IEP A;  2CFW A;  3CXC 2;  2MC8 A;  1FGM A;  3KSP A;  3CC4 3;  5D83 A;  1HZ1 A;  2XFT A;  1DMQ A;  1OAC A;  1LRA A;  3CMA 3;  2PNC A;  3DH2 A;  1I2G A;  1ZX2 A;  4HZ9 B;  3X3Z A;  2Z6B A;  1BRG A;  3FH1 A;  1Q82 4;  1QAK A;  4R1K A;  1ASK A;  4AEQ A;  3GZB A;  1MNL A;  3AHS A;  3UB1 A;  2Y74 A;  1JJ2 2;  4RNZ A;  3F14 A;  4ORL A;  2C4B A;  1JNQ A;  3CME 3;  3MWZ A;  3G4S 3;  2CFL A;  2CC3 A;  1GYB A;  2BT3 A;  3CNM A;  3Q3F A;  4FMD A;  1O7N B;  3DXO A;  4J5G A;  4EV5 A;  1I3F A;  1TUH A;  4IPB A;  1OCV A;  2CWV A;  4FCM A;  3E99 A;  5IEO A;  2L4V A;  4GHO A;  2CWU A;  1BNS A;  3X42 A;  1OHO A;  1FGO A;  1KSI A;  4K90 B;  1RNB A;  1JN5 B;  2OCT A;  4FMA A;  3WDG B;  1V58 A;  1IYY A;  5RNT A;  3MPH A;  2I9W A;  1N8Q A;  3CC7 3;  1LQM B;  3CU3 A;  3DGM A;  3NUV A;  1RGL A;  1IT8 A;  1W7C A;  2BIR A;  3ALA A;  1JZD A;  2IY2 A;  1IU7 A;  4PEJ A;  1RGH A;  3WHO A;  2RGQ A;  1PY3 A;  4CDL A;  3G16 A;  1IVW A;  1TU5 A;  1D6U A;  2BNG A;  2QEX 3;  3VGN A;  1B2X A;  5AYR B;  7GSP A;  2F99 A;  2Z77 A;  3HX8 A;  4HM2 B;  1C7H A;  1IK3 A;  2GBW B;  1AY7 A;  2CX0 A;  3M8C A;  4HZB B;  4AKY A;  3X40 A;  1UCK A;  3CCQ 3;  3GAX A;  1IVU A;  4TX4 A;  5FW5 A;  2UX0 A;  1ULJ B;  3BB9 A;  4N6M A;  1QAL A;  3KFQ C;  3A5E A;  4J8T A;  3SX1 A;  1VQ8 3;  5EEO A;  1RGK A;  4K1V A;  1KWI A;  5EVH A;  4LYL B;  1JV2 B;  2C10 A;  2D1W A;  3ZFZ A;  2WGO A;  3CCL 3;  1B2U A;  5G1L A;  4O3V A;  3LTD A;  2RBI A;  2FXT A;  4HAA A;  1BVI A;  1G96 A;  2XRX B;  2SAR A;  1O7M B;  1M9G A;  4CJN A;  3A76 A;  5G2G A;  2KF3 A;  1M1X B;  3MKI A;  2KF5 A;  2ML5 A;  5AEU B;  2CH9 A;  1ZS7 A;  3FZW A;  4RNT A;  4L8O A;  1HKX A;  5AII A;  3OWU A;  3RGR A;  1FGQ A;  2F5M A;  1CYU A;  2CIU A;  4KT3 B;  5ELU A;  1BRH A;  4DKI A;  1JB5 A;  1J2B A;  1CYV A;  3LYG A;  5CXO A;  4EYC A;  1A2K A;  2WO0 A;  3V92 A;  1YGW A;  5IEN A;  2GSP A;  1A90 A;  2P09 A;  3Q2P A;  3CCJ 3;  1GD4 A;  3D5G A;  1BSC A;  3GSP A;  1R4C A;  1OGX A;  2BMR B;  3HII A;  3RNT A;  3SYU A;  1UI8 A;  4EBG A;  3FKA A;  1G0T A;  1PFP A;  1Q40 B;  1ZO2 A;  3WOD G;  1EA2 A;  2XEP A;  4JRF A;  3CD6 3;  3LT8 A;  1VQ5 3;  2W2C A;  1B20 A;  1GMQ A;  2JDI H;  2R41 A;  4KFF A;  2OQE C;  3MG1 A;  4MMZ B;  1LNH A;  3KN4 A;  3MG2 A;  6GSP A;  1BNI A;  1BRS A;  1ULI B;  1BOX A;  3ER7 A;  1QMA A;  3HOH A;  3SVA A;  4HKV B;  1RSN A;  2GEY A;  1BUQ A;  4WP5 A;  1I3I A;  3AGO A;  3OV4 A;  1FZU A;  1JBS A;  1LOW A;  1W6Y A;  4R80 A;  1M1K 4;  3PCS A;  1D6Z A;  1VQ9 3;  1CH0 A;  1R4Y A;  2CW9 A;  2XR8 B;  1W5Z A;  5AI1 A;  2ZL8 A;  1RN1 A;  1BSD A;  1LNI A;  2O9U X;  2UUG C;  1TRQ A;  1B2Z A;  1GD3 A;  4O02 B;  5IG0 A;  2CK3 H;  5D81 A;  1Q7Y 4;  2XGL A;  1SPU A;  1OPY A;  1YI2 3;  3NM7 A;  1GOY A;  1W01 A;  4ZM8 A;  3I0Y A;  1NB5 I;  1Q40 A;  4HJL B;  1RGA A;  1BRJ A;  2D42 A;  3QK9 A;  1AVK A;  2W56 A;  3N54 B;  3EQQ B;  3G6E 3;  1VQO 3;  1A2V A;  3FG1 A;  3HI7 A;  1S5A A;  2ML6 A;  1JZO A;  2WGQ A;  1NU3 A;  1JBR A;  3T0U A;  4LMI A;  1VQ7 3;  2E2T A;  2RNT A;  2IYJ A;  2W03 A;  3DGN A;  1SAR A;  1IQ8 A;  2AAE A;  2CFK A;  1LOX A;  1UUW B;  1RRH A;  2P38 A;  1GOU A;  2H0I A;  5DRV A;  3UNL A;  2FNQ A;  3F40 A;  3FLJ A;  1VQ6 3;  4XB5 A;  3WR2 A;  5JPU A;  3EN1 B;  2B24 B;  1I0V A;  3V99 A;  4GL6 A;  2XF3 A;  1CQS A;  1JB4 A;  3AMO A;  1E97 A;  4R4K A;  3OWY A;  4RZM A;  1OGZ A;  3G71 3;  4MMX B;  1AR0 A;  4MMY B;  2GU1 A;  1VQK 3;  4JF8 A;  1EKM A;  1O7H B;  3CPO A;  1W6G A;  1GY5 A;  1OUN A;  4KFE A;  3DUK A;  2ZA4 A;  4K1U A;  2BMO B;  2QA4 3;  4KFD A;  2AAD A;  3OXA A;  4J9A A;  2PZV A;  4XM4 A;  1B3S A;  1EEJ A;  5AIF A;  3LTA A;  3ROB A;  1K8A 4;  1CEW I;  4XBY A;  3EBT A;  5KP1 A;  5M18 A;  1PYL A;  1B27 A;  2BMQ B;  3K7C A;  3B8L A;  2WOH A;  1VZZ A;  1UCL A;  1YVS A;  3KII A;  2CHC A;  1UW1 A;  8RNT A;  1VQL 3;  2QIY A;  4R9K A;  1F8N A;  2C11 A;  1AV4 A;  5BXQ A;  1KQS 2;  1LXE A;  1ROA A;  2Z7A A;  2OOV A;  5ELJ A;  3NBJ A;  2W9Q A;  4MEI A;  4BTW A;  2KXG A;  5IG4 A;  4J5K A;  2KAA A;  1B21 A;  1N8R 4;  4WYK B;  4X2H A;  3CCR 3;  1YJW 3;  3HIG A;  3IJE B;  2JQ5 A;  3NV0 B;  1DYU A;  5GSP A;  5BIR A;  2A15 A;  4RNY A;  2BU4 A;  2F5W A;  1RLS A;  3S67 A;  1VQM 3;  5AYS C;  5A0O B;  4XBT A;  1MWT A;  3CCM 3;  2RFR A;  4FCZ A;  1K28 A;  1RN7 A;  3JUQ A;  3WMD A;  3X3Y A;  1BAN A;  3F8X A;  2HMJ B;  3D9R A;  3BNB A;  1I2E A;  3F8H A;  4WFO A;  3G8Z A;  2H0H A;  1M90 4;  3LTC A;  1JN5 A;  1VQP 3;  1KD1 4;  5AIG A;  2RCD A;  3GZX B;  5BVB A;  3CNX A;  2OOV C;  4OK0 A;  4EC6 A;  3K5T A;  3NHX A;  1WNH A;  4LZI A;  1QVG 2;  3H3H A;  3ECF A;  3UL5 A;  1FA3 A;  3T8N A;  2OQE A;  3DM8 A;  1T3B A;  3S27 A;  3EE1 A;  6RNT A;  4BTX A;  2CG0 A;  3Q1C A;  1L5G B;  1E3R A;  1MWU A;  2W9P A;  3DZL A;  3Q90 A;  4Q53 A;  3MYT A;  3IPT A;  2SBL A;  3PYJ A;  4ILF A;  2E2V A;  1UUV B;  4NRE A;  3CCS 3;  4KVH A;  2CWT A;  4HM7 B;  1C54 A;  1O7P B;  2YX9 A;  1V74 A;  1U8C B;  1AQZ A;  1LVN A;  1TIJ A;  1RMS A;  1N5P A;  2CFG A;  1BNG A;  1MGR A;  3RDE A;  4XDV A;  1RDS A;  2E2U A;  3NM2 A;  4NHF A;  2BHM A;  1U5O A;  3MHE A;  1BRI A;  3HK4 A;  1GMP A;  1OHP A;  5CLK A;  1N9E A;  4N6U A;  2CKF B;  1GMR A;  3S5C A;  1GSP A;  1TFK A;  1MOL A;  3NQZ A;  2KRT A;  1DVC A;  1RCL A;  3H51 A;  4HM4 B;  1IV7 A;  1SQW A;  1OF5 B;  1OH0 A;  2W0Q A;  1MWR A;  3FG4 A;  1Y4K A;  1D6Y A;  1RCK A;  1STD A;  3SED A;  3BNE A;  5LC7 A;  5M19 A;  4HM0 B;  3K63 A;  3JUN A;  4MJD A;  1BNF A;  3FG3 A;  2Z76 A;  4NPB A;  1GY6 A;  3OX9 A;  1UCI A;  3J7Y d;  5EQL A;  1GS3 A;  3UL6 A;  3GZY B;  4O8S A;  1RGC A;  7RNT A;  1BU4 A;  3FSD A;  3IMA B;  3EBY A;  1W6C A;  4FCJ A;  2ZDJ A;  4O2H A;  3ZG0 A;  2OTJ 3;  2P0M A;  1BRK A;  1Q81 4;  3DGO A;  2Q07 A;  2HOH A;  3N8B A;  1IVV A;  1N9J A;  2KF4 A;  3GRD A;  3LH4 A;  1K41 A;  1DET A;  4N6V 0;  2HMN B;  8CHO A;  3DGY A;  3D79 A;  3LT9 A;  3BND A;  4CCV A;  3CPW 2;  2K54 A;  3K9M C;  3CCE 3;  3MG3 A;  5AIH A;  2LQV A;  1Q86 4;  1YGE A;  4STD A;  1EG9 B;  3SLU A;  1QJG A;  2INX A;  4HBR A;  3EX9 A;  1E3V A;  3NXJ A;  3EN8 A;  1NJI 4;  1O7G B;  1HU9 A;  3F7S A;  1TRP A;  1SJW A;  1VQQ A;  3FF2 A;  1K9M 4;  4L8P A;  4N6N B;  1QVF 2;  1RN4 A;  4IIA A;  1BGS A;  5IER A;  2HMO B;  3U1W A;  1IQX A;  1VQ4 3;  1B2S A;  3I55 3;  1KC8 4;  1X1Y A;  3KKG A;  1K73 4;  1YHQ 3;  1N5H A;  2YFI B;  3K0Z A;  3B4O A;  4I5Q A;  1WQL B;  1FUT A;  4FR9 A;  2STD A;  2P05 A;  1W2Z A;  1GY7 A;  1I70 A;  1YVB I;  4K61 A;  2B1X B;  3JUO A;  1YJ9 3;  4H61 A;  1Q7H A;  2CX1 A;  1I8V A;  3PXM A;  5HOH A;  3D5I A;  3PS8 A;  2IA7 A;  4N6L A;  2IUJ A;  1SII A;  2HMM B;  4HM5 B;  3ZG5 A;  2F98 A;  1DMM A;  4IT7 A;  3STD A;  1FYS A;  2FGT A;  4BL3 A;  3CC2 3;  2P0X A;  1ISK A;  1MGW A;  1RGG A;  3T8U A;  3WOE B;  3DGL A;  1A67 A;  3SOY A;  1W2B 2;  2QGU A;  3L0R A;  4N3V A;  2XH9 A;  4HOH A;  1AVL A;  1BSB A;  3AHW A;  3PGB A;  5HGR A;  3BLZ A;  1BNR A;  4X2O A;  2W04 A;  5IG3 A;  1DE3 A;  2XGN A;  3LZA A;  1X1X A;  1X1W A;  4R9L A;  4GSP A;  1WTH A;  2HML B;  4WWU C;  1IQY A;  3S29 A;  4WHA A;  3OWS A;  4RBN A;  3BU4 A;  1LOV A;  2H0G A;  2J8X B;  2UGI A;  1W00 A;  3NBB A;  1TFO A;  5KP3 A;  5JBS A;  1A2P A;  2W6J H;  2OTL 3;  1VQN 3;  4BU4 A;  1LOY A;  1NNV A;  2BO9 B;  1W02 A;  5I97 A;  4GB5 A;  1NB3 I;  1W4N A;  3FF0 A;  5CF2 A;  2RSX A;  3VSY A;  3CCU 3;  3LXU X;  3AGN A;  1BIR A;  1IDP A;  4BL2 A;  5IG5 A;  3NBR A;  1JRQ A;  3EF8 A;  3F7X A;  1RNT A;  4HVN A;  1V57 A;  2HMK B;  1T5Y A;  3BNC A;  2KCD A;  3OW2 2;  1RHL A;  1GOV A;  3WOF B;  1RGF A;  1OHS A;  1BSE A;  3U97 A;  3WA3 A;  2MF7 A;  1JB2 A;  3PZW A;  4OUQ A;  1SIH A;  2OWP A;  3LML A;  5LC6 A;  1HYF A;  2YFL B;  4FMC A;  1G02 A;  4H3U A;  1IVX A;  2YFJ B;  1UDI I;  4LEH A;  4WYK A;  1S72 3;  3HZP A;  3N9H A;  2F4Y A;  2O3O A;  3NV0 A;  4XBX A;  5DRE A;  3G0K A;  3CCV 3;  1BSA A;  1JBT A;  1TP6 A;  3JVC A;  3RGA A;  4EV2 A;  2IUK A;  2F86 B;  3EC9 A;  1TJD A;  1T2H A;  1DMN A;  2CG1 A;  3GZR A;  3NX0 A;  4XDW A;  4L7K A;  5IW9 A;  4EW5 A;  2M7O A;  1FGR A;  2L1S A;  5TGN A;  1T2I A;  1UUG B;  6STD A;  3MSO A;  1YIT 3;  1Q9E A;  1RRL A;  2R4I A;  1LQG C;  1B2M A;  1BNE A;  3EHC A;  3F9S A;  4KZ1 A;  5JPP A;  2K3D A;  3KE7 A;  3URP A;  4BTY A;  5AEW B;  4N6O B;  1WMP A;  1NDO B;  1YNV X;  2V1L A;  3DMC A;  2KF6 A;  2LYX A;  1JKG B;  4HM3 B;  5IF6 A;  3NQY A;  3QRD A;  1FGT A;  1STF I;  4HM6 B;  3X3X A;  1I0X A;  2GBX B;  1BAO A;  4QWT A;  2WOF A;  5G1K A;  4AKZ A;  1X1U A;  3I56 3;  1FUS A;  2Y73 A;  4FMB A;  2ZHX B; 
#chains in the Genus database with same CATH homology
 3DY5 A;  3B4P A;  2GU3 A;  3FGY A;  4HM8 B;  2XSO B;  3X41 A;  7STD A;  3KSE D;  3VF1 A;  3JUM A;  3V98 A;  2W56 B;  5STD A;  3B7C A;  2K0M A;  3LOY A;  3GWR A;  4HYZ A;  3WA2 X;  4LGQ A;  1NO3 A;  1FUW A;  1US1 A;  5CF1 A;  3PCR A;  3O8Y A;  3TDG A;  1OF5 A;  3EJV A;  1IV9 A;  3SOA A;  1JKG A;  3SXX A;  1RJO A;  2CFD A;  1Q42 A;  3D3L A;  1O7W B;  4LSO A;  3FCS B;  1YIJ 3;  1Z1S A;  4I4K A;  2GXF A;  3AMO B;  3KZT A;  5KP4 A;  1WMO A;  1YJN 3;  4OVM A;  2XSH B;  5FGO A;  2XFS A;  3UJM A;  4EXR A;  1UI7 A;  1DVD A;  1ROV A;  3JUP A;  5D82 A;  3S28 A;  1EQK A;  5CK6 A;  4N6T A;  2IMJ A;  1NWW A;  1IT7 A;  1QAF A;  4G1M B;  4HM1 B;  3EB8 A;  2GEX A;  1PU4 A;  1WMN A;  4U13 A;  1RKY A;  3LTB A;  5IEP A;  2CFW A;  2MC8 A;  1FGM A;  3KSP A;  3CC4 3;  5D83 A;  2XFT A;  1DMQ A;  1OAC A;  3CMA 3;  2PNC A;  1ZX2 A;  4HZ9 B;  3X3Z A;  2Z6B A;  3FH1 A;  1Q82 4;  1QAK A;  4R1K A;  1ASK A;  4AEQ A;  3GZB A;  1MNL A;  3UB1 A;  1JJ2 2;  4RNZ A;  3F14 A;  4ORL A;  3CME 3;  1JNQ A;  3MWZ A;  3G4S 3;  2CFL A;  2CC3 A;  1GYB A;  2BT3 A;  3CNM A;  4FMD A;  5G2G A;  1O7N B;  3DXO A;  4EV5 A;  1TUH A;  4IPB A;  1OCV A;  2CWV A;  4FCM A;  3E99 A;  5IEO A;  2L4V A;  2CWU A;  3X42 A;  1OHO A;  1FGO A;  1KSI A;  4K90 B;  1JN5 B;  2OCT A;  4FMA A;  3WDG B;  3MPH A;  2I9W A;  1N8Q A;  3CC7 3;  3CU3 A;  3DGM A;  3NUV A;  1IT8 A;  1W7C A;  3ALA A;  1IU7 A;  4PEJ A;  2RGQ A;  4CDL A;  3G16 A;  1IVW A;  1TU5 A;  1D6U A;  2BNG A;  2QEX 3;  3VGN A;  5AYR B;  2F99 A;  2Z77 A;  3HX8 A;  4HM2 B;  1C7H A;  1IK3 A;  2GBW B;  3M8C A;  4HZB B;  4AKY A;  3X40 A;  3CCQ 3;  3GAX A;  1IVU A;  4TX4 A;  5FW5 A;  2UX0 A;  1ULJ B;  3BB9 A;  4N6M A;  1QAL A;  3KFQ C;  4J8T A;  3SX1 A;  1VQ8 3;  5EEO A;  4K1V A;  1KWI A;  5EVH A;  1JV2 B;  2C10 A;  2D1W A;  2WGO A;  3CCL 3;  4O3V A;  3LTD A;  2FXT A;  1G96 A;  2XRX B;  1O7M B;  1M9G A;  3A76 A;  1M1X B;  3MKI A;  2ML5 A;  5AEU B;  2CH9 A;  3FZW A;  4L8O A;  1HKX A;  5AII A;  3OWU A;  3RGR A;  1FGQ A;  1CYU A;  2CIU A;  5ELU A;  1JB5 A;  1J2B A;  1CYV A;  3LYG A;  5CXO A;  4EYC A;  1A2K A;  2WO0 A;  3V92 A;  5IEN A;  1A90 A;  2P09 A;  3Q2P A;  3CCJ 3;  1GD4 A;  1R4C A;  1OGX A;  2BMR B;  3HII A;  1UI8 A;  4EBG A;  3FKA A;  1PFP A;  1Q40 B;  3WOD G;  1ZO2 A;  1EA2 A;  2XEP A;  4JRF A;  3CD6 3;  3LT8 A;  1VQ5 3;  2W2C A;  2JDI H;  4KFF A;  2OQE C;  3MG1 A;  4MMZ B;  1LNH A;  3KN4 A;  3MG2 A;  3ER7 A;  1ULI B;  3SVA A;  1BUQ A;  1QMA A;  4HKV B;  2GEY A;  4WP5 A;  3OV4 A;  1M1K 4;  1W6Y A;  4R80 A;  3PCS A;  1D6Z A;  1VQ9 3;  2CW9 A;  2XR8 B;  1W5Z A;  5AI1 A;  2ZL8 A;  2O9U X;  1GD3 A;  4O02 B;  5IG0 A;  2CK3 H;  5D81 A;  1Q7Y 4;  2XGL A;  1SPU A;  1OPY A;  1YI2 3;  3NM7 A;  1W01 A;  4ZM8 A;  3I0Y A;  1NB5 I;  1Q40 A;  4HJL B;  2D42 A;  3QK9 A;  1AVK A;  2W56 A;  3N54 B;  3EQQ B;  3G6E 3;  1VQO 3;  1A2V A;  3FG1 A;  3HI7 A;  1S5A A;  2ML6 A;  2WGQ A;  1NU3 A;  3T0U A;  4LMI A;  1VQ7 3;  2E2T A;  3DGN A;  2W03 A;  2Y74 A;  1IQ8 A;  2CFK A;  2P38 A;  1LOX A;  1UUW B;  1RRH A;  3UNL A;  3CXC 2;  5DRV A;  2FNQ A;  3F40 A;  3FLJ A;  1VQ6 3;  4XB5 A;  5JPU A;  3EN1 B;  2B24 B;  3V99 A;  4GL6 A;  2XF3 A;  1CQS A;  1JB4 A;  3AMO A;  1E97 A;  4R4K A;  3OWY A;  4RZM A;  1OGZ A;  3G71 3;  4MMX B;  1AR0 A;  4MMY B;  2GU1 A;  1VQK 3;  4JF8 A;  1EKM A;  1O7H B;  3CPO A;  1W6G A;  1GY5 A;  1OUN A;  4KFE A;  3DUK A;  4K1U A;  2BMO B;  2QA4 3;  4KFD A;  3U1W A;  3OXA A;  4J9A A;  2PZV A;  4XM4 A;  3ROB A;  5AIF A;  3LTA A;  1K8A 4;  1CEW I;  4XBY A;  3EBT A;  5KP1 A;  2BMQ B;  3K7C A;  3B8L A;  2WOH A;  1VZZ A;  3KII A;  2CHC A;  1UW1 A;  1VQL 3;  2QIY A;  4R9K A;  1F8N A;  2C11 A;  1AV4 A;  5BXQ A;  1KQS 2;  1LXE A;  1ROA A;  2Z7A A;  2OOV A;  5ELJ A;  3NBJ A;  2W9Q A;  4MEI A;  4BTW A;  2KXG A;  5IG4 A;  1N8R 4;  4WYK B;  4X2H A;  3CCR 3;  1YJW 3;  3HIG A;  3IJE B;  2JQ5 A;  3NV0 B;  1DYU A;  2A15 A;  4RNY A;  3S67 A;  1VQM 3;  5AYS C;  5A0O B;  4XBT A;  3CCM 3;  2RFR A;  4FCZ A;  1K28 A;  1RN7 A;  3JUQ A;  3WMD A;  3X3Y A;  3F8X A;  2HMJ B;  3D9R A;  3BNB A;  3F8H A;  4WFO A;  3G8Z A;  1M90 4;  3LTC A;  1JN5 A;  1VQP 3;  1KD1 4;  5AIG A;  2RCD A;  3GZX B;  5BVB A;  3CNX A;  2OOV C;  4OK0 A;  4EC6 A;  3K5T A;  3NHX A;  1WNH A;  4LZI A;  1QVG 2;  3H3H A;  3ECF A;  3UL5 A;  1FA3 A;  3T8N A;  2OQE A;  3DM8 A;  3S27 A;  3EE1 A;  4BTX A;  2CG0 A;  3Q1C A;  1L5G B;  1E3R A;  2W9P A;  3DZL A;  3Q90 A;  4Q53 A;  3MYT A;  3IPT A;  2SBL A;  3PYJ A;  2E2V A;  1UUV B;  4NRE A;  3CCS 3;  4KVH A;  2CWT A;  4HM7 B;  1O7P B;  2YX9 A;  1V74 A;  1U8C B;  1LVN A;  1TIJ A;  2CFG A;  1N5P A;  3RDE A;  4XDV A;  2E2U A;  3NM2 A;  4NHF A;  2BHM A;  1U5O A;  3MHE A;  3HK4 A;  1OHP A;  5CLK A;  1N9E A;  4N6U A;  2CKF B;  3S5C A;  1TFK A;  1MOL A;  3NQZ A;  2KRT A;  1DVC A;  4HM4 B;  3H51 A;  1IV7 A;  1SQW A;  1OF5 B;  1OH0 A;  2W0Q A;  3FG4 A;  1Y4K A;  1D6Y A;  1STD A;  3SED A;  3BNE A;  5LC7 A;  4HM0 B;  3K63 A;  3JUN A;  4MJD A;  3FG3 A;  2Z76 A;  1GY6 A;  3OX9 A;  3J7Y d;  5EQL A;  1GS3 A;  3UL6 A;  3GZY B;  4O8S A;  3FSD A;  3IMA B;  3EBY A;  1W6C A;  4FCJ A;  2ZDJ A;  4O2H A;  2OTJ 3;  2P0M A;  1Q81 4;  3DGO A;  2Q07 A;  3N8B A;  1IVV A;  1N9J A;  3GRD A;  3LH4 A;  1K41 A;  8CHO A;  4N6V 0;  2HMN B;  3LT9 A;  3BND A;  4CCV A;  3CPW 2;  2K54 A;  3K9M C;  3CCE 3;  3MG3 A;  5AIH A;  2LQV A;  1Q86 4;  1YGE A;  4STD A;  1EG9 B;  3SLU A;  1QJG A;  2INX A;  4HBR A;  3EX9 A;  1E3V A;  3NXJ A;  3EN8 A;  1NJI 4;  1O7G B;  1HU9 A;  3F7S A;  1SJW A;  3FF2 A;  1K9M 4;  4L8P A;  4N6N B;  1QVF 2;  4IIA A;  5IER A;  2HMO B;  1VQ4 3;  1IQX A;  3I55 3;  1KC8 4;  3KKG A;  1K73 4;  1YHQ 3;  1N5H A;  2YFI B;  3K0Z A;  3B4O A;  1WQL B;  4FR9 A;  2STD A;  2P05 A;  1W2Z A;  1GY7 A;  1YVB I;  4K61 A;  2B1X B;  3JUO A;  1YJ9 3;  4H61 A;  3PXM A;  3PS8 A;  2IA7 A;  4N6L A;  2IUJ A;  1SII A;  2HMM B;  2F98 A;  1DMM A;  4IT7 A;  3STD A;  2FGT A;  3CC2 3;  2P0X A;  1ISK A;  3T8U A;  3WOE B;  3DGL A;  1A67 A;  3SOY A;  1W2B 2;  2QGU A;  3L0R A;  4N3V A;  2XH9 A;  1AVL A;  3PGB A;  5HGR A;  3BLZ A;  4X2O A;  2W04 A;  5IG3 A;  2XGN A;  3LZA A;  4R9L A;  1WTH A;  2HML B;  4WWU C;  1IQY A;  3S29 A;  4WHA A;  3OWS A;  4RBN A;  5KP3 A;  3NBB A;  5JBS A;  1W00 A;  1TFO A;  2W6J H;  2OTL 3;  1VQN 3;  2BO9 B;  1W02 A;  5I97 A;  4GB5 A;  1NB3 I;  1W4N A;  3FF0 A;  5CF2 A;  2RSX A;  3VSY A;  3CCU 3;  3LXU X;  1IDP A;  5IG5 A;  3NBR A;  1JRQ A;  3EF8 A;  3F7X A;  4HVN A;  2HMK B;  1T5Y A;  3BNC A;  2KCD A;  3OW2 2;  3WOF B;  1OHS A;  3WA3 A;  3U97 A;  2MF7 A;  1JB2 A;  3PZW A;  4OUQ A;  1SIH A;  2OWP A;  3LML A;  5LC6 A;  2YFL B;  4FMC A;  4H3U A;  1IVX A;  2YFJ B;  4LEH A;  4WYK A;  1S72 3;  3HZP A;  3N9H A;  2O3O A;  3NV0 A;  4XBX A;  5DRE A;  3G0K A;  3CCV 3;  1TP6 A;  3JVC A;  3RGA A;  4EV2 A;  2IUK A;  2F86 B;  3EC9 A;  1DMN A;  2CG1 A;  3GZR A;  3NX0 A;  4XDW A;  4L7K A;  5IW9 A;  2M7O A;  1FGR A;  5TGN A;  6STD A;  3MSO A;  1YIT 3;  1RRL A;  2R4I A;  3F9S A;  3EHC A;  4KZ1 A;  5JPP A;  3KE7 A;  4BTY A;  5AEW B;  4N6O B;  1WMP A;  1NDO B;  2V1L A;  5IF6 A;  3DMC A;  2LYX A;  1JKG B;  4HM3 B;  3NQY A;  3QRD A;  1FGT A;  1STF I;  4HM6 B;  3X3X A;  2GBX B;  4QWT A;  2WOF A;  4AKZ A;  3I56 3;  2Y73 A;  4FMB A;  4HM5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...