5ELJA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
ENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAKVWVKGLTNWKLGMNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-Affirmer-S2D5
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
total genus 17
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eljA00
5LC7A 4N6OB 2CH9A 1CEWI 1LXEA 5ELJA 5A0OB 4CCVA 4IT7A 3L0RA 1G96A 1NB5I 2BO9B 2O9UX 1RN7A 5LC6A 1N9JA 3GAXA 1N5PA 1N5HA 3NX0A 4TX4A 4N6LA 1A90A 1IV7A 3QRDA 3UL6A 1DVCA 3LH4A 5ELUA 2OCTA 1EQKA 1NB3I 3K9MC 3KSED 3KFQC 4N6UA 1MOLA 4N6NB 1DVDA 1STFI 3S67A 3MWZA 4LZIA 1IV9A 4N6MA 4EYCA 3PXMA 1PFPA 4N6TA 1FUWA 1WNHA 1A67A 1YVBI 1FA3A 1TIJA 4ZM8A 1MNLA 1M9GA 2W9QA 3IMAB 1R4CA 3PS8A 1GD4A 3UL5A 1GD3A 3SVAA 3Q2PA 2W9PA 1CYVA 1KWIA 3PYJA 5EQLA 4N6V0 1CYUA 1ROAA 2KXGA
chains in the Genus database with same CATH superfamily
4K90B 5AIHA 2XR8B 3BLZA 2IYJA 5AEUB 2CG1A 1CEWI 4MMYB 1LXEA 1VQP3 3X3XA 4NHFA 4RBNA 2XSHB 4FMBA 3L0RA 3DGOA 2UGIA 2WO0A 2ZA4A 3K7CA 2BO9B 3KCHA 1BSDA 1RN7A 1W01A 4HYZA 3ROBA 1NB5I 1SARA 4J5KA 2AAEA 2XEPA 3GAXA 1TP6A 4U13A 1N5PA 2XH9A 1N5HA 2D1WA 3FKAA 3MHEA 4N6LA 4R9KA 1WMOA 5M18A 2KAAA 9RNTA 1O7NB 1E3RA 2K3DA 3CNMA 3M8CA 8RNTA 1A90A 1FGMA 2CWVA 1CQSA 5G1KA 1LVNA 1B20A 1RN4A 1SIHA 1W2ZA 2C10A 2WOHA 1RGKA 2GXFA 3MG3A 1B2MA 1F8NA 4K1UA 1BRIA 3CCM3 2QGUA 3FLJA 4HM1B 5HGRA 1CH0A 1UUVB 1JB5A 1GOUA 1EQKA 3B7CA 1IU7A 2KF3A 1BUQA 3K9MC 4BU4A 1U8CB 3SOAA 5IEOA 5JBSA 1VQK3 3KSED 1I2GA 1OHPA 3E99A 3LTBA 1JN5B 4L8PA 3SOYA 8CHOA 1BUJA 3N54B 1K28A 1UGIA 4KVHA 1T2HA 1BVIA 3HIGA 3CME3 1RN1A 2YFIB 5JPPA 7RNTA 3MG2A 4GL6A 3WA3A 1ULJB 2XGLA 3BIRA 5CK6A 1B2XA 3NHXA 1UCIA 3WMDA 1ROVA 5EVHA 3OXAA 3X40A 3PCSA 4G1MB 1LOWA 4MEIA 1VQ63 1QJGA 3OX9A 3GZRA 3S27A 4R4KA 3CXC2 2XRXB 3EQQB 3NQYA 1BSBA 2F5WA 4WP5A 4WFOA 5AIIA 5IERA 3LTCA 3A5EA 2XF3A 3MWZA 1NDOB 1AR0A 3FF2A 1WQLB 3GRDA 3X42A 1SPUA 1AQZA 2C4BA 4EYCA 2O3OA 3SLUA 1JKGB 4HKVB 1TFKA 3X3YA 1X1XA 2HMNB 4BIRA 1GOVA 1OUNA 3LYGA 5IG4A 1V74A 3QK9A 3NV0B 2IUJA 1TU5A 3H51A 1FUWA 2MC8A 1S723 1GY5A 1K9M4 1DMQA 1BGSA 2F56A 1IVWA 1R4YA 4HM2B 5EEOA 1KC84 1JBTA 1QVF2 2KCDA 1MGRA 3LT8A 3CCE3 1GSPA 5D83A 3DGLA 2QA43 1I70A 1BANA 3LT9A 3STDA 1BNEA 1UCLA 1M9GA 2F86B 1IQ8A 2CWUA 4AEQA 3IMAB 1AV4A 2CFWA 2IY2A 3ALAA 3RGAA 1W2B2 1K8A4 3LZAA 1FUTA 1RCKA 3SX1A 3SVAA 2CKFB 2HMLB 1VQ53 2OOVC 1I8VA 4HBRA 2UUGC 2XSOB 3NUVA 3H3HA 1JBRA 3WHOA 5CF1A 2AADA 3V98A 5IG3A 2F5MA 4GB5A 1BNFA 1W00A 3GSPA 4N6V0 1AY7A 4FR9A 3WR2A 4R9LA 3B4OA 4HM5B 1W02A 3CCS3 5FGOA 1I0XA 2HMKB 3AHWA 3OWYA 2H0HA 1Q7Y4 3JUNA 1YVSA 3N9HA 3ZG5A 2LQVA 4O8SA 3ER7A 4RNTA 1UI7A 1NU3A 3O8YA 3D79A 1EA2A 5ELJA 5A0OB 3AGOA 2W03A 1RLSA 1G96A 1VQ93 3A76A 1G0TA 1MWSA 3PGBA 1LRAA 4ORLA 4XM4A 1A2PA 5AI1A 1L5GB 4KFDA 3CC23 1ULIB 1S5AA 3F40A 4LMIA 1JZOA 4PEJA 1N8QA 1G02A 4HM3B 1ZS7A 3OV4A 3NX0A 4JRFA 1A2VA 4QWTA 4WYKA 1BNSA 3TDGA 1YJN3 1YGEA 3T8UA 1O7MB 3S29A 3N8BA 1RCLA 3JUMA 1JZDA 3SXXA 1Z1SA 2Y74A 1FGRA 1PY3A 1RNBA 2JQ5A 1OACA 1QVG2 1RHLA 2RGQA 2GBXB 1VQ83 3U97A 5IF6A 1W5ZA 3CNXA 3CCV3 5GSPA 2GEXA 4RZMA 5IW9A 3S28A 3HX8A 3I0YA 5RNTA 1FGTA 1RSNA 4FCZA 2UX0A 1BRHA 3VSYA 2GU3A 2WOFA 1I0VA 4AKYA 2CIUA 2CW9A 3NM7A 1Q864 3RGRA 2C11A 3SYUA 3KFQC 2GSPA 3KZTA 2CWTA 4OK0A 2FXTA 2P38A 4N6UA 3K63A 1DYUA 3CCR3 2H0GA 4N6NB 3HIIA 2CFLA 1IQYA 3LXUX 1RGAA 3GWRA 2H0IA 1JB4A 1KD14 2P0MA 4MMXB 3D5GA 3EC9A 3EE1A 4RNYA 4J9AA 4L7KA 1ASKA 3G713 4K61A 1W6YA 5IG0A 3NM2A 5HOHA 1LNIA 1RRLA 3U1WA 1IV9A 3NBRA 1BIRA 2Z76A 2OWPA 4BTYA 2GEYA 1UUGB 2F98A 3F9SA 7STDA 1QAKA 3JUOA 3UJMA 3DZLA 4LGQA 1U5OA 1Q824 1HZ1A 1BSCA 3X3ZA 1FYSA 1T3BA 1YGWA 4HVNA 3D5IA 3EN1B 1WNHA 1RGLA 3JUQA 1A67A 1ZO2A 1FZUA 2BMOB 2IUKA 5IG5A 4Q53A 4ZM8A 1Q40B 1B2UA 1VQO3 3FF0A 1BRGA 1IDPA 4CDLA 3G6E3 2FGTA 1NWWA 1I2FA 1LOVA 4WWUC 3LMLA 3HOHA 3J7Yd 3PS8A 1SQWA 2LYXA 1IVUA 4I5QA 2SARA 4FMCA 3GZYB 4GHOA 2W9PA 3OWSA 1GYBA 2E2UA 2J8XB 1CYVA 4EV5A 1KWIA 3LTAA 1FW7A 4LEHA 5M19A 2F99A 1IVXA 1VZZA 3BNEA 1VQ73 4X2HA 3DGYA 4DKIA 2L1SA 1ROAA 3AGNA 3VGNA 2KRTA 2OQEA 1TFOA 5KP4A 3B8LA 4J8TA 1BOXA 4N6OB 5LC7A 1OCVA 2PZVA 4AKZA 1UW1A 4HM6B 1TRQA 1D6ZA 3CD63 1OPYA 1KSIA 4IT7A 4WYKB 2RCDA 1DE3A 3OW22 1UI8A 3MKIA 2CFDA 3ECFA 1GY7A 1K734 1Q40A 1LQMB 1N9JA 3PCRA 5BIRA 4FMAA 6STDA 1AVLA 2QEX3 5I97A 4EW5A 1RNTA 4MJDA 4TX4A 1MWUA 4JF8A 3KIIA 3CCU3 5BU4A 1J2BA 1K41A 2ZHXB 3JUPA 1EG9B 2XGNA 2YX9A 1RGGA 1QALA 2JDIH 3IJEB 1O7PB 3MPHA 4XDVA 1STDA 1W7CA 3V99A 1NO3A 3WA2X 5CF2A 3EBYA 1WMPA 4LSOA 2RBIA 2P09A 5FW5A 1B3SA 1RGCA 1EEJA 1TTOA 1EUIC 1GMRA 3F7XA 5AEWB 3F14A 1FGQA 2CX1A 1X1UA 3FG1A 2F4YA 4KZ1A 3UL6A 5IENA 2BIRA 1Q42A 2XFTA 1NB3I 1HKXA 3URPA 1YHQ3 3D4AA 3WOEB 1RDSA 2W2CA 2YFJB 4FCJA 2ZDJA 4HZ9B 1D6UA 5TGNA 1E3VA 4EBGA 3LOYA 3F8HA 3HZPA 1MOLA 1LNHA 1O7HB 4N3VA 4O2HA 1RRHA 4XDWA 3DGMA 1B2SA 2WGQA 1GS3A 3EN8A 3HI7A 1IT7A 2FNQA 5BXQA 1UDII 3UB1A 3GZBA 1VQ43 2V1LA 7GSPA 1PYLA 3CC43 1Y4KA 1YIT3 1LQGC 1UCKA 5M1AA 2OTJ3 3CCL3 4I4KA 2I9WA 4OVMA 3CPW2 1US1A 1JJ22 1BNRA 1VQL3 3MYTA 5CLKA 1DVDA 1HYFA 4HM8B 1JV2B 5CXOA 1SJWA 1STFI 2R41A 3S67A 1YI23 3Q1CA 1BNIA 1WTHA 3FGYA 4H61A 3IPTA 1I2EA 3B4PA 3JVCA 3KKGA 4LZIA 4N6MA 4CJNA 2OTL3 4ILFA 4O02B 3G8ZA 2KF6A 3VF1A 5AYRB 2D42A 3NBBA 3S5CA 1Q7HA 3F8XA 1C54A 1BRKA 1YNVX 1QAFA 1RGEA 3PZWA 3T8NA 5D81A 1WMNA 1YVBI 1HU9A 1TIJA 3WOFB 2W04A 4EXRA 4CPKA 3DH2A 1BU4A 1I3FA 2SBLA 2HMOB 2Z6BA 4STDA 1KQS2 3EX9A 1NJI4 1MNLA 1MWRA 4NREA 3ZG0A 1FGOA 2KF5A 2STDA 3BNDA 6GSPA 3EB8A 1R4CA 1V58A 3FG3A 2BHMA 1GD4A 1W6CA 3NQZA 4RNZA 3DGNA 4IPBA 1LOXA 1VQM3 1V57A 2E2TA 1DMNA 1OGXA 3CCQ3 1B2ZA 5EQLA 3EF8A 2RNTA 2HMJB 1DMMA 1RJOA 2PNCA 5D82A 2Q07A 1RGHA 4R80A 4KT3B 5BVBA 1CYUA 2XFSA 1NNVA 2R4IA 1BNGA 2IMJA 3WODG 6RNTA 3AMOA 2OOVA 5KP1A 5AIGA 1GOYA 2CH9A 2ZL8A 3LTDA 4KFEA 4O3VA 5DRVA 1BNJA 1IQXA 1N9EA 3HK4A 4HAAA 3DXOA 2BMQB 2B1XB 3GZXB 2GBWB 2K54A 3FCSB 4GSPA 4HM0B 3DM8A 4CCVA 4XB5A 2HOHA 3OWUA 1OH0A 4MMZB 1RTUA 2O9UX 5LC6A 3I563 2Z7AA 5AYSC 1BRNL 3NXJA 5IEPA 1X1YA 3MG1A 2E2VA 3K0ZA 1M904 1E97A 3G0KA 1JB2A 1RMSA 1VQQA 2P0XA 1YIJ3 3BNBA 1ZGXA 1OGZA 3BB9A 1BAOA 1MGWA 1Q9EA 4NPBA 5AIFA 3KE7A 1YJ93 1C7HA 2Z77A 4X2OA 2M7OA 1FUSA 1IV7A 2INXA 3CU3A 1JBSA 2CFGA 4K1VA 1W4NA 2W56B 1JRQA 2WGOA 4HM4B 2BNGA 1RKYA 2BU4A 1O7GB 1LOYA 1N8R4 2CHCA 3AHSA 3QRDA 4WHAA 1DVCA 2HMMB 4L8OA 3RNTA 3LH4A 4LYLB 2OCTA 5ELUA 3I553 2CC3A 2KF4A 4H3UA 1BSEA 3K5TA 3EJVA 3KN4A 2Y73A 1TJDA 2L4VA 2YFLB 1OF5B 1B27A 3SEDA 1OHOA 3ZFZA 2BMRB 2QIYA 5KP3A 4FCMA 3G16A 2MF7A 3F7SA 4XBYA 1EKMA 3CPOA 1B21A 2CG0A 4KFFA 5DREA 1JNQA 1YJW3 1X1WA 1OHSA 1JN5A 1M1XB 1W6GA 3EHCA 1T5YA 3KSPA 1QMAA 2CK3H 3FZWA 1GMQA 2RSXA 4J5GA 1PU4A 3V92A 2RFRA 5JPUA 2A15A 2BT3A 1AVKA 1IYYA 1A2KA 3FH1A 1BRSA 3DY5A 4XBXA 3D3LA 4IIAA 3RDEA 1TUHA 3X41A 2IA7A 4BL2A 4XBTA 1D6YA 3PXMA 3Q3FA 1BRJA 1PFPA 2W56A 3DMCA 2ML5A 1BSAA 1UGHI 4N6TA 3Q90A 1UUWB 4HJLB 2B24B 5G2GA 2K0MA 3UNLA 2CFKA 3CCJ3 4OUQA 2P05A 3WDGB 5G1LA 1FA3A 1JKGA 3NBJA 1RGFA 3T0UA 4BL3A 4EV2A 1Q814 3NV0A 1IVVA 1DETA 3G4S3 3CC73 1VQN3 1IK3A 1O7WB 2W6JH 1UCJA 1OF5A 2W9QA 1IT8A 5STDA 4BTXA 2ML6A 3BNCA 1GD3A 1GMPA 3FSDA 3UL5A 2OQEC 3Q2PA 4HZBB 2GU1A 4FMDA 3BU4A 1SIIA 4HOHA 1T2IA 3AMOB 3CMA3 3PYJA 1MWTA 3EBTA 4BTWA 1TRPA 3D9RA 1ZX2A 4R1KA 3MSOA 3DUKA 1GY6A 1ISKA 3FG4A 4HM7B 4EC6A 2KXGA 1M1K4 2W0QA 2CX0A 1I3IA
chains in the Genus database with same CATH topology
4K90B 5AIHA 2XR8B 3BLZA 5AEUB 2CG1A 1CEWI 4MMYB 1LXEA 1VQP3 3X3XA 4NHFA 4RBNA 2XSHB 4FMBA 3L0RA 3DGOA 3K7CA 2WO0A 4HYZA 2BO9B 1NB5I 1RN7A 3ROBA 1W01A 2XEPA 3GAXA 4U13A 1TP6A 1N5PA 2XH9A 1N5HA 2D1WA 3FKAA 3MHEA 4N6LA 4R9KA 1WMOA 1O7NB 1E3RA 3CNMA 3M8CA 1A90A 1FGMA 2CWVA 1CQSA 1LVNA 1W2ZA 3MG3A 1SIHA 2C10A 2WOHA 2GXFA 1F8NA 4K1UA 3CCM3 2QGUA 3FLJA 4HM1B 5HGRA 1UUVB 1JB5A 1EQKA 3B7CA 1IU7A 1BUQA 3K9MC 1U8CB 3SOAA 5IEOA 5JBSA 1VQK3 3KSED 1OHPA 3E99A 3LTBA 1JN5B 4L8PA 3SOYA 8CHOA 3N54B 1K28A 4KVHA 3HIGA 3CME3 2YFIB 5JPPA 3MG2A 4GL6A 3WA3A 1ULJB 2XGLA 5CK6A 3NHXA 3WMDA 1ROVA 5EVHA 3OXAA 3X40A 3PCSA 4G1MB 4MEIA 1VQ63 1QJGA 3OX9A 3GZRA 3S27A 4R4KA 3CXC2 2XRXB 3EQQB 3NQYA 4WFOA 4WP5A 5AIIA 5IERA 3LTCA 2XF3A 3MWZA 1NDOB 1AR0A 3FF2A 1WQLB 3GRDA 3X42A 1SPUA 4EYCA 2O3OA 3SLUA 1JKGB 4HKVB 1TFKA 3X3YA 2HMNB 1OUNA 3LYGA 5IG4A 1V74A 3QK9A 3NV0B 2IUJA 1TU5A 3H51A 1FUWA 2MC8A 1S723 1GY5A 1K9M4 1DMQA 1IVWA 4HM2B 5EEOA 1KC84 1QVF2 2KCDA 3LT8A 3CCE3 5D83A 3DGLA 2QA43 3LT9A 3STDA 1M9GA 2F86B 1IQ8A 2CWUA 4AEQA 3IMAB 1AV4A 2CFWA 3ALAA 1W2B2 3RGAA 1K8A4 3LZAA 3SX1A 3SVAA 2CKFB 2HMLB 1VQ53 2OOVC 4HBRA 2XSOB 3NUVA 3H3HA 5CF1A 3V98A 5IG3A 4GB5A 1W00A 4N6V0 4FR9A 4R9LA 3B4OA 4HM5B 1W02A 3CCS3 5FGOA 2HMKB 3OWYA 1Q7Y4 3JUNA 3N9HA 2LQVA 4O8SA 3ER7A 1UI7A 1NU3A 3O8YA 1EA2A 5ELJA 5A0OB 2W03A 1VQ93 1G96A 3A76A 3PGBA 4ORLA 4XM4A 5AI1A 1L5GB 4KFDA 3CC23 1ULIB 1S5AA 3F40A 4LMIA 4PEJA 1N8QA 4QWTA 4HM3B 4JRFA 3OV4A 3NX0A 4WYKA 1A2VA 3TDGA 1YJN3 1YGEA 3T8UA 1O7MB 3S29A 3N8BA 3JUMA 3SXXA 1Z1SA 2Y74A 1FGRA 2JQ5A 1OACA 1QVG2 2RGQA 2GBXB 1VQ83 3U97A 5IF6A 1W5ZA 3CNXA 3CCV3 2GEXA 4RZMA 5IW9A 3S28A 3HX8A 3I0YA 1FGTA 4FCZA 2UX0A 3VSYA 2GU3A 2WOFA 4AKYA 2CIUA 2CW9A 3NM7A 1Q864 3RGRA 2C11A 3KFQC 3KZTA 2CWTA 4OK0A 2FXTA 2P38A 4N6UA 3K63A 1DYUA 3CCR3 4N6NB 3HIIA 2CFLA 1IQYA 3LXUX 3GWRA 1JB4A 1KD14 2P0MA 4MMXB 3EC9A 3EE1A 4RNYA 4J9AA 4L7KA 1ASKA 3G713 4K61A 1W6YA 5IG0A 3NM2A 1RRLA 3U1WA 1IV9A 3NBRA 2Z76A 2OWPA 4BTYA 2GEYA 3F9SA 2F98A 7STDA 1QAKA 3JUOA 3UJMA 3DZLA 4LGQA 1U5OA 1Q824 3X3ZA 4HVNA 3EN1B 1WNHA 3JUQA 1A67A 1ZO2A 2BMOB 2IUKA 5IG5A 4Q53A 4ZM8A 1Q40B 1VQO3 3FF0A 1IDPA 4CDLA 3G6E3 2FGTA 1NWWA 4WWUC 3LMLA 3J7Yd 3PS8A 1SQWA 2LYXA 1IVUA 4FMCA 3GZYB 2W9PA 3OWSA 1GYBA 2E2UA 1CYVA 4EV5A 1KWIA 3LTAA 4LEHA 2F99A 1IVXA 1VZZA 3BNEA 1VQ73 4X2HA 1ROAA 3VGNA 2KRTA 2OQEA 1TFOA 5KP4A 3B8LA 4J8TA 5LC7A 4N6OB 1OCVA 2PZVA 4AKZA 1UW1A 4HM6B 1D6ZA 3CD63 1OPYA 1KSIA 4IT7A 4WYKB 2RCDA 3OW22 1UI8A 3MKIA 2CFDA 3ECFA 1GY7A 1K734 1Q40A 3PCRA 1N9JA 4FMAA 6STDA 1AVLA 2QEX3 5I97A 4MJDA 4TX4A 4JF8A 3KIIA 3CCU3 1J2BA 1K41A 3JUPA 1EG9B 2XGNA 2YX9A 2JDIH 1QALA 3IJEB 3MPHA 1O7PB 4XDVA 1YHQ3 1STDA 1W7CA 3V99A 1NO3A 3WA2X 5CF2A 3EBYA 1WMPA 4LSOA 2P09A 5FW5A 3F7XA 5AEWB 3F14A 1FGQA 3FG1A 4KZ1A 3UL6A 5IENA 1Q42A 1NB3I 1HKXA 3WOEB 2W2CA 2YFJB 4FCJA 2ZDJA 4HZ9B 1D6UA 5TGNA 1E3VA 4EBGA 3LOYA 3F8HA 3HZPA 1MOLA 1LNHA 1O7HB 4N3VA 4O2HA 1RRHA 4XDWA 3DGMA 2WGQA 1GS3A 3EN8A 3HI7A 1IT7A 2FNQA 5BXQA 3UB1A 3GZBA 1VQ43 2V1LA 3CC43 1Y4KA 1YIT3 2OTJ3 3CCL3 4I4KA 2I9WA 4OVMA 3CPW2 1US1A 1JJ22 1VQL3 3MYTA 5CLKA 1DVDA 4HM8B 1JV2B 5CXOA 1SJWA 1STFI 3S67A 1YI23 3Q1CA 4H61A 1WTHA 3FGYA 4LZIA 3IPTA 3B4PA 3JVCA 4N6MA 3KKGA 2OTL3 4O02B 3G8ZA 3VF1A 5AYRB 2D42A 3NBBA 3S5CA 3F8XA 1QAFA 3PZWA 3T8NA 5D81A 1WMNA 1YVBI 1HU9A 1TIJA 3WOFB 2W04A 4EXRA 1KQS2 2SBLA 2HMOB 2Z6BA 4STDA 3EX9A 1NJI4 1MNLA 4NREA 1FGOA 2STDA 3BNDA 3EB8A 1R4CA 3FG3A 2BHMA 1GD4A 1W6CA 3NQZA 4RNZA 3DGNA 4IPBA 1LOXA 1VQM3 2E2TA 1DMNA 1OGXA 3CCQ3 5EQLA 3EF8A 2HMJB 1DMMA 1RJOA 2PNCA 5D82A 2Q07A 5BVBA 4R80A 1CYUA 2XFSA 2R4IA 2IMJA 3WODG 3AMOA 2OOVA 5KP1A 5AIGA 2CH9A 3LTDA 2ZL8A 4KFEA 4O3VA 5DRVA 1N9EA 1IQXA 3HK4A 3DXOA 2BMQB 2B1XB 3GZXB 2GBWB 2K54A 3FCSB 4HM0B 4CCVA 3DM8A 4XB5A 3OWUA 4MMZB 1OH0A 2O9UX 5LC6A 3I563 2Z7AA 5AYSC 3NXJA 5IEPA 3MG1A 2E2VA 3K0ZA 1M904 1E97A 3G0KA 1JB2A 2P0XA 1YIJ3 3BNBA 1OGZA 3BB9A 5AIFA 3KE7A 1YJ93 1C7HA 2Z77A 4X2OA 2M7OA 2INXA 1IV7A 3CU3A 2CFGA 4K1VA 1W4NA 2W56B 1JRQA 2WGOA 4HM4B 2BNGA 1RKYA 1N8R4 1O7GB 2CHCA 3QRDA 4WHAA 1DVCA 2HMMB 4L8OA 3LH4A 5ELUA 2OCTA 3I553 2CC3A 4H3UA 3K5TA 3EJVA 3KN4A 2Y73A 2L4VA 2YFLB 1OF5B 1OHOA 2BMRB 2QIYA 5KP3A 4FCMA 3G16A 2MF7A 3F7SA 4XBYA 1EKMA 3CPOA 2CG0A 4KFFA 5DREA 1YJW3 1JNQA 1OHSA 1JN5A 1M1XB 1W6GA 3EHCA 1T5YA 3KSPA 1QMAA 2CK3H 3FZWA 2RSXA 1PU4A 3V92A 2RFRA 5JPUA 2A15A 2BT3A 1AVKA 1A2KA 3FH1A 3DY5A 4XBXA 3D3LA 4IIAA 3RDEA 1TUHA 3X41A 2IA7A 4XBTA 1D6YA 3PXMA 1PFPA 2W56A 3DMCA 2ML5A 4N6TA 3Q90A 1UUWB 4HJLB 2B24B 5G2GA 2K0MA 3UNLA 2CFKA 3CCJ3 4OUQA 2P05A 3WDGB 1FA3A 1JKGA 3NBJA 3T0UA 1Q814 4EV2A 3NV0A 1IVVA 3G4S3 1VQN3 3CC73 1IK3A 1O7WB 2W6JH 1OF5A 2W9QA 1IT8A 5STDA 4BTXA 2ML6A 3BNCA 1GD3A 3FSDA 3UL5A 2OQEC 3Q2PA 4HZBB 2GU1A 4FMDA 1SIIA 3AMOB 3CMA3 3PYJA 4BTWA 3EBTA 3D9RA 1ZX2A 4R1KA 3MSOA 3DUKA 1GY6A 1ISKA 3FG4A 4HM7B 4EC6A 2KXGA 1M1K4 2W0QA 3SEDA 2XFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LC7 A;  4N6O B;  2CH9 A;  1CEW I;  1LXE A;  5ELJ A;  5A0O B;  4CCV A;  4IT7 A;  3L0R A;  1G96 A;  1NB5 I;  2BO9 B;  2O9U X;  1RN7 A;  5LC6 A;  1N9J A;  3GAX A;  1N5P A;  1N5H A;  3NX0 A;  4TX4 A;  4N6L A;  1A90 A;  1IV7 A;  3QRD A;  3UL6 A;  1DVC A;  3LH4 A;  5ELU A;  2OCT A;  1EQK A;  1NB3 I;  3K9M C;  3KSE D;  3KFQ C;  4N6U A;  1MOL A;  4N6N B;  1DVD A;  1STF I;  3S67 A;  3MWZ A;  4LZI A;  1IV9 A;  4N6M A;  4EYC A;  3PXM A;  1PFP A;  4N6T A;  1FUW A;  1WNH A;  1A67 A;  1YVB I;  1FA3 A;  1TIJ A;  4ZM8 A;  1MNL A;  1M9G A;  2W9Q A;  3IMA B;  1R4C A;  3PS8 A;  1GD4 A;  3UL5 A;  1GD3 A;  3SVA A;  3Q2P A;  2W9P A;  1CYV A;  1KWI A;  3PYJ A;  5EQL A;  4N6V 0;  1CYU A;  1ROA A;  2KXG A; 
#chains in the Genus database with same CATH topology
 4K90 B;  5AIH A;  2XR8 B;  3BLZ A;  2IYJ A;  5AEU B;  2CG1 A;  1CEW I;  4MMY B;  1LXE A;  1VQP 3;  3X3X A;  4NHF A;  4RBN A;  2XSH B;  4FMB A;  3L0R A;  3DGO A;  2UGI A;  2WO0 A;  2ZA4 A;  3K7C A;  2BO9 B;  3KCH A;  1BSD A;  1RN7 A;  1W01 A;  4HYZ A;  3ROB A;  1NB5 I;  1SAR A;  4J5K A;  2AAE A;  2XEP A;  3GAX A;  1TP6 A;  4U13 A;  1N5P A;  2XH9 A;  1N5H A;  2D1W A;  3FKA A;  3MHE A;  4N6L A;  4R9K A;  1WMO A;  5M18 A;  2KAA A;  9RNT A;  1O7N B;  1E3R A;  2K3D A;  3CNM A;  3M8C A;  8RNT A;  1A90 A;  1FGM A;  2CWV A;  1CQS A;  5G1K A;  1LVN A;  1B20 A;  1RN4 A;  1SIH A;  1W2Z A;  2C10 A;  2WOH A;  1RGK A;  2GXF A;  3MG3 A;  1B2M A;  1F8N A;  4K1U A;  1BRI A;  3CCM 3;  2QGU A;  3FLJ A;  4HM1 B;  5HGR A;  1CH0 A;  1UUV B;  1JB5 A;  1GOU A;  1EQK A;  3B7C A;  1IU7 A;  2KF3 A;  1BUQ A;  3K9M C;  4BU4 A;  1U8C B;  3SOA A;  5IEO A;  5JBS A;  1VQK 3;  3KSE D;  1I2G A;  1OHP A;  3E99 A;  3LTB A;  1JN5 B;  4L8P A;  3SOY A;  8CHO A;  1BUJ A;  3N54 B;  1K28 A;  1UGI A;  4KVH A;  1T2H A;  1BVI A;  3HIG A;  3CME 3;  1RN1 A;  2YFI B;  5JPP A;  7RNT A;  3MG2 A;  4GL6 A;  3WA3 A;  1ULJ B;  2XGL A;  3BIR A;  5CK6 A;  1B2X A;  3NHX A;  1UCI A;  3WMD A;  1ROV A;  5EVH A;  3OXA A;  3X40 A;  3PCS A;  4G1M B;  1LOW A;  4MEI A;  1VQ6 3;  1QJG A;  3OX9 A;  3GZR A;  3S27 A;  4R4K A;  3CXC 2;  2XRX B;  3EQQ B;  3NQY A;  1BSB A;  2F5W A;  4WP5 A;  4WFO A;  5AII A;  5IER A;  3LTC A;  3A5E A;  2XF3 A;  3MWZ A;  1NDO B;  1AR0 A;  3FF2 A;  1WQL B;  3GRD A;  3X42 A;  1SPU A;  1AQZ A;  2C4B A;  4EYC A;  2O3O A;  3SLU A;  1JKG B;  4HKV B;  1TFK A;  3X3Y A;  1X1X A;  2HMN B;  4BIR A;  1GOV A;  1OUN A;  3LYG A;  5IG4 A;  1V74 A;  3QK9 A;  3NV0 B;  2IUJ A;  1TU5 A;  3H51 A;  1FUW A;  2MC8 A;  1S72 3;  1GY5 A;  1K9M 4;  1DMQ A;  1BGS A;  2F56 A;  1IVW A;  1R4Y A;  4HM2 B;  5EEO A;  1KC8 4;  1JBT A;  1QVF 2;  2KCD A;  1MGR A;  3LT8 A;  3CCE 3;  1GSP A;  5D83 A;  3DGL A;  2QA4 3;  1I70 A;  1BAN A;  3LT9 A;  3STD A;  1BNE A;  1UCL A;  1M9G A;  2F86 B;  1IQ8 A;  2CWU A;  4AEQ A;  3IMA B;  1AV4 A;  2CFW A;  2IY2 A;  3ALA A;  3RGA A;  1W2B 2;  1K8A 4;  3LZA A;  1FUT A;  1RCK A;  3SX1 A;  3SVA A;  2CKF B;  2HML B;  1VQ5 3;  2OOV C;  1I8V A;  4HBR A;  2UUG C;  2XSO B;  3NUV A;  3H3H A;  1JBR A;  3WHO A;  5CF1 A;  2AAD A;  3V98 A;  5IG3 A;  2F5M A;  4GB5 A;  1BNF A;  1W00 A;  3GSP A;  4N6V 0;  1AY7 A;  4FR9 A;  3WR2 A;  4R9L A;  3B4O A;  4HM5 B;  1W02 A;  3CCS 3;  5FGO A;  1I0X A;  2HMK B;  3AHW A;  3OWY A;  2H0H A;  1Q7Y 4;  3JUN A;  1YVS A;  3N9H A;  3ZG5 A;  2LQV A;  4O8S A;  3ER7 A;  4RNT A;  1UI7 A;  1NU3 A;  3O8Y A;  3D79 A;  1EA2 A;  5ELJ A;  5A0O B;  3AGO A;  2W03 A;  1RLS A;  1G96 A;  1VQ9 3;  3A76 A;  1G0T A;  1MWS A;  3PGB A;  1LRA A;  4ORL A;  4XM4 A;  1A2P A;  5AI1 A;  1L5G B;  4KFD A;  3CC2 3;  1ULI B;  1S5A A;  3F40 A;  4LMI A;  1JZO A;  4PEJ A;  1N8Q A;  1G02 A;  4HM3 B;  1ZS7 A;  3OV4 A;  3NX0 A;  4JRF A;  1A2V A;  4QWT A;  4WYK A;  1BNS A;  3TDG A;  1YJN 3;  1YGE A;  3T8U A;  1O7M B;  3S29 A;  3N8B A;  1RCL A;  3JUM A;  1JZD A;  3SXX A;  1Z1S A;  2Y74 A;  1FGR A;  1PY3 A;  1RNB A;  2JQ5 A;  1OAC A;  1QVG 2;  1RHL A;  2RGQ A;  2GBX B;  1VQ8 3;  3U97 A;  5IF6 A;  1W5Z A;  3CNX A;  3CCV 3;  5GSP A;  2GEX A;  4RZM A;  5IW9 A;  3S28 A;  3HX8 A;  3I0Y A;  5RNT A;  1FGT A;  1RSN A;  4FCZ A;  2UX0 A;  1BRH A;  3VSY A;  2GU3 A;  2WOF A;  1I0V A;  4AKY A;  2CIU A;  2CW9 A;  3NM7 A;  1Q86 4;  3RGR A;  2C11 A;  3SYU A;  3KFQ C;  2GSP A;  3KZT A;  2CWT A;  4OK0 A;  2FXT A;  2P38 A;  4N6U A;  3K63 A;  1DYU A;  3CCR 3;  2H0G A;  4N6N B;  3HII A;  2CFL A;  1IQY A;  3LXU X;  1RGA A;  3GWR A;  2H0I A;  1JB4 A;  1KD1 4;  2P0M A;  4MMX B;  3D5G A;  3EC9 A;  3EE1 A;  4RNY A;  4J9A A;  4L7K A;  1ASK A;  3G71 3;  4K61 A;  1W6Y A;  5IG0 A;  3NM2 A;  5HOH A;  1LNI A;  1RRL A;  3U1W A;  1IV9 A;  3NBR A;  1BIR A;  2Z76 A;  2OWP A;  4BTY A;  2GEY A;  1UUG B;  2F98 A;  3F9S A;  7STD A;  1QAK A;  3JUO A;  3UJM A;  3DZL A;  4LGQ A;  1U5O A;  1Q82 4;  1HZ1 A;  1BSC A;  3X3Z A;  1FYS A;  1T3B A;  1YGW A;  4HVN A;  3D5I A;  3EN1 B;  1WNH A;  1RGL A;  3JUQ A;  1A67 A;  1ZO2 A;  1FZU A;  2BMO B;  2IUK A;  5IG5 A;  4Q53 A;  4ZM8 A;  1Q40 B;  1B2U A;  1VQO 3;  3FF0 A;  1BRG A;  1IDP A;  4CDL A;  3G6E 3;  2FGT A;  1NWW A;  1I2F A;  1LOV A;  4WWU C;  3LML A;  3HOH A;  3J7Y d;  3PS8 A;  1SQW A;  2LYX A;  1IVU A;  4I5Q A;  2SAR A;  4FMC A;  3GZY B;  4GHO A;  2W9P A;  3OWS A;  1GYB A;  2E2U A;  2J8X B;  1CYV A;  4EV5 A;  1KWI A;  3LTA A;  1FW7 A;  4LEH A;  5M19 A;  2F99 A;  1IVX A;  1VZZ A;  3BNE A;  1VQ7 3;  4X2H A;  3DGY A;  4DKI A;  2L1S A;  1ROA A;  3AGN A;  3VGN A;  2KRT A;  2OQE A;  1TFO A;  5KP4 A;  3B8L A;  4J8T A;  1BOX A;  4N6O B;  5LC7 A;  1OCV A;  2PZV A;  4AKZ A;  1UW1 A;  4HM6 B;  1TRQ A;  1D6Z A;  3CD6 3;  1OPY A;  1KSI A;  4IT7 A;  4WYK B;  2RCD A;  1DE3 A;  3OW2 2;  1UI8 A;  3MKI A;  2CFD A;  3ECF A;  1GY7 A;  1K73 4;  1Q40 A;  1LQM B;  1N9J A;  3PCR A;  5BIR A;  4FMA A;  6STD A;  1AVL A;  2QEX 3;  5I97 A;  4EW5 A;  1RNT A;  4MJD A;  4TX4 A;  1MWU A;  4JF8 A;  3KII A;  3CCU 3;  5BU4 A;  1J2B A;  1K41 A;  2ZHX B;  3JUP A;  1EG9 B;  2XGN A;  2YX9 A;  1RGG A;  1QAL A;  2JDI H;  3IJE B;  1O7P B;  3MPH A;  4XDV A;  1STD A;  1W7C A;  3V99 A;  1NO3 A;  3WA2 X;  5CF2 A;  3EBY A;  1WMP A;  4LSO A;  2RBI A;  2P09 A;  5FW5 A;  1B3S A;  1RGC A;  1EEJ A;  1TTO A;  1EUI C;  1GMR A;  3F7X A;  5AEW B;  3F14 A;  1FGQ A;  2CX1 A;  1X1U A;  3FG1 A;  2F4Y A;  4KZ1 A;  3UL6 A;  5IEN A;  2BIR A;  1Q42 A;  2XFT A;  1NB3 I;  1HKX A;  3URP A;  1YHQ 3;  3D4A A;  3WOE B;  1RDS A;  2W2C A;  2YFJ B;  4FCJ A;  2ZDJ A;  4HZ9 B;  1D6U A;  5TGN A;  1E3V A;  4EBG A;  3LOY A;  3F8H A;  3HZP A;  1MOL A;  1LNH A;  1O7H B;  4N3V A;  4O2H A;  1RRH A;  4XDW A;  3DGM A;  1B2S A;  2WGQ A;  1GS3 A;  3EN8 A;  3HI7 A;  1IT7 A;  2FNQ A;  5BXQ A;  1UDI I;  3UB1 A;  3GZB A;  1VQ4 3;  2V1L A;  7GSP A;  1PYL A;  3CC4 3;  1Y4K A;  1YIT 3;  1LQG C;  1UCK A;  5M1A A;  2OTJ 3;  3CCL 3;  4I4K A;  2I9W A;  4OVM A;  3CPW 2;  1US1 A;  1JJ2 2;  1BNR A;  1VQL 3;  3MYT A;  5CLK A;  1DVD A;  1HYF A;  4HM8 B;  1JV2 B;  5CXO A;  1SJW A;  1STF I;  2R41 A;  3S67 A;  1YI2 3;  3Q1C A;  1BNI A;  1WTH A;  3FGY A;  4H61 A;  3IPT A;  1I2E A;  3B4P A;  3JVC A;  3KKG A;  4LZI A;  4N6M A;  4CJN A;  2OTL 3;  4ILF A;  4O02 B;  3G8Z A;  2KF6 A;  3VF1 A;  5AYR B;  2D42 A;  3NBB A;  3S5C A;  1Q7H A;  3F8X A;  1C54 A;  1BRK A;  1YNV X;  1QAF A;  1RGE A;  3PZW A;  3T8N A;  5D81 A;  1WMN A;  1YVB I;  1HU9 A;  1TIJ A;  3WOF B;  2W04 A;  4EXR A;  4CPK A;  3DH2 A;  1BU4 A;  1I3F A;  2SBL A;  2HMO B;  2Z6B A;  4STD A;  1KQS 2;  3EX9 A;  1NJI 4;  1MNL A;  1MWR A;  4NRE A;  3ZG0 A;  1FGO A;  2KF5 A;  2STD A;  3BND A;  6GSP A;  3EB8 A;  1R4C A;  1V58 A;  3FG3 A;  2BHM A;  1GD4 A;  1W6C A;  3NQZ A;  4RNZ A;  3DGN A;  4IPB A;  1LOX A;  1VQM 3;  1V57 A;  2E2T A;  1DMN A;  1OGX A;  3CCQ 3;  1B2Z A;  5EQL A;  3EF8 A;  2RNT A;  2HMJ B;  1DMM A;  1RJO A;  2PNC A;  5D82 A;  2Q07 A;  1RGH A;  4R80 A;  4KT3 B;  5BVB A;  1CYU A;  2XFS A;  1NNV A;  2R4I A;  1BNG A;  2IMJ A;  3WOD G;  6RNT A;  3AMO A;  2OOV A;  5KP1 A;  5AIG A;  1GOY A;  2CH9 A;  2ZL8 A;  3LTD A;  4KFE A;  4O3V A;  5DRV A;  1BNJ A;  1IQX A;  1N9E A;  3HK4 A;  4HAA A;  3DXO A;  2BMQ B;  2B1X B;  3GZX B;  2GBW B;  2K54 A;  3FCS B;  4GSP A;  4HM0 B;  3DM8 A;  4CCV A;  4XB5 A;  2HOH A;  3OWU A;  1OH0 A;  4MMZ B;  1RTU A;  2O9U X;  5LC6 A;  3I56 3;  2Z7A A;  5AYS C;  1BRN L;  3NXJ A;  5IEP A;  1X1Y A;  3MG1 A;  2E2V A;  3K0Z A;  1M90 4;  1E97 A;  3G0K A;  1JB2 A;  1RMS A;  1VQQ A;  2P0X A;  1YIJ 3;  3BNB A;  1ZGX A;  1OGZ A;  3BB9 A;  1BAO A;  1MGW A;  1Q9E A;  4NPB A;  5AIF A;  3KE7 A;  1YJ9 3;  1C7H A;  2Z77 A;  4X2O A;  2M7O A;  1FUS A;  1IV7 A;  2INX A;  3CU3 A;  1JBS A;  2CFG A;  4K1V A;  1W4N A;  2W56 B;  1JRQ A;  2WGO A;  4HM4 B;  2BNG A;  1RKY A;  2BU4 A;  1O7G B;  1LOY A;  1N8R 4;  2CHC A;  3AHS A;  3QRD A;  4WHA A;  1DVC A;  2HMM B;  4L8O A;  3RNT A;  3LH4 A;  4LYL B;  2OCT A;  5ELU A;  3I55 3;  2CC3 A;  2KF4 A;  4H3U A;  1BSE A;  3K5T A;  3EJV A;  3KN4 A;  2Y73 A;  1TJD A;  2L4V A;  2YFL B;  1OF5 B;  1B27 A;  3SED A;  1OHO A;  3ZFZ A;  2BMR B;  2QIY A;  5KP3 A;  4FCM A;  3G16 A;  2MF7 A;  3F7S A;  4XBY A;  1EKM A;  3CPO A;  1B21 A;  2CG0 A;  4KFF A;  5DRE A;  1JNQ A;  1YJW 3;  1X1W A;  1OHS A;  1JN5 A;  1M1X B;  1W6G A;  3EHC A;  1T5Y A;  3KSP A;  1QMA A;  2CK3 H;  3FZW A;  1GMQ A;  2RSX A;  4J5G A;  1PU4 A;  3V92 A;  2RFR A;  5JPU A;  2A15 A;  2BT3 A;  1AVK A;  1IYY A;  1A2K A;  3FH1 A;  1BRS A;  3DY5 A;  4XBX A;  3D3L A;  4IIA A;  3RDE A;  1TUH A;  3X41 A;  2IA7 A;  4BL2 A;  4XBT A;  1D6Y A;  3PXM A;  3Q3F A;  1BRJ A;  1PFP A;  2W56 A;  3DMC A;  2ML5 A;  1BSA A;  1UGH I;  4N6T A;  3Q90 A;  1UUW B;  4HJL B;  2B24 B;  5G2G A;  2K0M A;  3UNL A;  2CFK A;  3CCJ 3;  4OUQ A;  2P05 A;  3WDG B;  5G1L A;  1FA3 A;  1JKG A;  3NBJ A;  1RGF A;  3T0U A;  4BL3 A;  4EV2 A;  1Q81 4;  3NV0 A;  1IVV A;  1DET A;  3G4S 3;  3CC7 3;  1VQN 3;  1IK3 A;  1O7W B;  2W6J H;  1UCJ A;  1OF5 A;  2W9Q A;  1IT8 A;  5STD A;  4BTX A;  2ML6 A;  3BNC A;  1GD3 A;  1GMP A;  3FSD A;  3UL5 A;  2OQE C;  3Q2P A;  4HZB B;  2GU1 A;  4FMD A;  3BU4 A;  1SII A;  4HOH A;  1T2I A;  3AMO B;  3CMA 3;  3PYJ A;  1MWT A;  3EBT A;  4BTW A;  1TRP A;  3D9R A;  1ZX2 A;  4R1K A;  3MSO A;  3DUK A;  1GY6 A;  1ISK A;  3FG4 A;  4HM7 B;  4EC6 A;  2KXG A;  1M1K 4;  2W0Q A;  2CX0 A;  1I3I A; 
#chains in the Genus database with same CATH homology
 4K90 B;  5AIH A;  2XR8 B;  3BLZ A;  5AEU B;  2CG1 A;  1CEW I;  4MMY B;  1LXE A;  1VQP 3;  3X3X A;  4NHF A;  4RBN A;  2XSH B;  4FMB A;  3L0R A;  3DGO A;  3K7C A;  2WO0 A;  4HYZ A;  2BO9 B;  1NB5 I;  1RN7 A;  3ROB A;  1W01 A;  2XEP A;  3GAX A;  4U13 A;  1TP6 A;  1N5P A;  2XH9 A;  1N5H A;  2D1W A;  3FKA A;  3MHE A;  4N6L A;  4R9K A;  1WMO A;  1O7N B;  1E3R A;  3CNM A;  3M8C A;  1A90 A;  1FGM A;  2CWV A;  1CQS A;  1LVN A;  1W2Z A;  3MG3 A;  1SIH A;  2C10 A;  2WOH A;  2GXF A;  1F8N A;  4K1U A;  3CCM 3;  2QGU A;  3FLJ A;  4HM1 B;  5HGR A;  1UUV B;  1JB5 A;  1EQK A;  3B7C A;  1IU7 A;  1BUQ A;  3K9M C;  1U8C B;  3SOA A;  5IEO A;  5JBS A;  1VQK 3;  3KSE D;  1OHP A;  3E99 A;  3LTB A;  1JN5 B;  4L8P A;  3SOY A;  8CHO A;  3N54 B;  1K28 A;  4KVH A;  3HIG A;  3CME 3;  2YFI B;  5JPP A;  3MG2 A;  4GL6 A;  3WA3 A;  1ULJ B;  2XGL A;  5CK6 A;  3NHX A;  3WMD A;  1ROV A;  5EVH A;  3OXA A;  3X40 A;  3PCS A;  4G1M B;  4MEI A;  1VQ6 3;  1QJG A;  3OX9 A;  3GZR A;  3S27 A;  4R4K A;  3CXC 2;  2XRX B;  3EQQ B;  3NQY A;  4WFO A;  4WP5 A;  5AII A;  5IER A;  3LTC A;  2XF3 A;  3MWZ A;  1NDO B;  1AR0 A;  3FF2 A;  1WQL B;  3GRD A;  3X42 A;  1SPU A;  4EYC A;  2O3O A;  3SLU A;  1JKG B;  4HKV B;  1TFK A;  3X3Y A;  2HMN B;  1OUN A;  3LYG A;  5IG4 A;  1V74 A;  3QK9 A;  3NV0 B;  2IUJ A;  1TU5 A;  3H51 A;  1FUW A;  2MC8 A;  1S72 3;  1GY5 A;  1K9M 4;  1DMQ A;  1IVW A;  4HM2 B;  5EEO A;  1KC8 4;  1QVF 2;  2KCD A;  3LT8 A;  3CCE 3;  5D83 A;  3DGL A;  2QA4 3;  3LT9 A;  3STD A;  1M9G A;  2F86 B;  1IQ8 A;  2CWU A;  4AEQ A;  3IMA B;  1AV4 A;  2CFW A;  3ALA A;  1W2B 2;  3RGA A;  1K8A 4;  3LZA A;  3SX1 A;  3SVA A;  2CKF B;  2HML B;  1VQ5 3;  2OOV C;  4HBR A;  2XSO B;  3NUV A;  3H3H A;  5CF1 A;  3V98 A;  5IG3 A;  4GB5 A;  1W00 A;  4N6V 0;  4FR9 A;  4R9L A;  3B4O A;  4HM5 B;  1W02 A;  3CCS 3;  5FGO A;  2HMK B;  3OWY A;  1Q7Y 4;  3JUN A;  3N9H A;  2LQV A;  4O8S A;  3ER7 A;  1UI7 A;  1NU3 A;  3O8Y A;  1EA2 A;  5ELJ A;  5A0O B;  2W03 A;  1VQ9 3;  1G96 A;  3A76 A;  3PGB A;  4ORL A;  4XM4 A;  5AI1 A;  1L5G B;  4KFD A;  3CC2 3;  1ULI B;  1S5A A;  3F40 A;  4LMI A;  4PEJ A;  1N8Q A;  4QWT A;  4HM3 B;  4JRF A;  3OV4 A;  3NX0 A;  4WYK A;  1A2V A;  3TDG A;  1YJN 3;  1YGE A;  3T8U A;  1O7M B;  3S29 A;  3N8B A;  3JUM A;  3SXX A;  1Z1S A;  2Y74 A;  1FGR A;  2JQ5 A;  1OAC A;  1QVG 2;  2RGQ A;  2GBX B;  1VQ8 3;  3U97 A;  5IF6 A;  1W5Z A;  3CNX A;  3CCV 3;  2GEX A;  4RZM A;  5IW9 A;  3S28 A;  3HX8 A;  3I0Y A;  1FGT A;  4FCZ A;  2UX0 A;  3VSY A;  2GU3 A;  2WOF A;  4AKY A;  2CIU A;  2CW9 A;  3NM7 A;  1Q86 4;  3RGR A;  2C11 A;  3KFQ C;  3KZT A;  2CWT A;  4OK0 A;  2FXT A;  2P38 A;  4N6U A;  3K63 A;  1DYU A;  3CCR 3;  4N6N B;  3HII A;  2CFL A;  1IQY A;  3LXU X;  3GWR A;  1JB4 A;  1KD1 4;  2P0M A;  4MMX B;  3EC9 A;  3EE1 A;  4RNY A;  4J9A A;  4L7K A;  1ASK A;  3G71 3;  4K61 A;  1W6Y A;  5IG0 A;  3NM2 A;  1RRL A;  3U1W A;  1IV9 A;  3NBR A;  2Z76 A;  2OWP A;  4BTY A;  2GEY A;  3F9S A;  2F98 A;  7STD A;  1QAK A;  3JUO A;  3UJM A;  3DZL A;  4LGQ A;  1U5O A;  1Q82 4;  3X3Z A;  4HVN A;  3EN1 B;  1WNH A;  3JUQ A;  1A67 A;  1ZO2 A;  2BMO B;  2IUK A;  5IG5 A;  4Q53 A;  4ZM8 A;  1Q40 B;  1VQO 3;  3FF0 A;  1IDP A;  4CDL A;  3G6E 3;  2FGT A;  1NWW A;  4WWU C;  3LML A;  3J7Y d;  3PS8 A;  1SQW A;  2LYX A;  1IVU A;  4FMC A;  3GZY B;  2W9P A;  3OWS A;  1GYB A;  2E2U A;  1CYV A;  4EV5 A;  1KWI A;  3LTA A;  4LEH A;  2F99 A;  1IVX A;  1VZZ A;  3BNE A;  1VQ7 3;  4X2H A;  1ROA A;  3VGN A;  2KRT A;  2OQE A;  1TFO A;  5KP4 A;  3B8L A;  4J8T A;  5LC7 A;  4N6O B;  1OCV A;  2PZV A;  4AKZ A;  1UW1 A;  4HM6 B;  1D6Z A;  3CD6 3;  1OPY A;  1KSI A;  4IT7 A;  4WYK B;  2RCD A;  3OW2 2;  1UI8 A;  3MKI A;  2CFD A;  3ECF A;  1GY7 A;  1K73 4;  1Q40 A;  3PCR A;  1N9J A;  4FMA A;  6STD A;  1AVL A;  2QEX 3;  5I97 A;  4MJD A;  4TX4 A;  4JF8 A;  3KII A;  3CCU 3;  1J2B A;  1K41 A;  3JUP A;  1EG9 B;  2XGN A;  2YX9 A;  2JDI H;  1QAL A;  3IJE B;  3MPH A;  1O7P B;  4XDV A;  1YHQ 3;  1STD A;  1W7C A;  3V99 A;  1NO3 A;  3WA2 X;  5CF2 A;  3EBY A;  1WMP A;  4LSO A;  2P09 A;  5FW5 A;  3F7X A;  5AEW B;  3F14 A;  1FGQ A;  3FG1 A;  4KZ1 A;  3UL6 A;  5IEN A;  1Q42 A;  1NB3 I;  1HKX A;  3WOE B;  2W2C A;  2YFJ B;  4FCJ A;  2ZDJ A;  4HZ9 B;  1D6U A;  5TGN A;  1E3V A;  4EBG A;  3LOY A;  3F8H A;  3HZP A;  1MOL A;  1LNH A;  1O7H B;  4N3V A;  4O2H A;  1RRH A;  4XDW A;  3DGM A;  2WGQ A;  1GS3 A;  3EN8 A;  3HI7 A;  1IT7 A;  2FNQ A;  5BXQ A;  3UB1 A;  3GZB A;  1VQ4 3;  2V1L A;  3CC4 3;  1Y4K A;  1YIT 3;  2OTJ 3;  3CCL 3;  4I4K A;  2I9W A;  4OVM A;  3CPW 2;  1US1 A;  1JJ2 2;  1VQL 3;  3MYT A;  5CLK A;  1DVD A;  4HM8 B;  1JV2 B;  5CXO A;  1SJW A;  1STF I;  3S67 A;  1YI2 3;  3Q1C A;  4H61 A;  1WTH A;  3FGY A;  4LZI A;  3IPT A;  3B4P A;  3JVC A;  4N6M A;  3KKG A;  2OTL 3;  4O02 B;  3G8Z A;  3VF1 A;  5AYR B;  2D42 A;  3NBB A;  3S5C A;  3F8X A;  1QAF A;  3PZW A;  3T8N A;  5D81 A;  1WMN A;  1YVB I;  1HU9 A;  1TIJ A;  3WOF B;  2W04 A;  4EXR A;  1KQS 2;  2SBL A;  2HMO B;  2Z6B A;  4STD A;  3EX9 A;  1NJI 4;  1MNL A;  4NRE A;  1FGO A;  2STD A;  3BND A;  3EB8 A;  1R4C A;  3FG3 A;  2BHM A;  1GD4 A;  1W6C A;  3NQZ A;  4RNZ A;  3DGN A;  4IPB A;  1LOX A;  1VQM 3;  2E2T A;  1DMN A;  1OGX A;  3CCQ 3;  5EQL A;  3EF8 A;  2HMJ B;  1DMM A;  1RJO A;  2PNC A;  5D82 A;  2Q07 A;  5BVB A;  4R80 A;  1CYU A;  2XFS A;  2R4I A;  2IMJ A;  3WOD G;  3AMO A;  2OOV A;  5KP1 A;  5AIG A;  2CH9 A;  3LTD A;  2ZL8 A;  4KFE A;  4O3V A;  5DRV A;  1N9E A;  1IQX A;  3HK4 A;  3DXO A;  2BMQ B;  2B1X B;  3GZX B;  2GBW B;  2K54 A;  3FCS B;  4HM0 B;  4CCV A;  3DM8 A;  4XB5 A;  3OWU A;  4MMZ B;  1OH0 A;  2O9U X;  5LC6 A;  3I56 3;  2Z7A A;  5AYS C;  3NXJ A;  5IEP A;  3MG1 A;  2E2V A;  3K0Z A;  1M90 4;  1E97 A;  3G0K A;  1JB2 A;  2P0X A;  1YIJ 3;  3BNB A;  1OGZ A;  3BB9 A;  5AIF A;  3KE7 A;  1YJ9 3;  1C7H A;  2Z77 A;  4X2O A;  2M7O A;  2INX A;  1IV7 A;  3CU3 A;  2CFG A;  4K1V A;  1W4N A;  2W56 B;  1JRQ A;  2WGO A;  4HM4 B;  2BNG A;  1RKY A;  1N8R 4;  1O7G B;  2CHC A;  3QRD A;  4WHA A;  1DVC A;  2HMM B;  4L8O A;  3LH4 A;  5ELU A;  2OCT A;  3I55 3;  2CC3 A;  4H3U A;  3K5T A;  3EJV A;  3KN4 A;  2Y73 A;  2L4V A;  2YFL B;  1OF5 B;  1OHO A;  2BMR B;  2QIY A;  5KP3 A;  4FCM A;  3G16 A;  2MF7 A;  3F7S A;  4XBY A;  1EKM A;  3CPO A;  2CG0 A;  4KFF A;  5DRE A;  1YJW 3;  1JNQ A;  1OHS A;  1JN5 A;  1M1X B;  1W6G A;  3EHC A;  1T5Y A;  3KSP A;  1QMA A;  2CK3 H;  3FZW A;  2RSX A;  1PU4 A;  3V92 A;  2RFR A;  5JPU A;  2A15 A;  2BT3 A;  1AVK A;  1A2K A;  3FH1 A;  3DY5 A;  4XBX A;  3D3L A;  4IIA A;  3RDE A;  1TUH A;  3X41 A;  2IA7 A;  4XBT A;  1D6Y A;  3PXM A;  1PFP A;  2W56 A;  3DMC A;  2ML5 A;  4N6T A;  3Q90 A;  1UUW B;  4HJL B;  2B24 B;  5G2G A;  2K0M A;  3UNL A;  2CFK A;  3CCJ 3;  4OUQ A;  2P05 A;  3WDG B;  1FA3 A;  1JKG A;  3NBJ A;  3T0U A;  1Q81 4;  4EV2 A;  3NV0 A;  1IVV A;  3G4S 3;  1VQN 3;  3CC7 3;  1IK3 A;  1O7W B;  2W6J H;  1OF5 A;  2W9Q A;  1IT8 A;  5STD A;  4BTX A;  2ML6 A;  3BNC A;  1GD3 A;  3FSD A;  3UL5 A;  2OQE C;  3Q2P A;  4HZB B;  2GU1 A;  4FMD A;  1SII A;  3AMO B;  3CMA 3;  3PYJ A;  4BTW A;  3EBT A;  3D9R A;  1ZX2 A;  4R1K A;  3MSO A;  3DUK A;  1GY6 A;  1ISK A;  3FG4 A;  4HM7 B;  4EC6 A;  2KXG A;  1M1K 4;  2W0Q A;  3SED A;  2XFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...