1AY7A

Ribonuclease sa complex with barstar
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Recognition of RNase Sa by the inhibitor barstar: structure of the complex at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Complex (enzyme/inhibitor)
total genus 24
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ay7A00
1R4YA 1BNEA 1LRAA 5RNTA 2BU4A 1TRPA 3WR2A 1FZUA 1B2SA 1SARA 2KF3A 6RNTA 1BNSA 3D5IA 1RTUA 1UCLA 2GSPA 8RNTA 1UCIA 1BSAA 1FYSA 4HAAA 1BRSA 1DE3A 1RNBA 1FUSA 2AAEA 1I3IA 6GSPA 1CH0A 1GMPA 1BU4A 1RGFA 3BU4A 1GOYA 1RGGA 1X1UA 1I0VA 2RBIA 1JBSA 1GSPA 1RGLA 3AHSA 1X1WA 3KCHA 1LOVA 2F5MA 3WHOA 1AY7A 1AQZA 1IYYA 3GSPA 5HOHA 1BRNL 1B2XA 1BIRA 1LOWA 3D5GA 1G02A 2ZA4A 1TTOA 1RHLA 3AGNA 1BRHA 1BRGA 1UCJA 1TRQA 1FUTA 1BRIA 1DETA 1RGHA 1B2UA 1LOYA 2BIRA 1I2GA 4GHOA 1RDSA 2HOHA 7RNTA 1BANA 1RGCA 1BNJA 1BNGA 2C4BA 1BVIA 1PY3A 1ZGXA 3URPA 4BIRA 1GMQA 1RCLA 1RGEA 1BOXA 1I8VA 2KAAA 3HOHA 1GMRA 3BIRA 1Q9EA 2KF4A 7GSPA 1A2PA 2KF6A 1YGWA 5BIRA 1RMSA 1RN1A 1I2EA 2F5WA 4HOHA 3RNTA 1B2MA 1T2HA 1LNIA 1JBTA 3AHWA 1B27A 1B3SA 1MGRA 3SYUA 1RNTA 1UCKA 1FW7A 1C54A 1RCKA 1BNFA 4BU4A 2SARA 1BSBA 1HYFA 1BSDA 3AGOA 1B20A 1BAOA 1BSEA 1X1YA 1BRKA 1PYLA 1RGAA 3DGYA 3D4AA 1BUJA 1BNRA 1JBRA 2KF5A 4GSPA 1BSCA 1BGSA 4RNTA 1I2FA 1RGKA 1T2IA 1B2ZA 4J5KA 9RNTA 2F56A 1BNIA 5BU4A 3DH2A 1I70A 1I3FA 2F4YA 1GOVA 3Q3FA 5GSPA 1HZ1A 1I0XA 1RN4A 1YNVX 1B21A 4J5GA 1RSNA 1RLSA 2RNTA 1MGWA 1X1XA 1YVSA 3A5EA 2AADA 1BRJA 1GOUA
chains in the Genus database with same CATH superfamily
2E2TA 1KWIA 4KFFA 1VQO3 1WMOA 5CK6A 3OWSA 3EX9A 6STDA 1B2SA 1GY5A 2GBWB 2K54A 2B24B 1BNSA 3KE7A 5LC7A 2Z6BA 4J8TA 3CCE3 1M9GA 3NQZA 1LOXA 2IUJA 1JKGA 1STFI 4EXRA 3JUNA 1FYSA 3S5CA 4MMYB 1FGTA 3T0UA 2BO9B 1K9M4 3FCSB 1IU7A 2F98A 3LT9A 1I3IA 2Z76A 1GMPA 5BXQA 1BU4A 3MKIA 4N6LA 5EEOA 3CCL3 3SX1A 2WGQA 2W56B 3CNXA 3F14A 3H3HA 5STDA 2JQ5A 2XSOB 1TP6A 2W6JH 2WO0A 3ZFZA 2XFTA 3NM2A 1UDII 2RBIA 1OUNA 1QALA 1OHPA 1GSPA 3FH1A 4EYCA 4XB5A 3EBYA 3PCSA 3IPTA 1FGMA 1OHSA 2CFWA 3FG3A 2CKFB 4ORLA 1ZS7A 3GZBA 4HM3B 1G02A 3HK4A 3SLUA 3X3YA 2ZA4A 3NV0A 1OCVA 1RHLA 3AGNA 3KFQC 4HM1B 4HM4B 1BRHA 4TX4A 3S27A 1OGXA 2XGNA 4BTYA 1N9JA 3ALAA 3AMOB 5KP3A 8CHOA 1GY6A 1T5YA 1IV9A 1IVVA 1Q40B 1BRIA 5KP4A 3EB8A 1IVWA 2CW9A 2P09A 3CC73 4G1MB 2BIRA 3CCR3 3KSED 2OCTA 2HOHA 2KCDA 1BANA 1IK3A 1BNGA 4HVNA 3K5TA 3MPHA 4KVHA 5IG3A 1JN5A 2KF6A 2BHMA 2RCDA 1EG9B 3N9HA 1RN1A 3V98A 1B2MA 2MC8A 2BNGA 4R9KA 3T8UA 3CCJ3 1JBTA 3CC43 2E2UA 3CME3 1VQK3 4N6UA 1VQ73 4XBXA 1FW7A 1W6CA 3DMCA 1RCKA 3IMAB 1VQ63 3BB9A 2XGLA 3WOFB 1O7HB 4FMDA 3B4PA 1BSDA 1F8NA 1DMQA 1MOLA 4O8SA 1DVDA 1BSEA 1UGIA 4LYLB 3FLJA 1JNQA 2LYXA 3JUMA 3U1WA 1BNRA 5IG5A 3IJEB 4NHFA 1IDPA 3DXOA 1RGKA 3EJVA 3T8NA 3KN4A 3UL5A 9RNTA 2CHCA 2P38A 1I3FA 2F4YA 1GOVA 3ECFA 2F99A 2WOFA 3N54B 3S67A 4MMZB 4K1UA 1B21A 2P05A 3MHEA 3EQQB 2XH9A 1YVSA 2F86B 1VQ43 4DKIA 1JB2A 2AADA 1TFKA 3KSPA 1MWSA 2IMJA 3LMLA 2UUGC 5RNTA 2BU4A 2O3OA 2HMNB 1TRPA 4RZMA 1MWTA 2MF7A 3GWRA 3CD63 1FZUA 1TFOA 1O7MB 3DGNA 1LXEA 2KF3A 4EW5A 4MJDA 4FCZA 3D5IA 4XBYA 1RTUA 8RNTA 1UCIA 4RNYA 4N6NB 1RRHA 2W2CA 1YGEA 3LH4A 1DE3A 2BMRB 1W2B2 2IA7A 3FSDA 3HI7A 1IVUA 1RNBA 1WMPA 1FUSA 2AAEA 2ZDJA 5HGRA 1MNLA 2KRTA 3BU4A 4HM2B 3CCM3 2ML5A 2OTJ3 3JUOA 4IPBA 1JB4A 1V57A 3VGNA 4MMXB 1KC84 3K9MC 3FKAA 2L4VA 4RNZA 1ROAA 4WYKA 2LQVA 2CG1A 3CXC2 1LQMB 1X1WA 2BMQB 1D6YA 2CC3A 4QWTA 4RBNA 1CQSA 1JZDA 1NU3A 1MWRA 2F5MA 3NXJA 4O02B 5D83A 3WHOA 1AY7A 1NB5I 4K61A 4CJNA 3GSPA 2OQEA 1YJW3 1JKGB 3NQYA 1LOWA 2Q07A 5AIGA 1W4NA 4BL2A 3WOEB 2B1XB 4N6V0 1A2KA 1TTOA 1OF5B 2XF3A 5ELJA 1EKMA 5DREA 2CFKA 2YX9A 1BRGA 2BMOB 4WHAA 3JVCA 5M19A 3B7CA 5CLKA 2INXA 5I97A 4CCVA 3BNEA 2ZHXB 4XM4A 1EA2A 3GZRA 1RGHA 2CWVA 1B2UA 1LOYA 2H0IA 2OOVC 1U8CB 3GAXA 4FMBA 4LMIA 5AEUB 4GHOA 1RDSA 3DGOA 1A67A 5AI1A 2Z7AA 1RGCA 1BNJA 1SJWA 2IUKA 5LC6A 3G8ZA 5IG4A 3F40A 4OK0A 4BIRA 1VQP3 3CCV3 1RGEA 1I8VA 3SOAA 2OTL3 1GMRA 1FGRA 3BIRA 1STDA 2KF4A 3DGLA 1TU5A 1A2PA 4FMCA 3NV0B 1IQ8A 3HIGA 4ZM8A 4I5QA 1W00A 2XFSA 4N6TA 4LSOA 2CFDA 1VQN3 1W01A 2F5WA 3BNBA 2HMJB 1EEJA 4CDLA 2A15A 2W03A 3AHWA 3UNLA 5KP1A 2BT3A 3RGRA 1A90A 2XRXB 2WGOA 4KFDA 2UX0A 3BNCA 3ZG0A 1W7CA 2H0GA 4KZ1A 5AYSC 3X40A 1IQXA 2HMKB 3E99A 5D82A 4HZ9B 1HYFA 3DUKA 1PFPA 1B20A 3N8BA 3F7SA 1UUWB 1RGAA 2RGQA 3D4AA 1UGHI 4CPKA 1JN5B 2YFIB 1I2FA 3OWYA 1RRLA 4HBRA 1YHQ3 1QJGA 1T2IA 2PNCA 3OX9A 5IG0A 1YJ93 1ULJB 1Z1SA 1I70A 1NJI4 3MWZA 3F9SA 2GU3A 3AMOA 1RN4A 3LZAA 1WTHA 2RFRA 4J5GA 1RLSA 1MGWA 2CFGA 3LYGA 2KXGA 3J7Yd 3A5EA 2FNQA 3ZG5A 4L8OA 3PXMA 1W02A 2C11A 1UUVB 1VQ93 5M1AA 1YJN3 3PS8A 1PU4A 3NX0A 4N3VA 4X2OA 6RNTA 2GXFA 4HM7B 1GYBA 4AKYA 1UCLA 5M18A 3PZWA 1BSAA 3LXUX 3X42A 3K7CA 1C7HA 3LT8A 2W9QA 3K0ZA 2SBLA 3V99A 3EBTA 2D42A 3MSOA 1G96A 4XDWA 1TIJA 1VQQA 3NBBA 2CX1A 3VSYA 1CH0A 1RGFA 3GRDA 3F8XA 3UL6A 1GOYA 3RDEA 5AYRB 4X2HA 3PGBA 1OACA 1EUIC 1RN7A 3A76A 3OWUA 1X1UA 1LQGC 3EE1A 1JBSA 1VQ83 3DZLA 3G713 3D79A 1RGLA 3CMA3 2L1SA 3NUVA 2XEPA 3BLZA 3UJMA 3FG4A 5AEWB 1IT8A 3DM8A 3PCRA 5AIFA 1WMNA 1AV4A 4R9LA 4BTWA 4EC6A 1IYYA 1M904 5HOHA 1BRNL 3B4OA 2P0XA 3CPOA 3D5GA 1O7GB 1MWUA 1E3RA 2D1WA 3SVAA 3I563 1M1K4 5IERA 1E97A 1N9EA 1OPYA 3WODG 3D9RA 5CF2A 4AEQA 2QA43 5CXOA 3BNDA 1K41A 1TRQA 2OOVA 3X3XA 1Q824 3CCU3 3FZWA 1V74A 4FCJA 3HIIA 3G16A 1D6UA 4N6MA 4AKZA 4BTXA 1KD14 2O9UX 3F7XA 1O7PB 2GEXA 1I2GA 2CIUA 3GZYB 3WA2X 3OXAA 1N8R4 1US1A 1LVNA 7STDA 1JRQA 3ER7A 4IT7A 4XBTA 2RSXA 1VZZA 3CCS3 4HM6B 1BUQA 4ILFA 3URPA 1Q7HA 1NWWA 1RCLA 2Y73A 2Z77A 3HOHA 3G6E3 1FA3A 4HZBB 1Q9EA 1DYUA 3O8YA 1Q864 1WQLB 1RMSA 3FF0A 3VF1A 3Q1CA 3EN1B 4HOHA 4EV5A 3MG2A 1IVXA 3NBJA 3SOYA 4O3VA 1SIHA 1TJDA 1W5ZA 1QAKA 1LNIA 2ZL8A 3EF8A 5JPPA 3CCQ3 4OVMA 1U5OA 1YI23 1OGZA 1SQWA 3NBRA 4FMAA 5AIHA 1IT7A 1IQYA 2JDIH 5TGNA 1JB5A 1L5GB 4FR9A 2K0MA 5D81A 1C54A 3EN8A 1BNFA 1N5HA 1M1XB 3OW22 4MEIA 1BSBA 1Q7Y4 4K90B 1BAOA 3QRDA 1BRKA 3EC9A 4KFEA 3DY5A 2W9PA 1BUJA 1JBRA 2V1LA 3GZXB 2KF5A 5ELUA 1ROVA 4XDVA 3U97A 1NB3I 4RNTA 5EQLA 5A0OB 2M7OA 1CYVA 2GU1A 5IENA 1OF5A 4J5KA 1AVKA 2F56A 1BNIA 4R1KA 2K3DA 2CWUA 5BU4A 2HMOB 1ZX2A 2UGIA 1DVCA 3UB1A 5JPUA 1I0XA 5FGOA 1NDOB 3JUPA 3M8CA 1RSNA 1W6GA 3CNMA 4PEJA 1CYUA 3LTCA 3V92A 1X1XA 3OV4A 1GD3A 2W56A 1GY7A 1R4YA 1BNEA 3L0RA 3HZPA 1UUGB 2STDA 2W0QA 1LRAA 4EBGA 2P0MA 2QIYA 1K734 1VQ53 1SIIA 1YVBI 4HM8B 1D6ZA 2HMMB 3WR2A 1O7NB 1TUHA 2QEX3 4HKVB 1KQS2 1ASKA 1SARA 1NNVA 3DGMA 4WFOA 1FGQA 3F8HA 3K63A 3LTAA 1S723 1NO3A 1S5AA 2GSPA 4R4KA 3G0KA 4EV2A 3SEDA 1YIJ3 2OQEC 5G1LA 5AIIA 4HAAA 1BRSA 1DMNA 1GD4A 3KZTA 2PZVA 1O7WB 3STDA 4GB5A 4KT3B 3LTDA 1UI7A 6GSPA 4R80A 1Q40A 4GL6A 3WA3A 1JZOA 1RGGA 1HU9A 1Q42A 4U13A 3HX8A 1SPUA 3WDGB 1RKYA 1I0VA 3Q2PA 4FCMA 5IF6A 2W04A 2GEYA 4NREA 1LNHA 1UI8A 3AHSA 3WMDA 3QK9A 1HKXA 3KCHA 1LOVA 4HM5B 4K1VA 4LGQA 1AQZA 3FG1A 1ISKA 5EVHA 1KSIA 1EQKA 1B2XA 3NM7A 1BIRA 4HJLB 3FF2A 2YFLB 1VQM3 1GS3A 3MG3A 3FGYA 4H61A 4L8PA 5G2GA 1UCJA 2CG0A 5IEOA 1W6YA 3Q90A 4BL3A 1FUTA 2I9WA 4H3UA 5IEPA 3I553 1QVG2 2YFJB 1DMMA 1DETA 4HM0B 2QGUA 4J9AA 4O2HA 2C10A 4WWUC 1G0TA 2CH9A 4N6OB 3SXXA 1A2VA 1AR0A 1W2ZA 4I4KA 2FXTA 4LZIA 4JF8A 4HYZA 1J2BA 7RNTA 4Q53A 2R4IA 2C4BA 2H0HA 1BVIA 1PY3A 1ZGXA 1YIT3 2R41A 1GMQA 5FW5A 2CX0A 3LTBA 2KAAA 1BOXA 4JRFA 1QMAA 4STDA 4LEHA 3X3ZA 5DRVA 7GSPA 3S29A 1N8QA 1YGWA 3H51A 3NHXA 5BIRA 1AVLA 1ZO2A 4IIAA 2J8XB 2ML6A 3X41A 2CFLA 1FGOA 1I2EA 2CK3H 5CF1A 1JV2B 1UW1A 3RNTA 1T2HA 3I0YA 2IYJA 2CWTA 3D3LA 1FUWA 1ULIB 1N5PA 2IY2A 1B27A 2FGTA 3KKGA 3KIIA 3PYJA 1QVF2 1B3SA 3RGAA 1MGRA 1T3BA 1RNTA 4OUQA 1UCKA 1QAFA 3SYUA 1OH0A 3EHCA 4BU4A 2SARA 1JJ22 1CEWI 3TDGA 3AGOA 4NPBA 4WYKB 1IV7A 4WP5A 1X1YA 5IW9A 1V58A 1PYLA 1VQL3 3G4S3 3DGYA 1RJOA 1K28A 3CPW2 3MYTA 4GSPA 4L7KA 1BSCA 2E2VA 1BGSA 3S28A 2Y74A 3CU3A 1Q814 1B2ZA 3MG1A 2HMLB 2WOHA 2XSHB 3DH2A 5JBSA 1E3VA 3Q3FA 1Y4KA 3CC23 5GSPA 3B8LA 5G1KA 1HZ1A 1WNHA 2GBXB 2OWPA 1YNVX 3LOYA 3ROBA 2RNTA 5BVBA 1K8A4 1R4CA 3JUQA 2XR8B 1OHOA 1BRJA 1GOUA
chains in the Genus database with same CATH topology
1R4YA 1BNEA 1LRAA 5RNTA 2BU4A 1TRPA 3WR2A 1FZUA 1B2SA 1SARA 2KF3A 6RNTA 1BNSA 3D5IA 1RTUA 1UCLA 2GSPA 8RNTA 1UCIA 1BSAA 1FYSA 4HAAA 1BRSA 1DE3A 1RNBA 1FUSA 2AAEA 1I3IA 6GSPA 1CH0A 1GMPA 1BU4A 1RGFA 3BU4A 1GOYA 1RGGA 1X1UA 1I0VA 2RBIA 1JBSA 1GSPA 1RGLA 3AHSA 1X1WA 3KCHA 1LOVA 2F5MA 3WHOA 1AY7A 1AQZA 1IYYA 3GSPA 5HOHA 1BRNL 1B2XA 1BIRA 1LOWA 3D5GA 1G02A 2ZA4A 1TTOA 1RHLA 3AGNA 1BRHA 1BRGA 1UCJA 1TRQA 1FUTA 1BRIA 1DETA 1RGHA 1B2UA 1LOYA 2BIRA 1I2GA 4GHOA 1RDSA 2HOHA 7RNTA 1BANA 1RGCA 1BNJA 1BNGA 2C4BA 1BVIA 1PY3A 1ZGXA 3URPA 4BIRA 1GMQA 1RCLA 1RGEA 1BOXA 1I8VA 2KAAA 3HOHA 1GMRA 3BIRA 1Q9EA 2KF4A 7GSPA 1A2PA 2KF6A 1YGWA 5BIRA 1RMSA 1RN1A 1I2EA 2F5WA 4HOHA 3RNTA 1B2MA 1T2HA 1LNIA 1JBTA 3AHWA 1B27A 1B3SA 1MGRA 3SYUA 1RNTA 1UCKA 1FW7A 1C54A 1RCKA 1BNFA 4BU4A 2SARA 1BSBA 1HYFA 1BSDA 3AGOA 1B20A 1BAOA 1BSEA 1X1YA 1BRKA 1PYLA 1RGAA 3DGYA 3D4AA 1BUJA 1BNRA 1JBRA 2KF5A 4GSPA 1BSCA 1BGSA 4RNTA 1I2FA 1RGKA 1T2IA 1B2ZA 4J5KA 9RNTA 2F56A 1BNIA 5BU4A 3DH2A 1I70A 1I3FA 2F4YA 1GOVA 3Q3FA 5GSPA 1HZ1A 1I0XA 1RN4A 1YNVX 1B21A 4J5GA 1RSNA 1RLSA 2RNTA 1MGWA 1X1XA 1YVSA 3A5EA 2AADA 1BRJA 1GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Y A;  1BNE A;  1LRA A;  5RNT A;  2BU4 A;  1TRP A;  3WR2 A;  1FZU A;  1B2S A;  1SAR A;  2KF3 A;  6RNT A;  1BNS A;  3D5I A;  1RTU A;  1UCL A;  2GSP A;  8RNT A;  1UCI A;  1BSA A;  1FYS A;  4HAA A;  1BRS A;  1DE3 A;  1RNB A;  1FUS A;  2AAE A;  1I3I A;  6GSP A;  1CH0 A;  1GMP A;  1BU4 A;  1RGF A;  3BU4 A;  1GOY A;  1RGG A;  1X1U A;  1I0V A;  2RBI A;  1JBS A;  1GSP A;  1RGL A;  3AHS A;  1X1W A;  3KCH A;  1LOV A;  2F5M A;  3WHO A;  1AY7 A;  1AQZ A;  1IYY A;  3GSP A;  5HOH A;  1BRN L;  1B2X A;  1BIR A;  1LOW A;  3D5G A;  1G02 A;  2ZA4 A;  1TTO A;  1RHL A;  3AGN A;  1BRH A;  1BRG A;  1UCJ A;  1TRQ A;  1FUT A;  1BRI A;  1DET A;  1RGH A;  1B2U A;  1LOY A;  2BIR A;  1I2G A;  4GHO A;  1RDS A;  2HOH A;  7RNT A;  1BAN A;  1RGC A;  1BNJ A;  1BNG A;  2C4B A;  1BVI A;  1PY3 A;  1ZGX A;  3URP A;  4BIR A;  1GMQ A;  1RCL A;  1RGE A;  1BOX A;  1I8V A;  2KAA A;  3HOH A;  1GMR A;  3BIR A;  1Q9E A;  2KF4 A;  7GSP A;  1A2P A;  2KF6 A;  1YGW A;  5BIR A;  1RMS A;  1RN1 A;  1I2E A;  2F5W A;  4HOH A;  3RNT A;  1B2M A;  1T2H A;  1LNI A;  1JBT A;  3AHW A;  1B27 A;  1B3S A;  1MGR A;  3SYU A;  1RNT A;  1UCK A;  1FW7 A;  1C54 A;  1RCK A;  1BNF A;  4BU4 A;  2SAR A;  1BSB A;  1HYF A;  1BSD A;  3AGO A;  1B20 A;  1BAO A;  1BSE A;  1X1Y A;  1BRK A;  1PYL A;  1RGA A;  3DGY A;  3D4A A;  1BUJ A;  1BNR A;  1JBR A;  2KF5 A;  4GSP A;  1BSC A;  1BGS A;  4RNT A;  1I2F A;  1RGK A;  1T2I A;  1B2Z A;  4J5K A;  9RNT A;  2F56 A;  1BNI A;  5BU4 A;  3DH2 A;  1I70 A;  1I3F A;  2F4Y A;  1GOV A;  3Q3F A;  5GSP A;  1HZ1 A;  1I0X A;  1RN4 A;  1YNV X;  1B21 A;  4J5G A;  1RSN A;  1RLS A;  2RNT A;  1MGW A;  1X1X A;  1YVS A;  3A5E A;  2AAD A;  1BRJ A;  1GOU A; 
#chains in the Genus database with same CATH topology
 2E2T A;  1KWI A;  4KFF A;  1VQO 3;  1WMO A;  5CK6 A;  3OWS A;  3EX9 A;  6STD A;  1B2S A;  1GY5 A;  2GBW B;  2K54 A;  2B24 B;  1BNS A;  3KE7 A;  5LC7 A;  2Z6B A;  4J8T A;  3CCE 3;  1M9G A;  3NQZ A;  1LOX A;  2IUJ A;  1JKG A;  1STF I;  4EXR A;  3JUN A;  1FYS A;  3S5C A;  4MMY B;  1FGT A;  3T0U A;  2BO9 B;  1K9M 4;  3FCS B;  1IU7 A;  2F98 A;  3LT9 A;  1I3I A;  2Z76 A;  1GMP A;  5BXQ A;  1BU4 A;  3MKI A;  4N6L A;  5EEO A;  3CCL 3;  3SX1 A;  2WGQ A;  2W56 B;  3CNX A;  3F14 A;  3H3H A;  5STD A;  2JQ5 A;  2XSO B;  1TP6 A;  2W6J H;  2WO0 A;  3ZFZ A;  2XFT A;  3NM2 A;  1UDI I;  2RBI A;  1OUN A;  1QAL A;  1OHP A;  1GSP A;  3FH1 A;  4EYC A;  4XB5 A;  3EBY A;  3PCS A;  3IPT A;  1FGM A;  1OHS A;  2CFW A;  3FG3 A;  2CKF B;  4ORL A;  1ZS7 A;  3GZB A;  4HM3 B;  1G02 A;  3HK4 A;  3SLU A;  3X3Y A;  2ZA4 A;  3NV0 A;  1OCV A;  1RHL A;  3AGN A;  3KFQ C;  4HM1 B;  4HM4 B;  1BRH A;  4TX4 A;  3S27 A;  1OGX A;  2XGN A;  4BTY A;  1N9J A;  3ALA A;  3AMO B;  5KP3 A;  8CHO A;  1GY6 A;  1T5Y A;  1IV9 A;  1IVV A;  1Q40 B;  1BRI A;  5KP4 A;  3EB8 A;  1IVW A;  2CW9 A;  2P09 A;  3CC7 3;  4G1M B;  2BIR A;  3CCR 3;  3KSE D;  2OCT A;  2HOH A;  2KCD A;  1BAN A;  1IK3 A;  1BNG A;  4HVN A;  3K5T A;  3MPH A;  4KVH A;  5IG3 A;  1JN5 A;  2KF6 A;  2BHM A;  2RCD A;  1EG9 B;  3N9H A;  1RN1 A;  3V98 A;  1B2M A;  2MC8 A;  2BNG A;  4R9K A;  3T8U A;  3CCJ 3;  1JBT A;  3CC4 3;  2E2U A;  3CME 3;  1VQK 3;  4N6U A;  1VQ7 3;  4XBX A;  1FW7 A;  1W6C A;  3DMC A;  1RCK A;  3IMA B;  1VQ6 3;  3BB9 A;  2XGL A;  3WOF B;  1O7H B;  4FMD A;  3B4P A;  1BSD A;  1F8N A;  1DMQ A;  1MOL A;  4O8S A;  1DVD A;  1BSE A;  1UGI A;  4LYL B;  3FLJ A;  1JNQ A;  2LYX A;  3JUM A;  3U1W A;  1BNR A;  5IG5 A;  3IJE B;  4NHF A;  1IDP A;  3DXO A;  1RGK A;  3EJV A;  3T8N A;  3KN4 A;  3UL5 A;  9RNT A;  2CHC A;  2P38 A;  1I3F A;  2F4Y A;  1GOV A;  3ECF A;  2F99 A;  2WOF A;  3N54 B;  3S67 A;  4MMZ B;  4K1U A;  1B21 A;  2P05 A;  3MHE A;  3EQQ B;  2XH9 A;  1YVS A;  2F86 B;  1VQ4 3;  4DKI A;  1JB2 A;  2AAD A;  1TFK A;  3KSP A;  1MWS A;  2IMJ A;  3LML A;  2UUG C;  5RNT A;  2BU4 A;  2O3O A;  2HMN B;  1TRP A;  4RZM A;  1MWT A;  2MF7 A;  3GWR A;  3CD6 3;  1FZU A;  1TFO A;  1O7M B;  3DGN A;  1LXE A;  2KF3 A;  4EW5 A;  4MJD A;  4FCZ A;  3D5I A;  4XBY A;  1RTU A;  8RNT A;  1UCI A;  4RNY A;  4N6N B;  1RRH A;  2W2C A;  1YGE A;  3LH4 A;  1DE3 A;  2BMR B;  1W2B 2;  2IA7 A;  3FSD A;  3HI7 A;  1IVU A;  1RNB A;  1WMP A;  1FUS A;  2AAE A;  2ZDJ A;  5HGR A;  1MNL A;  2KRT A;  3BU4 A;  4HM2 B;  3CCM 3;  2ML5 A;  2OTJ 3;  3JUO A;  4IPB A;  1JB4 A;  1V57 A;  3VGN A;  4MMX B;  1KC8 4;  3K9M C;  3FKA A;  2L4V A;  4RNZ A;  1ROA A;  4WYK A;  2LQV A;  2CG1 A;  3CXC 2;  1LQM B;  1X1W A;  2BMQ B;  1D6Y A;  2CC3 A;  4QWT A;  4RBN A;  1CQS A;  1JZD A;  1NU3 A;  1MWR A;  2F5M A;  3NXJ A;  4O02 B;  5D83 A;  3WHO A;  1AY7 A;  1NB5 I;  4K61 A;  4CJN A;  3GSP A;  2OQE A;  1YJW 3;  1JKG B;  3NQY A;  1LOW A;  2Q07 A;  5AIG A;  1W4N A;  4BL2 A;  3WOE B;  2B1X B;  4N6V 0;  1A2K A;  1TTO A;  1OF5 B;  2XF3 A;  5ELJ A;  1EKM A;  5DRE A;  2CFK A;  2YX9 A;  1BRG A;  2BMO B;  4WHA A;  3JVC A;  5M19 A;  3B7C A;  5CLK A;  2INX A;  5I97 A;  4CCV A;  3BNE A;  2ZHX B;  4XM4 A;  1EA2 A;  3GZR A;  1RGH A;  2CWV A;  1B2U A;  1LOY A;  2H0I A;  2OOV C;  1U8C B;  3GAX A;  4FMB A;  4LMI A;  5AEU B;  4GHO A;  1RDS A;  3DGO A;  1A67 A;  5AI1 A;  2Z7A A;  1RGC A;  1BNJ A;  1SJW A;  2IUK A;  5LC6 A;  3G8Z A;  5IG4 A;  3F40 A;  4OK0 A;  4BIR A;  1VQP 3;  3CCV 3;  1RGE A;  1I8V A;  3SOA A;  2OTL 3;  1GMR A;  1FGR A;  3BIR A;  1STD A;  2KF4 A;  3DGL A;  1TU5 A;  1A2P A;  4FMC A;  3NV0 B;  1IQ8 A;  3HIG A;  4ZM8 A;  4I5Q A;  1W00 A;  2XFS A;  4N6T A;  4LSO A;  2CFD A;  1VQN 3;  1W01 A;  2F5W A;  3BNB A;  2HMJ B;  1EEJ A;  4CDL A;  2A15 A;  2W03 A;  3AHW A;  3UNL A;  5KP1 A;  2BT3 A;  3RGR A;  1A90 A;  2XRX B;  2WGO A;  4KFD A;  2UX0 A;  3BNC A;  3ZG0 A;  1W7C A;  2H0G A;  4KZ1 A;  5AYS C;  3X40 A;  1IQX A;  2HMK B;  3E99 A;  5D82 A;  4HZ9 B;  1HYF A;  3DUK A;  1PFP A;  1B20 A;  3N8B A;  3F7S A;  1UUW B;  1RGA A;  2RGQ A;  3D4A A;  1UGH I;  4CPK A;  1JN5 B;  2YFI B;  1I2F A;  3OWY A;  1RRL A;  4HBR A;  1YHQ 3;  1QJG A;  1T2I A;  2PNC A;  3OX9 A;  5IG0 A;  1YJ9 3;  1ULJ B;  1Z1S A;  1I70 A;  1NJI 4;  3MWZ A;  3F9S A;  2GU3 A;  3AMO A;  1RN4 A;  3LZA A;  1WTH A;  2RFR A;  4J5G A;  1RLS A;  1MGW A;  2CFG A;  3LYG A;  2KXG A;  3J7Y d;  3A5E A;  2FNQ A;  3ZG5 A;  4L8O A;  3PXM A;  1W02 A;  2C11 A;  1UUV B;  1VQ9 3;  5M1A A;  1YJN 3;  3PS8 A;  1PU4 A;  3NX0 A;  4N3V A;  4X2O A;  6RNT A;  2GXF A;  4HM7 B;  1GYB A;  4AKY A;  1UCL A;  5M18 A;  3PZW A;  1BSA A;  3LXU X;  3X42 A;  3K7C A;  1C7H A;  3LT8 A;  2W9Q A;  3K0Z A;  2SBL A;  3V99 A;  3EBT A;  2D42 A;  3MSO A;  1G96 A;  4XDW A;  1TIJ A;  1VQQ A;  3NBB A;  2CX1 A;  3VSY A;  1CH0 A;  1RGF A;  3GRD A;  3F8X A;  3UL6 A;  1GOY A;  3RDE A;  5AYR B;  4X2H A;  3PGB A;  1OAC A;  1EUI C;  1RN7 A;  3A76 A;  3OWU A;  1X1U A;  1LQG C;  3EE1 A;  1JBS A;  1VQ8 3;  3DZL A;  3G71 3;  3D79 A;  1RGL A;  3CMA 3;  2L1S A;  3NUV A;  2XEP A;  3BLZ A;  3UJM A;  3FG4 A;  5AEW B;  1IT8 A;  3DM8 A;  3PCR A;  5AIF A;  1WMN A;  1AV4 A;  4R9L A;  4BTW A;  4EC6 A;  1IYY A;  1M90 4;  5HOH A;  1BRN L;  3B4O A;  2P0X A;  3CPO A;  3D5G A;  1O7G B;  1MWU A;  1E3R A;  2D1W A;  3SVA A;  3I56 3;  1M1K 4;  5IER A;  1E97 A;  1N9E A;  1OPY A;  3WOD G;  3D9R A;  5CF2 A;  4AEQ A;  2QA4 3;  5CXO A;  3BND A;  1K41 A;  1TRQ A;  2OOV A;  3X3X A;  1Q82 4;  3CCU 3;  3FZW A;  1V74 A;  4FCJ A;  3HII A;  3G16 A;  1D6U A;  4N6M A;  4AKZ A;  4BTX A;  1KD1 4;  2O9U X;  3F7X A;  1O7P B;  2GEX A;  1I2G A;  2CIU A;  3GZY B;  3WA2 X;  3OXA A;  1N8R 4;  1US1 A;  1LVN A;  7STD A;  1JRQ A;  3ER7 A;  4IT7 A;  4XBT A;  2RSX A;  1VZZ A;  3CCS 3;  4HM6 B;  1BUQ A;  4ILF A;  3URP A;  1Q7H A;  1NWW A;  1RCL A;  2Y73 A;  2Z77 A;  3HOH A;  3G6E 3;  1FA3 A;  4HZB B;  1Q9E A;  1DYU A;  3O8Y A;  1Q86 4;  1WQL B;  1RMS A;  3FF0 A;  3VF1 A;  3Q1C A;  3EN1 B;  4HOH A;  4EV5 A;  3MG2 A;  1IVX A;  3NBJ A;  3SOY A;  4O3V A;  1SIH A;  1TJD A;  1W5Z A;  1QAK A;  1LNI A;  2ZL8 A;  3EF8 A;  5JPP A;  3CCQ 3;  4OVM A;  1U5O A;  1YI2 3;  1OGZ A;  1SQW A;  3NBR A;  4FMA A;  5AIH A;  1IT7 A;  1IQY A;  2JDI H;  5TGN A;  1JB5 A;  1L5G B;  4FR9 A;  2K0M A;  5D81 A;  1C54 A;  3EN8 A;  1BNF A;  1N5H A;  1M1X B;  3OW2 2;  4MEI A;  1BSB A;  1Q7Y 4;  4K90 B;  1BAO A;  3QRD A;  1BRK A;  3EC9 A;  4KFE A;  3DY5 A;  2W9P A;  1BUJ A;  1JBR A;  2V1L A;  3GZX B;  2KF5 A;  5ELU A;  1ROV A;  4XDV A;  3U97 A;  1NB3 I;  4RNT A;  5EQL A;  5A0O B;  2M7O A;  1CYV A;  2GU1 A;  5IEN A;  1OF5 A;  4J5K A;  1AVK A;  2F56 A;  1BNI A;  4R1K A;  2K3D A;  2CWU A;  5BU4 A;  2HMO B;  1ZX2 A;  2UGI A;  1DVC A;  3UB1 A;  5JPU A;  1I0X A;  5FGO A;  1NDO B;  3JUP A;  3M8C A;  1RSN A;  1W6G A;  3CNM A;  4PEJ A;  1CYU A;  3LTC A;  3V92 A;  1X1X A;  3OV4 A;  1GD3 A;  2W56 A;  1GY7 A;  1R4Y A;  1BNE A;  3L0R A;  3HZP A;  1UUG B;  2STD A;  2W0Q A;  1LRA A;  4EBG A;  2P0M A;  2QIY A;  1K73 4;  1VQ5 3;  1SII A;  1YVB I;  4HM8 B;  1D6Z A;  2HMM B;  3WR2 A;  1O7N B;  1TUH A;  2QEX 3;  4HKV B;  1KQS 2;  1ASK A;  1SAR A;  1NNV A;  3DGM A;  4WFO A;  1FGQ A;  3F8H A;  3K63 A;  3LTA A;  1S72 3;  1NO3 A;  1S5A A;  2GSP A;  4R4K A;  3G0K A;  4EV2 A;  3SED A;  1YIJ 3;  2OQE C;  5G1L A;  5AII A;  4HAA A;  1BRS A;  1DMN A;  1GD4 A;  3KZT A;  2PZV A;  1O7W B;  3STD A;  4GB5 A;  4KT3 B;  3LTD A;  1UI7 A;  6GSP A;  4R80 A;  1Q40 A;  4GL6 A;  3WA3 A;  1JZO A;  1RGG A;  1HU9 A;  1Q42 A;  4U13 A;  3HX8 A;  1SPU A;  3WDG B;  1RKY A;  1I0V A;  3Q2P A;  4FCM A;  5IF6 A;  2W04 A;  2GEY A;  4NRE A;  1LNH A;  1UI8 A;  3AHS A;  3WMD A;  3QK9 A;  1HKX A;  3KCH A;  1LOV A;  4HM5 B;  4K1V A;  4LGQ A;  1AQZ A;  3FG1 A;  1ISK A;  5EVH A;  1KSI A;  1EQK A;  1B2X A;  3NM7 A;  1BIR A;  4HJL B;  3FF2 A;  2YFL B;  1VQM 3;  1GS3 A;  3MG3 A;  3FGY A;  4H61 A;  4L8P A;  5G2G A;  1UCJ A;  2CG0 A;  5IEO A;  1W6Y A;  3Q90 A;  4BL3 A;  1FUT A;  2I9W A;  4H3U A;  5IEP A;  3I55 3;  1QVG 2;  2YFJ B;  1DMM A;  1DET A;  4HM0 B;  2QGU A;  4J9A A;  4O2H A;  2C10 A;  4WWU C;  1G0T A;  2CH9 A;  4N6O B;  3SXX A;  1A2V A;  1AR0 A;  1W2Z A;  4I4K A;  2FXT A;  4LZI A;  4JF8 A;  4HYZ A;  1J2B A;  7RNT A;  4Q53 A;  2R4I A;  2C4B A;  2H0H A;  1BVI A;  1PY3 A;  1ZGX A;  1YIT 3;  2R41 A;  1GMQ A;  5FW5 A;  2CX0 A;  3LTB A;  2KAA A;  1BOX A;  4JRF A;  1QMA A;  4STD A;  4LEH A;  3X3Z A;  5DRV A;  7GSP A;  3S29 A;  1N8Q A;  1YGW A;  3H51 A;  3NHX A;  5BIR A;  1AVL A;  1ZO2 A;  4IIA A;  2J8X B;  2ML6 A;  3X41 A;  2CFL A;  1FGO A;  1I2E A;  2CK3 H;  5CF1 A;  1JV2 B;  1UW1 A;  3RNT A;  1T2H A;  3I0Y A;  2IYJ A;  2CWT A;  3D3L A;  1FUW A;  1ULI B;  1N5P A;  2IY2 A;  1B27 A;  2FGT A;  3KKG A;  3KII A;  3PYJ A;  1QVF 2;  1B3S A;  3RGA A;  1MGR A;  1T3B A;  1RNT A;  4OUQ A;  1UCK A;  1QAF A;  3SYU A;  1OH0 A;  3EHC A;  4BU4 A;  2SAR A;  1JJ2 2;  1CEW I;  3TDG A;  3AGO A;  4NPB A;  4WYK B;  1IV7 A;  4WP5 A;  1X1Y A;  5IW9 A;  1V58 A;  1PYL A;  1VQL 3;  3G4S 3;  3DGY A;  1RJO A;  1K28 A;  3CPW 2;  3MYT A;  4GSP A;  4L7K A;  1BSC A;  2E2V A;  1BGS A;  3S28 A;  2Y74 A;  3CU3 A;  1Q81 4;  1B2Z A;  3MG1 A;  2HML B;  2WOH A;  2XSH B;  3DH2 A;  5JBS A;  1E3V A;  3Q3F A;  1Y4K A;  3CC2 3;  5GSP A;  3B8L A;  5G1K A;  1HZ1 A;  1WNH A;  2GBX B;  2OWP A;  1YNV X;  3LOY A;  3ROB A;  2RNT A;  5BVB A;  1K8A 4;  1R4C A;  3JUQ A;  2XR8 B;  1OHO A;  1BRJ A;  1GOU A; 
#chains in the Genus database with same CATH homology
 1R4Y A;  1BNE A;  1LRA A;  5RNT A;  2BU4 A;  1TRP A;  3WR2 A;  1FZU A;  1B2S A;  1SAR A;  2KF3 A;  6RNT A;  1BNS A;  3D5I A;  1RTU A;  1UCL A;  2GSP A;  8RNT A;  1UCI A;  1BSA A;  1FYS A;  4HAA A;  1BRS A;  1DE3 A;  1RNB A;  1FUS A;  2AAE A;  1I3I A;  6GSP A;  1CH0 A;  1GMP A;  1BU4 A;  1RGF A;  3BU4 A;  1GOY A;  1RGG A;  1X1U A;  1I0V A;  2RBI A;  1JBS A;  1GSP A;  1RGL A;  3AHS A;  1X1W A;  3KCH A;  1LOV A;  2F5M A;  3WHO A;  1AY7 A;  1AQZ A;  1IYY A;  3GSP A;  5HOH A;  1BRN L;  1B2X A;  1BIR A;  1LOW A;  3D5G A;  1G02 A;  2ZA4 A;  1TTO A;  1RHL A;  3AGN A;  1BRH A;  1BRG A;  1UCJ A;  1TRQ A;  1FUT A;  1BRI A;  1DET A;  1RGH A;  1B2U A;  1LOY A;  2BIR A;  1I2G A;  4GHO A;  1RDS A;  2HOH A;  7RNT A;  1BAN A;  1RGC A;  1BNJ A;  1BNG A;  2C4B A;  1BVI A;  1PY3 A;  1ZGX A;  3URP A;  4BIR A;  1GMQ A;  1RCL A;  1RGE A;  1BOX A;  1I8V A;  2KAA A;  3HOH A;  1GMR A;  3BIR A;  1Q9E A;  2KF4 A;  7GSP A;  1A2P A;  2KF6 A;  1YGW A;  5BIR A;  1RMS A;  1RN1 A;  1I2E A;  2F5W A;  4HOH A;  3RNT A;  1B2M A;  1T2H A;  1LNI A;  1JBT A;  3AHW A;  1B27 A;  1B3S A;  1MGR A;  3SYU A;  1RNT A;  1UCK A;  1FW7 A;  1C54 A;  1RCK A;  1BNF A;  4BU4 A;  2SAR A;  1BSB A;  1HYF A;  1BSD A;  3AGO A;  1B20 A;  1BAO A;  1BSE A;  1X1Y A;  1BRK A;  1PYL A;  1RGA A;  3DGY A;  3D4A A;  1BUJ A;  1BNR A;  1JBR A;  2KF5 A;  4GSP A;  1BSC A;  1BGS A;  4RNT A;  1I2F A;  1RGK A;  1T2I A;  1B2Z A;  4J5K A;  9RNT A;  2F56 A;  1BNI A;  5BU4 A;  3DH2 A;  1I70 A;  1I3F A;  2F4Y A;  1GOV A;  3Q3F A;  5GSP A;  1HZ1 A;  1I0X A;  1RN4 A;  1YNV X;  1B21 A;  4J5G A;  1RSN A;  1RLS A;  2RNT A;  1MGW A;  1X1X A;  1YVS A;  3A5E A;  2AAD A;  1BRJ A;  1GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...