5ELJA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
ENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAKVWVKGLTNWKLGMNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SUMO-Affirmer-S2D5
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
total genus 17
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eljA00
3L0RA 1FUWA 1GD4A 3SVAA 1NB5I 4LZIA 1ROAA 3LH4A 3MWZA 1NB3I 3S67A 5LC6A 1STFI 4N6TA 1CYVA 3PYJA 5ELJA 3PXMA 2OCTA 1N5HA 2CH9A 3NX0A 3QRDA 2O9UX 3KSED 4N6NB 1CEWI 5EQLA 3PS8A 1MNLA 1MOLA 4EYCA 1KWIA 1YVBI 2BO9B 1G96A 5LC7A 1EQKA 2W9PA 3UL5A 4ZM8A 2KXGA 4N6LA 4N6OB 1R4CA 4IT7A 1DVCA 5A0OB 1A90A 4N6MA 3GAXA 1CYUA 1N5PA 2W9QA 4CCVA 3UL6A 1LXEA 3K9MC 1M9GA 1PFPA 1N9JA 4N6UA 1FA3A 1TIJA 1A67A 3KFQC 1GD3A 4N6V0 1DVDA 1WNHA 1RN7A 1IV9A 3Q2PA 3IMAB 1IV7A 4TX4A 5ELUA
chains in the Genus database with same CATH superfamily
1BRKA 1OF5A 1Q40B 1TFOA 2RFRA 4EC6A 5IG4A 3SVAA 4HBRA 4Q53A 1BVIA 2AADA 1ROAA 2F86B 1BRHA 1LVNA 1NB3I 2RCDA 3CNMA 1CH0A 1JN5B 1YGEA 2CC3A 3HIGA 4N6TA 1D6UA 1NJI4 2XFTA 1W6YA 2P05A 2XF3A 5ELJA 3B4PA 3LOYA 1Q864 3H3HA 1RGAA 2BMRB 4JRFA 3OWUA 2W6JH 2Z76A 1RN1A 3F7XA 5IF6A 3LMLA 1TTOA 1UUVB 3EF8A 3I563 3S29A 1JBTA 1JBSA 1Q7Y4 4BL3A 1IYYA 3JUPA 2W03A 2ZA4A 1GMPA 3UJMA 1QALA 5IG3A 3F40A 4L7KA 4CJNA 5D82A 4JF8A 1JV2B 3DXOA 1ZGXA 3GZRA 4KFEA 1O7NB 2F56A 1FYSA 2W56B 4AKZA 2B1XB 3PS8A 3SEDA 1MNLA 1S5AA 2CX0A 3EE1A 1SJWA 1UW1A 3D3LA 5AIIA 1AVLA 1JJ22 1I70A 3LTBA 3CMA3 1L5GB 1B2XA 4XBYA 1FGOA 3KCHA 3S5CA 2CWUA 1W4NA 2OOVC 2CFWA 1BRJA 3AMOA 3CCR3 1IVVA 1N8QA 3KIIA 1AQZA 3NV0B 2HMMB 2ZDJA 3CD63 1JB4A 4RNTA 3OX9A 1FZUA 1B2UA 1BNEA 3A5EA 4EV5A 1EQKA 3LTAA 1B2ZA 1ZO2A 4R1KA 1GS3A 1UI8A 3FLJA 4H3UA 5G1KA 5IW9A 3K0ZA 2KF3A 4R9LA 3CU3A 3HOHA 2HMKB 1B21A 1D6YA 4IT7A 4J5KA 2K0MA 1RTUA 1A90A 2GSPA 1BRSA 2M7OA 1Q824 1PYLA 3H51A 1VQM3 4CCVA 4WYKA 1JBRA 3QK9A 1YVSA 1PFPA 5TGNA 3SYUA 1I2FA 3OXAA 1O7MB 2BU4A 4N6UA 1UCIA 3EHCA 3SXXA 4KFFA 5KP1A 1I3IA 1KQS2 4J9AA 3CME3 3KFQC 1JKGA 2HMOB 5AIGA 3KN4A 1I0XA 2E2VA 2CWVA 3BNDA 3VF1A 2CFKA 3M8CA 3STDA 5AI1A 2GU1A 2Y73A 4BTWA 1QMAA 3JUQA 1YJW3 3V99A 5BU4A 1FW7A 1RRHA 1OH0A 2W0QA 4AEQA 1UUWB 2YX9A 3G713 4GSPA 3OWYA 1BNFA 2MF7A 2HOHA 1UGIA 1OACA 3EB8A 3EJVA 4J8TA 1RNBA 5HOHA 5DREA 5FGOA 1ZS7A 3FZWA 1T2HA 3L0RA 1GOUA 1NDOB 1FUWA 1RLSA 4I4KA 3CNXA 1GD4A 3OV4A 1X1YA 1T3BA 3AHSA 3FGYA 5CXOA 3N54B 4LZIA 4FR9A 3V98A 1I3FA 1MWUA 1BNIA 1RGEA 4BTXA 5IEPA 3MWZA 4EXRA 5KP3A 3FG4A 4XDWA 3S67A 1K41A 2IY2A 2R41A 4R80A 1Q7HA 3HX8A 4OVMA 4EBGA 5AIFA 4XBTA 2KAAA 1FGQA 3LXUX 1CYVA 1NU3A 3ROBA 5G2GA 3GRDA 3HIIA 2XGLA 1LRAA 4BTYA 1UI7A 4XM4A 4FMAA 4R9KA 1EUIC 1I2GA 2CKFB 4LMIA 1TP6A 1AVKA 1YNVX 1W6GA 2K54A 4HZBB 1D6ZA 5EVHA 1TRQA 3LT9A 1N5HA 3JVCA 2D1WA 4FMDA 3X3XA 2E2UA 2W2CA 4CDLA 3BB9A 4RNYA 1O7WB 2KF6A 2GBXB 2UX0A 3BNEA 4K61A 3WHOA 4KZ1A 5CF2A 3B8LA 1BU4A 3ZG0A 3NM2A 3DY5A 1Z1SA 3KSED 3PCRA 1VQ43 2QGUA 3AHWA 4HKVB 2CFDA 1FGTA 1UGHI 2CK3H 4HOHA 2GXFA 4RZMA 4PEJA 4GHOA 3FKAA 2YFLB 1MOLA 1RNTA 3S28A 1BSDA 3NUVA 2A15A 2BMQB 1OGZA 4XBXA 3T8NA 3WA2X 1KWIA 3MPHA 1SIIA 1YVBI 1M1XB 2IUKA 4IPBA 1K28A 1YHQ3 1W5ZA 2BO9B 1B3SA 2IA7A 3JUMA 2F98A 2KF4A 1IU7A 3HI7A 4MEIA 4IIAA 2KF5A 5AIHA 4HM0B 4N3VA 5D81A 2BIRA 3DUKA 3VSYA 3NBRA 2I9WA 1W00A 1K734 1M904 4OUQA 2GEYA 3AGNA 3EQQB 3CCU3 4J5GA 1VQN3 1LNHA 1UUGB 2RSXA 2XRXB 3GSPA 2XSOB 3FSDA 4N6LA 1FUSA 3MG3A 4N6OB 4RNZA 5EEOA 1R4CA 2CFLA 2QIYA 4ILFA 5D83A 5JPUA 1HYFA 1B27A 1WMNA 3OWSA 5CF1A 3ALAA 3G4S3 1BNJA 1BUJA 2SARA 1GOYA 1IK3A 2FXTA 3GAXA 5M1AA 1BRNL 1CYUA 4FMCA 2QA43 2BT3A 3CPOA 4GB5A 2CG1A 2YFJB 1YJN3 1Q40A 1M9GA 3CCS3 2AAEA 1N9JA 1V57A 1FA3A 4HJLB 3EX9A 4WFOA 5IENA 5IG0A 1X1XA 3KZTA 3N9HA 1DMNA 2KRTA 1A67A 2XH9A 1SARA 2XR8B 1Q9EA 4NHFA 8CHOA 1JN5A 4N6V0 1N9EA 3MKIA 4HM1B 3RGRA 3CCQ3 2MC8A 2OWPA 1RGKA 1MWSA 1J2BA 4QWTA 1GOVA 4WWUC 2OQEC 5JBSA 5M19A 5BXQA 1IVXA 2FNQA 4HVNA 1K8A4 1A2KA 1RN7A 1X1UA 2OTJ3 3OW22 3IMAB 3FF0A 1F8NA 3UB1A 5I97A 1VQL3 1RSNA 1DYUA 1BNGA 5ELUA 3CPW2 2P38A 1EEJA 1OHSA 2F5MA 3FCSB 1UCJA 1LOXA 1B20A 1CQSA 3T8UA 1RJOA 3CCE3 1RDSA 3DGOA 1WMPA 5GSPA 3I0YA 5STDA 3IJEB 4FCJA 3A76A 1OHOA 1RMSA 3HZPA 1HU9A 1WTHA 2W56A 5LC6A 2PNCA 3U1WA 1OGXA 2C11A 3GZBA 3LTDA 3CCM3 3SOYA 1HKXA 3NQZA 3B7CA 4LYLB 1PU4A 3WA3A 1IQYA 2OTL3 3CCL3 1IQ8A 4HM2B 3MG1A 2P0MA 2OCTA 3BNCA 3EBTA 3CC43 5AYSC 4I5QA 1GY5A 3DM8A 3NV0A 2JQ5A 1US1A 2P0XA 4G1MB 4ORLA 3DMCA 1KSIA 2WO0A 3D79A 1YI23 3WDGB 1OF5B 3CC23 2WOHA 2XFSA 3NX0A 4AKYA 1MWRA 3KKGA 2D42A 2OQEA 1BRGA 1G0TA 1S723 2C10A 4N6NB 1GY7A 5AYRB 3JUNA 1X1WA 1TFKA 2IUJA 1KD14 1FUTA 4EYCA 5RNTA 1VQ83 1VQ53 1JNQA 1W2ZA 4K1VA 1GMRA 3PZWA 3G8ZA 4HM3B 5AEUB 3X3YA 1T2IA 2B24B 2L4VA 1VZZA 1VQK3 1WMOA 3K63A 4HYZA 3BNBA 4FCZA 3CCJ3 4H61A 1GYBA 3D5IA 1G02A 7RNTA 1G96A 3LTCA 1BUQA 2O3OA 2LYXA 3BIRA 4GL6A 5CK6A 1YIT3 1KC84 1JRQA 8RNTA 1VQ63 3X40A 5LC7A 3VGNA 2LQVA 1JZDA 5BIRA 3SOAA 2E2TA 2ZL8A 2W9PA 5DRVA 1BRIA 1T5YA 1YIJ3 3EBYA 4ZM8A 1ASKA 2KXGA 5G1LA 4FMBA 3EN1B 1IVWA 4RBNA 1RRLA 4X2HA 3FH1A 2R4IA 2GU3A 4KVHA 1BNSA 3D4AA 1W01A 2SBLA 6GSPA 1BSEA 7GSPA 1DE3A 3CCV3 1NWWA 2ML6A 4HM8B 1DMQA 1SPUA 3F7SA 4HM7B 4LGQA 3SX1A 1N5PA 2W9QA 6STDA 3UL6A 1LXEA 1B2MA 3AMOB 4CPKA 2GBWB 1RGGA 1B2SA 2PZVA 4NREA 2STDA 4BIRA 5FW5A 1TU5A 1E3VA 4LEHA 4MJDA 2BHMA 3RGAA 1YJ93 4FCMA 3DH2A 4NPBA 5CLKA 3WOEB 1VQP3 3GWRA 5M18A 1OHPA 3N8BA 1V58A 2HMJB 1DVDA 4O8SA 3U97A 4K90B 2JDIH 3EN8A 1VQQA 1U8CB 1WNHA 4O2HA 4XB5A 1IDPA 2J8XB 1BSCA 1IV9A 1C7HA 1AV4A 1I8VA 1JB2A 1RGFA 2IMJA 5IERA 3I553 3ZFZA 4MMZB 3NQYA 3CXC2 1BAOA 1DETA 3ECFA 3FG3A 2IYJA 3URPA 2QEX3 4MMXB 2V1LA 4WYKB 2Y74A 1IQXA 3DGMA 1TRPA 3DGNA 1BIRA 2CIUA 3HK4A 3PGBA 1VQ93 3SLUA 1IT7A 1RGLA 2BMOB 1NB5I 1A2VA 4WP5A 3X3ZA 3LT8A 1W2B2 1RCKA 1C54A 1RGHA 2CHCA 3LH4A 2C4BA 3WODG 1QVF2 1JKGB 3NBBA 2ML5A 1A2PA 1BGSA 1STFI 4X2OA 2HMLB 2H0GA 3MSOA 3WOFB 3DZLA 1SIHA 1UDII 3PXMA 3PYJA 3TDGA 1LOVA 2Z77A 3GZYB 1QAFA 2XSHB 4U13A 2ZHXB 4LSOA 3T0UA 1RN4A 2CG0A 1LQMB 3MG2A 1O7PB 4STDA 2WGQA 1IVUA 1BSBA 1QAKA 1QJGA 4R4KA 1QVG2 1IT8A 1MWTA 1O7GB 2CH9A 3G16A 2CW9A 3RDEA 3QRDA 5HGRA 1RCLA 1VQ73 2O9UX 1I2EA 3NHXA 5BVBA 1AR0A 1OUNA 3K5TA 4L8OA 2W04A 3DGLA 9RNTA 1Q814 1BNRA 1TJDA 3RNTA 3D9RA 3LZAA 1CEWI 5EQLA 2YFIB 1OPYA 1RGCA 3Q1CA 1EKMA 4BU4A 3F8HA 1U5OA 1HZ1A 1V74A 4HM5B 1GMQA 3Q90A 4XDVA 3F8XA 3D5GA 4MMYB 3G6E3 3MYTA 3MHEA 1EG9B 3B4OA 1ULIB 4EV2A 6RNTA 4DKIA 4BL2A 4O02B 1M1K4 1W02A 2H0HA 3EC9A 2GEXA 2CWTA 3IPTA 1STDA 2Z7AA 2WGOA 2H0IA 3K7CA 2RGQA 4HM4B 1O7HB 5IG5A 3LYGA 1LOWA 1ROVA 1MGWA 2FGTA 3WMDA 1JZOA 1R4YA 1RKYA 3FG1A 1W6CA 4L8PA 2F5WA 4OK0A 3UL5A 3ER7A 1E3RA 3WR2A 1Q42A 3BU4A 2Q07A 1UCLA 4KT3B 2UGIA 1GSPA 5JPPA 1FGRA 1BSAA 3Q3FA 2OOVA 1SQWA 1VQO3 1TUHA 3F14A 3ZG5A 2CX1A 2RNTA 2XEPA 3CC73 3GZXB 3X42A 1DVCA 3F9SA 5A0OB 3J7Yd 1BANA 4N6MA 1DMMA 2WOFA 3PCSA 2K3DA 1Y4KA 5KP4A 4KFDA 2Z6BA 4WHAA 1NNVA 2XGNA 1LOYA 3K9MC 3KSPA 5AEWB 7STDA 1ISKA 1UCKA 4K1UA 1FGMA 3NXJA 1E97A 1LNIA 1OCVA 1RHLA 2BNGA 1LQGC 3JUOA 2P09A 1TIJA 3BLZA 1NO3A 2RBIA 4HZ9B 1AY7A 1GD3A 5IEOA 3S27A 3X41A 3AGOA 1YGWA 3V92A 3O8YA 3UNLA 1ULJB 2F4YA 1ZX2A 3NM7A 4EW5A 1W7CA 1BOXA 3G0KA 3DGYA 4HM6B 1K9M4 1PY3A 4O3VA 2KCDA 1GY6A 2INXA 1WQLB 3E99A 3Q2PA 2F99A 2L1SA 1JB5A 2UUGC 1IV7A 1MGRA 2CFGA 4HAAA 1N8R4 3FF2A 3KE7A 2HMNB 1EA2A 3NBJA 4TX4A 1I0VA
chains in the Genus database with same CATH topology
1OF5A 1Q40B 1TFOA 2RFRA 4EC6A 5IG4A 3SVAA 4HBRA 4Q53A 1ROAA 2F86B 1LVNA 1NB3I 2RCDA 3CNMA 1JN5B 1YGEA 2CC3A 3HIGA 4N6TA 1D6UA 1NJI4 2XFTA 1W6YA 2P05A 2XF3A 5ELJA 3B4PA 3LOYA 1Q864 3H3HA 2BMRB 4JRFA 3OWUA 2W6JH 2Z76A 3F7XA 5IF6A 3LMLA 1UUVB 3EF8A 3I563 3S29A 1Q7Y4 3JUPA 2W03A 3UJMA 1QALA 5IG3A 3F40A 4L7KA 5D82A 4JF8A 1JV2B 3DXOA 3GZRA 4KFEA 1O7NB 4AKZA 2W56B 2B1XB 3PS8A 3SEDA 1MNLA 1S5AA 3EE1A 1SJWA 1UW1A 3D3LA 5AIIA 1AVLA 1JJ22 3LTBA 3CMA3 1L5GB 4XBYA 3S5CA 1FGOA 2CWUA 1W4NA 2OOVC 2CFWA 3AMOA 3CCR3 1IVVA 1N8QA 3KIIA 3NV0B 2HMMB 2ZDJA 3CD63 1JB4A 3OX9A 4EV5A 1EQKA 3LTAA 1ZO2A 4R1KA 1GS3A 1UI8A 3FLJA 4H3UA 5IW9A 3K0ZA 4R9LA 3CU3A 2HMKB 1D6YA 4IT7A 2K0MA 1A90A 2M7OA 1Q824 3H51A 1VQM3 4CCVA 4WYKA 3QK9A 1PFPA 5TGNA 3OXAA 1O7MB 4N6UA 3EHCA 3SXXA 4KFFA 5KP1A 1KQS2 4J9AA 3CME3 3KFQC 1JKGA 2HMOB 5AIGA 3KN4A 2E2VA 2CWVA 3BNDA 3VF1A 2CFKA 3M8CA 3STDA 5AI1A 2GU1A 2Y73A 4BTWA 1QMAA 3JUQA 1YJW3 3V99A 1RRHA 1OH0A 2W0QA 4AEQA 1UUWB 2YX9A 3G713 3OWYA 2MF7A 3EJVA 4J8TA 1OACA 3EB8A 5DREA 5FGOA 3FZWA 3L0RA 1NDOB 1FUWA 4I4KA 3CNXA 1GD4A 3OV4A 3FGYA 5CXOA 3N54B 4LZIA 4FR9A 3V98A 4BTXA 5IEPA 3MWZA 4EXRA 5KP3A 3FG4A 4XDWA 3S67A 1K41A 4R80A 3HX8A 4OVMA 4EBGA 5AIFA 4XBTA 1FGQA 3LXUX 1CYVA 1NU3A 3ROBA 5G2GA 3GRDA 3HIIA 2XGLA 4BTYA 1UI7A 4XM4A 4FMAA 4R9KA 2CKFB 4LMIA 1TP6A 1AVKA 1W6GA 2K54A 4HZBB 1D6ZA 5EVHA 3LT9A 1N5HA 3JVCA 2D1WA 4FMDA 3X3XA 2E2UA 2W2CA 4CDLA 3BB9A 4RNYA 1O7WB 2GBXB 2UX0A 3BNEA 4K61A 4KZ1A 5CF2A 3B8LA 3NM2A 3DY5A 1Z1SA 3KSED 3PCRA 1VQ43 2QGUA 4HKVB 2CFDA 1FGTA 2CK3H 4RZMA 2GXFA 4PEJA 3FKAA 2YFLB 1MOLA 3S28A 3NUVA 2A15A 2BMQB 1OGZA 4XBXA 3T8NA 3WA2X 1KWIA 3MPHA 1SIIA 1YVBI 1M1XB 2IUKA 4IPBA 1K28A 1YHQ3 1W5ZA 2BO9B 3JUMA 2IA7A 2F98A 1IU7A 3HI7A 4MEIA 4IIAA 5AIHA 4HM0B 4N3VA 5D81A 3DUKA 3VSYA 3NBRA 2I9WA 1W00A 1K734 1M904 4OUQA 2GEYA 3EQQB 3CCU3 1VQN3 1LNHA 2RSXA 2XRXB 2XSOB 3FSDA 4N6LA 3MG3A 4N6OB 4RNZA 5EEOA 1R4CA 2CFLA 2QIYA 5D83A 5JPUA 1WMNA 3OWSA 5CF1A 3ALAA 3G4S3 1IK3A 2FXTA 3GAXA 1CYUA 4FMCA 2QA43 2BT3A 3CPOA 4GB5A 2CG1A 2YFJB 1YJN3 1Q40A 1M9GA 3CCS3 1N9JA 1FA3A 4HJLB 3EX9A 4WFOA 5IENA 5IG0A 3KZTA 3N9HA 1DMNA 2KRTA 1A67A 2XH9A 2XR8B 4NHFA 8CHOA 1JN5A 4N6V0 1N9EA 3MKIA 4HM1B 3RGRA 3CCQ3 2MC8A 2OWPA 1J2BA 4QWTA 4WWUC 2OQEC 5JBSA 5BXQA 1IVXA 2FNQA 4HVNA 1K8A4 1A2KA 1RN7A 2OTJ3 3OW22 3IMAB 3FF0A 1F8NA 3UB1A 5I97A 1VQL3 1DYUA 5ELUA 3CPW2 2P38A 1OHSA 3FCSB 1LOXA 1CQSA 3T8UA 1RJOA 3CCE3 3DGOA 1WMPA 3I0YA 5STDA 3IJEB 4FCJA 3A76A 1OHOA 3HZPA 1HU9A 1WTHA 2W56A 5LC6A 2PNCA 3U1WA 1OGXA 2C11A 3GZBA 3LTDA 3CCM3 3SOYA 1HKXA 3NQZA 3B7CA 3WA3A 1PU4A 2OTL3 1IQYA 3CCL3 1IQ8A 4HM2B 3MG1A 2P0MA 2OCTA 3BNCA 3EBTA 3CC43 5AYSC 1GY5A 3DM8A 3NV0A 2JQ5A 1US1A 2P0XA 4G1MB 4ORLA 3DMCA 1KSIA 2WO0A 1YI23 3WDGB 1OF5B 3CC23 2WOHA 2XFSA 3NX0A 4AKYA 3KKGA 2D42A 2OQEA 1S723 2C10A 4N6NB 1GY7A 5AYRB 3JUNA 1TFKA 2IUJA 1KD14 4EYCA 1VQ83 1VQ53 1JNQA 1W2ZA 4K1VA 3PZWA 3G8ZA 4HM3B 5AEUB 3X3YA 2B24B 2L4VA 1VZZA 1VQK3 1WMOA 3K63A 4HYZA 3BNBA 4FCZA 3CCJ3 4H61A 1GYBA 1G96A 3LTCA 1BUQA 2O3OA 2LYXA 5CK6A 4GL6A 1KC84 1YIT3 1JRQA 1VQ63 3X40A 5LC7A 3VGNA 2LQVA 3SOAA 2E2TA 2ZL8A 2W9PA 5DRVA 1T5YA 1YIJ3 3EBYA 4ZM8A 1ASKA 2KXGA 4FMBA 3EN1B 1IVWA 4RBNA 1RRLA 4X2HA 3FH1A 2R4IA 2GU3A 4KVHA 1W01A 2SBLA 3CCV3 1NWWA 2ML6A 4HM8B 1DMQA 1SPUA 3F7SA 4HM7B 4LGQA 3SX1A 1N5PA 2W9QA 6STDA 3UL6A 1LXEA 3AMOB 2GBWB 2PZVA 4NREA 2STDA 5FW5A 1TU5A 1E3VA 4LEHA 4MJDA 2BHMA 3RGAA 1YJ93 4FCMA 5CLKA 3WOEB 1VQP3 3GWRA 1OHPA 3N8BA 2HMJB 1DVDA 4O8SA 3U97A 4K90B 2JDIH 3EN8A 1U8CB 1WNHA 4O2HA 4XB5A 1IDPA 1C7HA 1IV9A 1AV4A 1JB2A 2IMJA 5IERA 3I553 3CXC2 4MMZB 3NQYA 3ECFA 3FG3A 2QEX3 4MMXB 2V1LA 4WYKB 2Y74A 1IQXA 3DGMA 3DGNA 3HK4A 2CIUA 3PGBA 1VQ93 3SLUA 1IT7A 2BMOB 1NB5I 1A2VA 4WP5A 3X3ZA 3LT8A 1W2B2 3LH4A 2CHCA 1QVF2 3WODG 1JKGB 3NBBA 2ML5A 4X2OA 1STFI 2HMLB 3MSOA 3WOFB 3DZLA 1SIHA 3PXMA 3PYJA 3TDGA 3GZYB 2Z77A 1QAFA 2XSHB 4U13A 4LSOA 3T0UA 2CG0A 3MG2A 1O7PB 4STDA 2WGQA 1IVUA 1QAKA 1QJGA 4R4KA 1QVG2 1IT8A 1O7GB 2CH9A 3G16A 2CW9A 3RDEA 3QRDA 5HGRA 1VQ73 2O9UX 5BVBA 3NHXA 1Q814 1AR0A 1OUNA 3K5TA 4L8OA 2W04A 3DGLA 3D9RA 3LZAA 1CEWI 5EQLA 2YFIB 1OPYA 3Q1CA 1EKMA 3F8HA 1U5OA 1V74A 4HM5B 3Q90A 4XDVA 3F8XA 4MMYB 3G6E3 3MYTA 3MHEA 1EG9B 3B4OA 1ULIB 4EV2A 1M1K4 4O02B 1W02A 3EC9A 2GEXA 2CWTA 3IPTA 1STDA 2Z7AA 2WGOA 3K7CA 4HM4B 2RGQA 1O7HB 5IG5A 3LYGA 3WMDA 1ROVA 2FGTA 1RKYA 3FG1A 1W6CA 4L8PA 4OK0A 3UL5A 3ER7A 1E3RA 1Q42A 2Q07A 5JPPA 1FGRA 2OOVA 1SQWA 1VQO3 1TUHA 3F14A 2XEPA 3CC73 3GZXB 3X42A 1DVCA 3F9SA 5A0OB 3J7Yd 4N6MA 1DMMA 2WOFA 3PCSA 5KP4A 1Y4KA 4KFDA 2Z6BA 4WHAA 2XGNA 3K9MC 3KSPA 7STDA 5AEWB 1ISKA 4K1UA 1FGMA 3NXJA 1E97A 1OCVA 2BNGA 3JUOA 2P09A 1TIJA 3BLZA 1NO3A 4HZ9B 3S27A 1GD3A 3X41A 5IEOA 3V92A 3O8YA 3UNLA 1ULJB 1ZX2A 3NM7A 1W7CA 3G0KA 1K9M4 4HM6B 4O3VA 2KCDA 1GY6A 2INXA 1WQLB 3E99A 3Q2PA 2F99A 1JB5A 1N8R4 1IV7A 2CFGA 3FF2A 3KE7A 2HMNB 1EA2A 3NBJA 4TX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0R A;  1FUW A;  1GD4 A;  3SVA A;  1NB5 I;  4LZI A;  1ROA A;  3LH4 A;  3MWZ A;  1NB3 I;  3S67 A;  5LC6 A;  1STF I;  4N6T A;  1CYV A;  3PYJ A;  5ELJ A;  3PXM A;  2OCT A;  1N5H A;  2CH9 A;  3NX0 A;  3QRD A;  2O9U X;  3KSE D;  4N6N B;  1CEW I;  5EQL A;  3PS8 A;  1MNL A;  1MOL A;  4EYC A;  1KWI A;  1YVB I;  2BO9 B;  1G96 A;  5LC7 A;  1EQK A;  2W9P A;  3UL5 A;  4ZM8 A;  2KXG A;  4N6L A;  4N6O B;  1R4C A;  4IT7 A;  1DVC A;  5A0O B;  1A90 A;  4N6M A;  3GAX A;  1CYU A;  1N5P A;  2W9Q A;  4CCV A;  3UL6 A;  1LXE A;  3K9M C;  1M9G A;  1PFP A;  1N9J A;  4N6U A;  1FA3 A;  1TIJ A;  1A67 A;  3KFQ C;  1GD3 A;  4N6V 0;  1DVD A;  1WNH A;  1RN7 A;  1IV9 A;  3Q2P A;  3IMA B;  1IV7 A;  4TX4 A;  5ELU A; 
#chains in the Genus database with same CATH topology
 1BRK A;  1OF5 A;  1Q40 B;  1TFO A;  2RFR A;  4EC6 A;  5IG4 A;  3SVA A;  4HBR A;  4Q53 A;  1BVI A;  2AAD A;  1ROA A;  2F86 B;  1BRH A;  1LVN A;  1NB3 I;  2RCD A;  3CNM A;  1CH0 A;  1JN5 B;  1YGE A;  2CC3 A;  3HIG A;  4N6T A;  1D6U A;  1NJI 4;  2XFT A;  1W6Y A;  2P05 A;  2XF3 A;  5ELJ A;  3B4P A;  3LOY A;  1Q86 4;  3H3H A;  1RGA A;  2BMR B;  4JRF A;  3OWU A;  2W6J H;  2Z76 A;  1RN1 A;  3F7X A;  5IF6 A;  3LML A;  1TTO A;  1UUV B;  3EF8 A;  3I56 3;  3S29 A;  1JBT A;  1JBS A;  1Q7Y 4;  4BL3 A;  1IYY A;  3JUP A;  2W03 A;  2ZA4 A;  1GMP A;  3UJM A;  1QAL A;  5IG3 A;  3F40 A;  4L7K A;  4CJN A;  5D82 A;  4JF8 A;  1JV2 B;  3DXO A;  1ZGX A;  3GZR A;  4KFE A;  1O7N B;  2F56 A;  1FYS A;  2W56 B;  4AKZ A;  2B1X B;  3PS8 A;  3SED A;  1MNL A;  1S5A A;  2CX0 A;  3EE1 A;  1SJW A;  1UW1 A;  3D3L A;  5AII A;  1AVL A;  1JJ2 2;  1I70 A;  3LTB A;  3CMA 3;  1L5G B;  1B2X A;  4XBY A;  1FGO A;  3KCH A;  3S5C A;  2CWU A;  1W4N A;  2OOV C;  2CFW A;  1BRJ A;  3AMO A;  3CCR 3;  1IVV A;  1N8Q A;  3KII A;  1AQZ A;  3NV0 B;  2HMM B;  2ZDJ A;  3CD6 3;  1JB4 A;  4RNT A;  3OX9 A;  1FZU A;  1B2U A;  1BNE A;  3A5E A;  4EV5 A;  1EQK A;  3LTA A;  1B2Z A;  1ZO2 A;  4R1K A;  1GS3 A;  1UI8 A;  3FLJ A;  4H3U A;  5G1K A;  5IW9 A;  3K0Z A;  2KF3 A;  4R9L A;  3CU3 A;  3HOH A;  2HMK B;  1B21 A;  1D6Y A;  4IT7 A;  4J5K A;  2K0M A;  1RTU A;  1A90 A;  2GSP A;  1BRS A;  2M7O A;  1Q82 4;  1PYL A;  3H51 A;  1VQM 3;  4CCV A;  4WYK A;  1JBR A;  3QK9 A;  1YVS A;  1PFP A;  5TGN A;  3SYU A;  1I2F A;  3OXA A;  1O7M B;  2BU4 A;  4N6U A;  1UCI A;  3EHC A;  3SXX A;  4KFF A;  5KP1 A;  1I3I A;  1KQS 2;  4J9A A;  3CME 3;  3KFQ C;  1JKG A;  2HMO B;  5AIG A;  3KN4 A;  1I0X A;  2E2V A;  2CWV A;  3BND A;  3VF1 A;  2CFK A;  3M8C A;  3STD A;  5AI1 A;  2GU1 A;  2Y73 A;  4BTW A;  1QMA A;  3JUQ A;  1YJW 3;  3V99 A;  5BU4 A;  1FW7 A;  1RRH A;  1OH0 A;  2W0Q A;  4AEQ A;  1UUW B;  2YX9 A;  3G71 3;  4GSP A;  3OWY A;  1BNF A;  2MF7 A;  2HOH A;  1UGI A;  1OAC A;  3EB8 A;  3EJV A;  4J8T A;  1RNB A;  5HOH A;  5DRE A;  5FGO A;  1ZS7 A;  3FZW A;  1T2H A;  3L0R A;  1GOU A;  1NDO B;  1FUW A;  1RLS A;  4I4K A;  3CNX A;  1GD4 A;  3OV4 A;  1X1Y A;  1T3B A;  3AHS A;  3FGY A;  5CXO A;  3N54 B;  4LZI A;  4FR9 A;  3V98 A;  1I3F A;  1MWU A;  1BNI A;  1RGE A;  4BTX A;  5IEP A;  3MWZ A;  4EXR A;  5KP3 A;  3FG4 A;  4XDW A;  3S67 A;  1K41 A;  2IY2 A;  2R41 A;  4R80 A;  1Q7H A;  3HX8 A;  4OVM A;  4EBG A;  5AIF A;  4XBT A;  2KAA A;  1FGQ A;  3LXU X;  1CYV A;  1NU3 A;  3ROB A;  5G2G A;  3GRD A;  3HII A;  2XGL A;  1LRA A;  4BTY A;  1UI7 A;  4XM4 A;  4FMA A;  4R9K A;  1EUI C;  1I2G A;  2CKF B;  4LMI A;  1TP6 A;  1AVK A;  1YNV X;  1W6G A;  2K54 A;  4HZB B;  1D6Z A;  5EVH A;  1TRQ A;  3LT9 A;  1N5H A;  3JVC A;  2D1W A;  4FMD A;  3X3X A;  2E2U A;  2W2C A;  4CDL A;  3BB9 A;  4RNY A;  1O7W B;  2KF6 A;  2GBX B;  2UX0 A;  3BNE A;  4K61 A;  3WHO A;  4KZ1 A;  5CF2 A;  3B8L A;  1BU4 A;  3ZG0 A;  3NM2 A;  3DY5 A;  1Z1S A;  3KSE D;  3PCR A;  1VQ4 3;  2QGU A;  3AHW A;  4HKV B;  2CFD A;  1FGT A;  1UGH I;  2CK3 H;  4HOH A;  2GXF A;  4RZM A;  4PEJ A;  4GHO A;  3FKA A;  2YFL B;  1MOL A;  1RNT A;  3S28 A;  1BSD A;  3NUV A;  2A15 A;  2BMQ B;  1OGZ A;  4XBX A;  3T8N A;  3WA2 X;  1KWI A;  3MPH A;  1SII A;  1YVB I;  1M1X B;  2IUK A;  4IPB A;  1K28 A;  1YHQ 3;  1W5Z A;  2BO9 B;  1B3S A;  2IA7 A;  3JUM A;  2F98 A;  2KF4 A;  1IU7 A;  3HI7 A;  4MEI A;  4IIA A;  2KF5 A;  5AIH A;  4HM0 B;  4N3V A;  5D81 A;  2BIR A;  3DUK A;  3VSY A;  3NBR A;  2I9W A;  1W00 A;  1K73 4;  1M90 4;  4OUQ A;  2GEY A;  3AGN A;  3EQQ B;  3CCU 3;  4J5G A;  1VQN 3;  1LNH A;  1UUG B;  2RSX A;  2XRX B;  3GSP A;  2XSO B;  3FSD A;  4N6L A;  1FUS A;  3MG3 A;  4N6O B;  4RNZ A;  5EEO A;  1R4C A;  2CFL A;  2QIY A;  4ILF A;  5D83 A;  5JPU A;  1HYF A;  1B27 A;  1WMN A;  3OWS A;  5CF1 A;  3ALA A;  3G4S 3;  1BNJ A;  1BUJ A;  2SAR A;  1GOY A;  1IK3 A;  2FXT A;  3GAX A;  5M1A A;  1BRN L;  1CYU A;  4FMC A;  2QA4 3;  2BT3 A;  3CPO A;  4GB5 A;  2CG1 A;  2YFJ B;  1YJN 3;  1Q40 A;  1M9G A;  3CCS 3;  2AAE A;  1N9J A;  1V57 A;  1FA3 A;  4HJL B;  3EX9 A;  4WFO A;  5IEN A;  5IG0 A;  1X1X A;  3KZT A;  3N9H A;  1DMN A;  2KRT A;  1A67 A;  2XH9 A;  1SAR A;  2XR8 B;  1Q9E A;  4NHF A;  8CHO A;  1JN5 A;  4N6V 0;  1N9E A;  3MKI A;  4HM1 B;  3RGR A;  3CCQ 3;  2MC8 A;  2OWP A;  1RGK A;  1MWS A;  1J2B A;  4QWT A;  1GOV A;  4WWU C;  2OQE C;  5JBS A;  5M19 A;  5BXQ A;  1IVX A;  2FNQ A;  4HVN A;  1K8A 4;  1A2K A;  1RN7 A;  1X1U A;  2OTJ 3;  3OW2 2;  3IMA B;  3FF0 A;  1F8N A;  3UB1 A;  5I97 A;  1VQL 3;  1RSN A;  1DYU A;  1BNG A;  5ELU A;  3CPW 2;  2P38 A;  1EEJ A;  1OHS A;  2F5M A;  3FCS B;  1UCJ A;  1LOX A;  1B20 A;  1CQS A;  3T8U A;  1RJO A;  3CCE 3;  1RDS A;  3DGO A;  1WMP A;  5GSP A;  3I0Y A;  5STD A;  3IJE B;  4FCJ A;  3A76 A;  1OHO A;  1RMS A;  3HZP A;  1HU9 A;  1WTH A;  2W56 A;  5LC6 A;  2PNC A;  3U1W A;  1OGX A;  2C11 A;  3GZB A;  3LTD A;  3CCM 3;  3SOY A;  1HKX A;  3NQZ A;  3B7C A;  4LYL B;  1PU4 A;  3WA3 A;  1IQY A;  2OTL 3;  3CCL 3;  1IQ8 A;  4HM2 B;  3MG1 A;  2P0M A;  2OCT A;  3BNC A;  3EBT A;  3CC4 3;  5AYS C;  4I5Q A;  1GY5 A;  3DM8 A;  3NV0 A;  2JQ5 A;  1US1 A;  2P0X A;  4G1M B;  4ORL A;  3DMC A;  1KSI A;  2WO0 A;  3D79 A;  1YI2 3;  3WDG B;  1OF5 B;  3CC2 3;  2WOH A;  2XFS A;  3NX0 A;  4AKY A;  1MWR A;  3KKG A;  2D42 A;  2OQE A;  1BRG A;  1G0T A;  1S72 3;  2C10 A;  4N6N B;  1GY7 A;  5AYR B;  3JUN A;  1X1W A;  1TFK A;  2IUJ A;  1KD1 4;  1FUT A;  4EYC A;  5RNT A;  1VQ8 3;  1VQ5 3;  1JNQ A;  1W2Z A;  4K1V A;  1GMR A;  3PZW A;  3G8Z A;  4HM3 B;  5AEU B;  3X3Y A;  1T2I A;  2B24 B;  2L4V A;  1VZZ A;  1VQK 3;  1WMO A;  3K63 A;  4HYZ A;  3BNB A;  4FCZ A;  3CCJ 3;  4H61 A;  1GYB A;  3D5I A;  1G02 A;  7RNT A;  1G96 A;  3LTC A;  1BUQ A;  2O3O A;  2LYX A;  3BIR A;  4GL6 A;  5CK6 A;  1YIT 3;  1KC8 4;  1JRQ A;  8RNT A;  1VQ6 3;  3X40 A;  5LC7 A;  3VGN A;  2LQV A;  1JZD A;  5BIR A;  3SOA A;  2E2T A;  2ZL8 A;  2W9P A;  5DRV A;  1BRI A;  1T5Y A;  1YIJ 3;  3EBY A;  4ZM8 A;  1ASK A;  2KXG A;  5G1L A;  4FMB A;  3EN1 B;  1IVW A;  4RBN A;  1RRL A;  4X2H A;  3FH1 A;  2R4I A;  2GU3 A;  4KVH A;  1BNS A;  3D4A A;  1W01 A;  2SBL A;  6GSP A;  1BSE A;  7GSP A;  1DE3 A;  3CCV 3;  1NWW A;  2ML6 A;  4HM8 B;  1DMQ A;  1SPU A;  3F7S A;  4HM7 B;  4LGQ A;  3SX1 A;  1N5P A;  2W9Q A;  6STD A;  3UL6 A;  1LXE A;  1B2M A;  3AMO B;  4CPK A;  2GBW B;  1RGG A;  1B2S A;  2PZV A;  4NRE A;  2STD A;  4BIR A;  5FW5 A;  1TU5 A;  1E3V A;  4LEH A;  4MJD A;  2BHM A;  3RGA A;  1YJ9 3;  4FCM A;  3DH2 A;  4NPB A;  5CLK A;  3WOE B;  1VQP 3;  3GWR A;  5M18 A;  1OHP A;  3N8B A;  1V58 A;  2HMJ B;  1DVD A;  4O8S A;  3U97 A;  4K90 B;  2JDI H;  3EN8 A;  1VQQ A;  1U8C B;  1WNH A;  4O2H A;  4XB5 A;  1IDP A;  2J8X B;  1BSC A;  1IV9 A;  1C7H A;  1AV4 A;  1I8V A;  1JB2 A;  1RGF A;  2IMJ A;  5IER A;  3I55 3;  3ZFZ A;  4MMZ B;  3NQY A;  3CXC 2;  1BAO A;  1DET A;  3ECF A;  3FG3 A;  2IYJ A;  3URP A;  2QEX 3;  4MMX B;  2V1L A;  4WYK B;  2Y74 A;  1IQX A;  3DGM A;  1TRP A;  3DGN A;  1BIR A;  2CIU A;  3HK4 A;  3PGB A;  1VQ9 3;  3SLU A;  1IT7 A;  1RGL A;  2BMO B;  1NB5 I;  1A2V A;  4WP5 A;  3X3Z A;  3LT8 A;  1W2B 2;  1RCK A;  1C54 A;  1RGH A;  2CHC A;  3LH4 A;  2C4B A;  3WOD G;  1QVF 2;  1JKG B;  3NBB A;  2ML5 A;  1A2P A;  1BGS A;  1STF I;  4X2O A;  2HML B;  2H0G A;  3MSO A;  3WOF B;  3DZL A;  1SIH A;  1UDI I;  3PXM A;  3PYJ A;  3TDG A;  1LOV A;  2Z77 A;  3GZY B;  1QAF A;  2XSH B;  4U13 A;  2ZHX B;  4LSO A;  3T0U A;  1RN4 A;  2CG0 A;  1LQM B;  3MG2 A;  1O7P B;  4STD A;  2WGQ A;  1IVU A;  1BSB A;  1QAK A;  1QJG A;  4R4K A;  1QVG 2;  1IT8 A;  1MWT A;  1O7G B;  2CH9 A;  3G16 A;  2CW9 A;  3RDE A;  3QRD A;  5HGR A;  1RCL A;  1VQ7 3;  2O9U X;  1I2E A;  3NHX A;  5BVB A;  1AR0 A;  1OUN A;  3K5T A;  4L8O A;  2W04 A;  3DGL A;  9RNT A;  1Q81 4;  1BNR A;  1TJD A;  3RNT A;  3D9R A;  3LZA A;  1CEW I;  5EQL A;  2YFI B;  1OPY A;  1RGC A;  3Q1C A;  1EKM A;  4BU4 A;  3F8H A;  1U5O A;  1HZ1 A;  1V74 A;  4HM5 B;  1GMQ A;  3Q90 A;  4XDV A;  3F8X A;  3D5G A;  4MMY B;  3G6E 3;  3MYT A;  3MHE A;  1EG9 B;  3B4O A;  1ULI B;  4EV2 A;  6RNT A;  4DKI A;  4BL2 A;  4O02 B;  1M1K 4;  1W02 A;  2H0H A;  3EC9 A;  2GEX A;  2CWT A;  3IPT A;  1STD A;  2Z7A A;  2WGO A;  2H0I A;  3K7C A;  2RGQ A;  4HM4 B;  1O7H B;  5IG5 A;  3LYG A;  1LOW A;  1ROV A;  1MGW A;  2FGT A;  3WMD A;  1JZO A;  1R4Y A;  1RKY A;  3FG1 A;  1W6C A;  4L8P A;  2F5W A;  4OK0 A;  3UL5 A;  3ER7 A;  1E3R A;  3WR2 A;  1Q42 A;  3BU4 A;  2Q07 A;  1UCL A;  4KT3 B;  2UGI A;  1GSP A;  5JPP A;  1FGR A;  1BSA A;  3Q3F A;  2OOV A;  1SQW A;  1VQO 3;  1TUH A;  3F14 A;  3ZG5 A;  2CX1 A;  2RNT A;  2XEP A;  3CC7 3;  3GZX B;  3X42 A;  1DVC A;  3F9S A;  5A0O B;  3J7Y d;  1BAN A;  4N6M A;  1DMM A;  2WOF A;  3PCS A;  2K3D A;  1Y4K A;  5KP4 A;  4KFD A;  2Z6B A;  4WHA A;  1NNV A;  2XGN A;  1LOY A;  3K9M C;  3KSP A;  5AEW B;  7STD A;  1ISK A;  1UCK A;  4K1U A;  1FGM A;  3NXJ A;  1E97 A;  1LNI A;  1OCV A;  1RHL A;  2BNG A;  1LQG C;  3JUO A;  2P09 A;  1TIJ A;  3BLZ A;  1NO3 A;  2RBI A;  4HZ9 B;  1AY7 A;  1GD3 A;  5IEO A;  3S27 A;  3X41 A;  3AGO A;  1YGW A;  3V92 A;  3O8Y A;  3UNL A;  1ULJ B;  2F4Y A;  1ZX2 A;  3NM7 A;  4EW5 A;  1W7C A;  1BOX A;  3G0K A;  3DGY A;  4HM6 B;  1K9M 4;  1PY3 A;  4O3V A;  2KCD A;  1GY6 A;  2INX A;  1WQL B;  3E99 A;  3Q2P A;  2F99 A;  2L1S A;  1JB5 A;  2UUG C;  1IV7 A;  1MGR A;  2CFG A;  4HAA A;  1N8R 4;  3FF2 A;  3KE7 A;  2HMN B;  1EA2 A;  3NBJ A;  4TX4 A;  1I0V A; 
#chains in the Genus database with same CATH homology
 1OF5 A;  1Q40 B;  1TFO A;  2RFR A;  4EC6 A;  5IG4 A;  3SVA A;  4HBR A;  4Q53 A;  1ROA A;  2F86 B;  1LVN A;  1NB3 I;  2RCD A;  3CNM A;  1JN5 B;  1YGE A;  2CC3 A;  3HIG A;  4N6T A;  1D6U A;  1NJI 4;  2XFT A;  1W6Y A;  2P05 A;  2XF3 A;  5ELJ A;  3B4P A;  3LOY A;  1Q86 4;  3H3H A;  2BMR B;  4JRF A;  3OWU A;  2W6J H;  2Z76 A;  3F7X A;  5IF6 A;  3LML A;  1UUV B;  3EF8 A;  3I56 3;  3S29 A;  1Q7Y 4;  3JUP A;  2W03 A;  3UJM A;  1QAL A;  5IG3 A;  3F40 A;  4L7K A;  5D82 A;  4JF8 A;  1JV2 B;  3DXO A;  3GZR A;  4KFE A;  1O7N B;  4AKZ A;  2W56 B;  2B1X B;  3PS8 A;  3SED A;  1MNL A;  1S5A A;  3EE1 A;  1SJW A;  1UW1 A;  3D3L A;  5AII A;  1AVL A;  1JJ2 2;  3LTB A;  3CMA 3;  1L5G B;  4XBY A;  3S5C A;  1FGO A;  2CWU A;  1W4N A;  2OOV C;  2CFW A;  3AMO A;  3CCR 3;  1IVV A;  1N8Q A;  3KII A;  3NV0 B;  2HMM B;  2ZDJ A;  3CD6 3;  1JB4 A;  3OX9 A;  4EV5 A;  1EQK A;  3LTA A;  1ZO2 A;  4R1K A;  1GS3 A;  1UI8 A;  3FLJ A;  4H3U A;  5IW9 A;  3K0Z A;  4R9L A;  3CU3 A;  2HMK B;  1D6Y A;  4IT7 A;  2K0M A;  1A90 A;  2M7O A;  1Q82 4;  3H51 A;  1VQM 3;  4CCV A;  4WYK A;  3QK9 A;  1PFP A;  5TGN A;  3OXA A;  1O7M B;  4N6U A;  3EHC A;  3SXX A;  4KFF A;  5KP1 A;  1KQS 2;  4J9A A;  3CME 3;  3KFQ C;  1JKG A;  2HMO B;  5AIG A;  3KN4 A;  2E2V A;  2CWV A;  3BND A;  3VF1 A;  2CFK A;  3M8C A;  3STD A;  5AI1 A;  2GU1 A;  2Y73 A;  4BTW A;  1QMA A;  3JUQ A;  1YJW 3;  3V99 A;  1RRH A;  1OH0 A;  2W0Q A;  4AEQ A;  1UUW B;  2YX9 A;  3G71 3;  3OWY A;  2MF7 A;  3EJV A;  4J8T A;  1OAC A;  3EB8 A;  5DRE A;  5FGO A;  3FZW A;  3L0R A;  1NDO B;  1FUW A;  4I4K A;  3CNX A;  1GD4 A;  3OV4 A;  3FGY A;  5CXO A;  3N54 B;  4LZI A;  4FR9 A;  3V98 A;  4BTX A;  5IEP A;  3MWZ A;  4EXR A;  5KP3 A;  3FG4 A;  4XDW A;  3S67 A;  1K41 A;  4R80 A;  3HX8 A;  4OVM A;  4EBG A;  5AIF A;  4XBT A;  1FGQ A;  3LXU X;  1CYV A;  1NU3 A;  3ROB A;  5G2G A;  3GRD A;  3HII A;  2XGL A;  4BTY A;  1UI7 A;  4XM4 A;  4FMA A;  4R9K A;  2CKF B;  4LMI A;  1TP6 A;  1AVK A;  1W6G A;  2K54 A;  4HZB B;  1D6Z A;  5EVH A;  3LT9 A;  1N5H A;  3JVC A;  2D1W A;  4FMD A;  3X3X A;  2E2U A;  2W2C A;  4CDL A;  3BB9 A;  4RNY A;  1O7W B;  2GBX B;  2UX0 A;  3BNE A;  4K61 A;  4KZ1 A;  5CF2 A;  3B8L A;  3NM2 A;  3DY5 A;  1Z1S A;  3KSE D;  3PCR A;  1VQ4 3;  2QGU A;  4HKV B;  2CFD A;  1FGT A;  2CK3 H;  4RZM A;  2GXF A;  4PEJ A;  3FKA A;  2YFL B;  1MOL A;  3S28 A;  3NUV A;  2A15 A;  2BMQ B;  1OGZ A;  4XBX A;  3T8N A;  3WA2 X;  1KWI A;  3MPH A;  1SII A;  1YVB I;  1M1X B;  2IUK A;  4IPB A;  1K28 A;  1YHQ 3;  1W5Z A;  2BO9 B;  3JUM A;  2IA7 A;  2F98 A;  1IU7 A;  3HI7 A;  4MEI A;  4IIA A;  5AIH A;  4HM0 B;  4N3V A;  5D81 A;  3DUK A;  3VSY A;  3NBR A;  2I9W A;  1W00 A;  1K73 4;  1M90 4;  4OUQ A;  2GEY A;  3EQQ B;  3CCU 3;  1VQN 3;  1LNH A;  2RSX A;  2XRX B;  2XSO B;  3FSD A;  4N6L A;  3MG3 A;  4N6O B;  4RNZ A;  5EEO A;  1R4C A;  2CFL A;  2QIY A;  5D83 A;  5JPU A;  1WMN A;  3OWS A;  5CF1 A;  3ALA A;  3G4S 3;  1IK3 A;  2FXT A;  3GAX A;  1CYU A;  4FMC A;  2QA4 3;  2BT3 A;  3CPO A;  4GB5 A;  2CG1 A;  2YFJ B;  1YJN 3;  1Q40 A;  1M9G A;  3CCS 3;  1N9J A;  1FA3 A;  4HJL B;  3EX9 A;  4WFO A;  5IEN A;  5IG0 A;  3KZT A;  3N9H A;  1DMN A;  2KRT A;  1A67 A;  2XH9 A;  2XR8 B;  4NHF A;  8CHO A;  1JN5 A;  4N6V 0;  1N9E A;  3MKI A;  4HM1 B;  3RGR A;  3CCQ 3;  2MC8 A;  2OWP A;  1J2B A;  4QWT A;  4WWU C;  2OQE C;  5JBS A;  5BXQ A;  1IVX A;  2FNQ A;  4HVN A;  1K8A 4;  1A2K A;  1RN7 A;  2OTJ 3;  3OW2 2;  3IMA B;  3FF0 A;  1F8N A;  3UB1 A;  5I97 A;  1VQL 3;  1DYU A;  5ELU A;  3CPW 2;  2P38 A;  1OHS A;  3FCS B;  1LOX A;  1CQS A;  3T8U A;  1RJO A;  3CCE 3;  3DGO A;  1WMP A;  3I0Y A;  5STD A;  3IJE B;  4FCJ A;  3A76 A;  1OHO A;  3HZP A;  1HU9 A;  1WTH A;  2W56 A;  5LC6 A;  2PNC A;  3U1W A;  1OGX A;  2C11 A;  3GZB A;  3LTD A;  3CCM 3;  3SOY A;  1HKX A;  3NQZ A;  3B7C A;  3WA3 A;  1PU4 A;  2OTL 3;  1IQY A;  3CCL 3;  1IQ8 A;  4HM2 B;  3MG1 A;  2P0M A;  2OCT A;  3BNC A;  3EBT A;  3CC4 3;  5AYS C;  1GY5 A;  3DM8 A;  3NV0 A;  2JQ5 A;  1US1 A;  2P0X A;  4G1M B;  4ORL A;  3DMC A;  1KSI A;  2WO0 A;  1YI2 3;  3WDG B;  1OF5 B;  3CC2 3;  2WOH A;  2XFS A;  3NX0 A;  4AKY A;  3KKG A;  2D42 A;  2OQE A;  1S72 3;  2C10 A;  4N6N B;  1GY7 A;  5AYR B;  3JUN A;  1TFK A;  2IUJ A;  1KD1 4;  4EYC A;  1VQ8 3;  1VQ5 3;  1JNQ A;  1W2Z A;  4K1V A;  3PZW A;  3G8Z A;  4HM3 B;  5AEU B;  3X3Y A;  2B24 B;  2L4V A;  1VZZ A;  1VQK 3;  1WMO A;  3K63 A;  4HYZ A;  3BNB A;  4FCZ A;  3CCJ 3;  4H61 A;  1GYB A;  1G96 A;  3LTC A;  1BUQ A;  2O3O A;  2LYX A;  5CK6 A;  4GL6 A;  1KC8 4;  1YIT 3;  1JRQ A;  1VQ6 3;  3X40 A;  5LC7 A;  3VGN A;  2LQV A;  3SOA A;  2E2T A;  2ZL8 A;  2W9P A;  5DRV A;  1T5Y A;  1YIJ 3;  3EBY A;  4ZM8 A;  1ASK A;  2KXG A;  4FMB A;  3EN1 B;  1IVW A;  4RBN A;  1RRL A;  4X2H A;  3FH1 A;  2R4I A;  2GU3 A;  4KVH A;  1W01 A;  2SBL A;  3CCV 3;  1NWW A;  2ML6 A;  4HM8 B;  1DMQ A;  1SPU A;  3F7S A;  4HM7 B;  4LGQ A;  3SX1 A;  1N5P A;  2W9Q A;  6STD A;  3UL6 A;  1LXE A;  3AMO B;  2GBW B;  2PZV A;  4NRE A;  2STD A;  5FW5 A;  1TU5 A;  1E3V A;  4LEH A;  4MJD A;  2BHM A;  3RGA A;  1YJ9 3;  4FCM A;  5CLK A;  3WOE B;  1VQP 3;  3GWR A;  1OHP A;  3N8B A;  2HMJ B;  1DVD A;  4O8S A;  3U97 A;  4K90 B;  2JDI H;  3EN8 A;  1U8C B;  1WNH A;  4O2H A;  4XB5 A;  1IDP A;  1C7H A;  1IV9 A;  1AV4 A;  1JB2 A;  2IMJ A;  5IER A;  3I55 3;  3CXC 2;  4MMZ B;  3NQY A;  3ECF A;  3FG3 A;  2QEX 3;  4MMX B;  2V1L A;  4WYK B;  2Y74 A;  1IQX A;  3DGM A;  3DGN A;  3HK4 A;  2CIU A;  3PGB A;  1VQ9 3;  3SLU A;  1IT7 A;  2BMO B;  1NB5 I;  1A2V A;  4WP5 A;  3X3Z A;  3LT8 A;  1W2B 2;  3LH4 A;  2CHC A;  1QVF 2;  3WOD G;  1JKG B;  3NBB A;  2ML5 A;  4X2O A;  1STF I;  2HML B;  3MSO A;  3WOF B;  3DZL A;  1SIH A;  3PXM A;  3PYJ A;  3TDG A;  3GZY B;  2Z77 A;  1QAF A;  2XSH B;  4U13 A;  4LSO A;  3T0U A;  2CG0 A;  3MG2 A;  1O7P B;  4STD A;  2WGQ A;  1IVU A;  1QAK A;  1QJG A;  4R4K A;  1QVG 2;  1IT8 A;  1O7G B;  2CH9 A;  3G16 A;  2CW9 A;  3RDE A;  3QRD A;  5HGR A;  1VQ7 3;  2O9U X;  5BVB A;  3NHX A;  1Q81 4;  1AR0 A;  1OUN A;  3K5T A;  4L8O A;  2W04 A;  3DGL A;  3D9R A;  3LZA A;  1CEW I;  5EQL A;  2YFI B;  1OPY A;  3Q1C A;  1EKM A;  3F8H A;  1U5O A;  1V74 A;  4HM5 B;  3Q90 A;  4XDV A;  3F8X A;  4MMY B;  3G6E 3;  3MYT A;  3MHE A;  1EG9 B;  3B4O A;  1ULI B;  4EV2 A;  1M1K 4;  4O02 B;  1W02 A;  3EC9 A;  2GEX A;  2CWT A;  3IPT A;  1STD A;  2Z7A A;  2WGO A;  3K7C A;  4HM4 B;  2RGQ A;  1O7H B;  5IG5 A;  3LYG A;  3WMD A;  1ROV A;  2FGT A;  1RKY A;  3FG1 A;  1W6C A;  4L8P A;  4OK0 A;  3UL5 A;  3ER7 A;  1E3R A;  1Q42 A;  2Q07 A;  5JPP A;  1FGR A;  2OOV A;  1SQW A;  1VQO 3;  1TUH A;  3F14 A;  2XEP A;  3CC7 3;  3GZX B;  3X42 A;  1DVC A;  3F9S A;  5A0O B;  3J7Y d;  4N6M A;  1DMM A;  2WOF A;  3PCS A;  5KP4 A;  1Y4K A;  4KFD A;  2Z6B A;  4WHA A;  2XGN A;  3K9M C;  3KSP A;  7STD A;  5AEW B;  1ISK A;  4K1U A;  1FGM A;  3NXJ A;  1E97 A;  1OCV A;  2BNG A;  3JUO A;  2P09 A;  1TIJ A;  3BLZ A;  1NO3 A;  4HZ9 B;  3S27 A;  1GD3 A;  3X41 A;  5IEO A;  3V92 A;  3O8Y A;  3UNL A;  1ULJ B;  1ZX2 A;  3NM7 A;  1W7C A;  3G0K A;  1K9M 4;  4HM6 B;  4O3V A;  2KCD A;  1GY6 A;  2INX A;  1WQL B;  3E99 A;  3Q2P A;  2F99 A;  1JB5 A;  1N8R 4;  1IV7 A;  2CFG A;  3FF2 A;  3KE7 A;  2HMN B;  1EA2 A;  3NBJ A;  4TX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...