1AY7A

Ribonuclease sa complex with barstar
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (enzyme/inhibitor)
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Recognition of RNase Sa by the inhibitor barstar: structure of the complex at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 24
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ay7A00
1X1YA 1RGKA 1RN1A 1G02A 1GMQA 2KF5A 1GMPA 2F56A 1BSBA 1I3FA 1YGWA 1I2GA 2GSPA 1RGEA 3KCHA 1I8VA 4HOHA 1BGSA 1Q9EA 3SYUA 1C54A 2RNTA 1RGFA 1I2EA 1X1XA 1BNGA 1BNSA 1B20A 1GSPA 1T2IA 1RGLA 1AQZA 2KF3A 5BU4A 3D5IA 1BNIA 1LOYA 2F4YA 1GOUA 7GSPA 1B2SA 3HOHA 1IYYA 1TRQA 1LRAA 1GOVA 1X1WA 3AHWA 1FUTA 2AAEA 3D5GA 4J5GA 1MGRA 1JBTA 5RNTA 2AADA 1T2HA 1JBRA 1BU4A 1BUJA 1BSCA 2SARA 8RNTA 1B2ZA 1BNEA 2KAAA 3WHOA 1I2FA 2F5WA 1BSDA 4GHOA 5GSPA 1X1UA 1I0VA 1I70A 1BRHA 1DE3A 1B2UA 9RNTA 1YVSA 1RHLA 1RDSA 3AGOA 1BRNL 1BNRA 1RCLA 2F5MA 1FYSA 1MGWA 2RBIA 1BOXA 1FUSA 1B3SA 1RNBA 1B2MA 1BRKA 3GSPA 3A5EA 3RNTA 3DGYA 1RNTA 1B21A 2BU4A 1LOVA 2ZA4A 1RCKA 1BIRA 1BRGA 1FZUA 6GSPA 6RNTA 1BRIA 1I3IA 1AY7A 4RNTA 1BSEA 1RGHA 1BAOA 3URPA 3AHSA 3BU4A 1BRSA 1HZ1A 1RLSA 1RN4A 2BIRA 1UCLA 1FW7A 2HOHA 1BRJA 1GOYA 1YNVX 1BVIA 4BIRA 3Q3FA 2C4BA 1RMSA 4GSPA 1GMRA 1BNJA 1TRPA 1UCIA 2KF6A 4HAAA 1HYFA 1RGCA 1BANA 7RNTA 3DH2A 1DETA 1RGAA 5HOHA 1CH0A 1PYLA 1A2PA 1TTOA 1RGGA 1UCKA 1PY3A 3WR2A 5BIRA 2KF4A 4BU4A 1R4YA 1I0XA 3BIRA 1B2XA 1LNIA 3D4AA 1RTUA 1ZGXA 4J5KA 1SARA 1B27A 1UCJA 1RSNA 1JBSA 1BNFA 1LOWA 3AGNA 1BSAA
chains in the Genus database with same CATH superfamily
1ASKA 2UUGC 3DGMA 4GL6A 1RRLA 2F56A 1BSBA 3IJEB 5IF6A 3Q1CA 1EG9B 2M7OA 2XSOB 1I8VA 3KCHA 2HMNB 4ZM8A 3EN8A 2CG1A 1Q40B 2RNTA 3A76A 1JKGA 1VZZA 3EQQB 1I2EA 2CFDA 2GU3A 3K7CA 4XBXA 4PEJA 3N9HA 1J2BA 2XRXB 1RKYA 1F8NA 2XR8B 1VQM3 4X2OA 3ROBA 3FKAA 3PYJA 1OGXA 1LOYA 4MEIA 1GOUA 4R80A 5M1AA 3UNLA 3CPW2 3LYGA 1OF5A 5CXOA 4BTWA 2QIYA 1ZO2A 1Q7HA 3WMDA 3ZG0A 2CC3A 4WYKA 3S27A 3I563 1Q814 1IYYA 3HIIA 3S29A 1VQ83 1KWIA 2MC8A 3OX9A 1VQP3 3O8YA 1LXEA 1CQSA 1CYUA 3KFQC 1Y4KA 1FUTA 1UI7A 3D5GA 1ROVA 3MWZA 5RNTA 3VSYA 4ILFA 1JBRA 2CWVA 2E2VA 3E99A 1AR0A 2Y73A 2ZHXB 1FGRA 2OOVA 1LOXA 8RNTA 2KAAA 1W2B2 4LGQA 2LYXA 2Z77A 3CXC2 1I2FA 1NNVA 3CMA3 1BSDA 1ULJB 4N6V0 4GHOA 1IVVA 1HKXA 1I0VA 4L8PA 1I70A 1DMNA 5TGNA 1BUQA 3FZWA 1ROAA 2WOFA 2BHMA 5AI1A 1B2UA 5LC7A 9RNTA 3PXMA 1A2VA 2B24B 4FCJA 4LSOA 1YIJ3 1BRNL 4IPBA 1UW1A 4WFOA 2W04A 1VQN3 1EKMA 2CWUA 3N8BA 1FUSA 1B3SA 1BRKA 2BMOB 1OH0A 4CPKA 3CCU3 4K90B 1AVLA 3G6E3 1B21A 3CC23 1LOVA 3I553 4J9AA 5IENA 3K63A 1E97A 3AMOB 2CG0A 3LOYA 1NU3A 1Q40A 1QALA 1T3BA 1U5OA 5IW9A 1WMNA 3NM2A 4BL3A 3ER7A 4FMDA 1SIHA 2Z7AA 3DXOA 2V1LA 1KD14 1N5HA 1FW7A 1FGTA 3G713 1V58A 4RBNA 3BNBA 4HM7B 4X2HA 5LC6A 5JBSA 1YI23 2QEX3 3OWSA 5JPPA 1Q42A 2PZVA 1TP6A 4N6OB 1UI8A 2F98A 2WGOA 5CK6A 1W01A 2KF6A 3UJMA 7RNTA 1A67A 3MKIA 4N6NB 3T0UA 4WHAA 5AYSC 1CH0A 1IK3A 3LH4A 1UCKA 2P09A 5G1KA 1MWRA 1PY3A 4RNZA 1V57A 3MG1A 2XSHB 4HJLB 3KKGA 1UUGB 4XM4A 1O7GB 3RDEA 1R4YA 1TU5A 2CX0A 1RRHA 1WNHA 2INXA 3D4AA 3FH1A 3WDGB 3NQYA 4J5KA 4KFDA 3FSDA 4H3UA 2GXFA 5AEUB 2Z6BA 5G1LA 3AGNA 3DUKA 3JUMA 5KP4A 1DMMA 2GEYA 4L7KA 3OWUA 4N6LA 1PU4A 1X1YA 1GD3A 1IT8A 1GMQA 1GMPA 1NDOB 4IT7A 3V92A 5AIGA 2BNGA 1I3FA 3N54B 3CCL3 1YGWA 3G0KA 1T5YA 1ZS7A 3NUVA 1Q9EA 4KT3B 2Z76A 3RGAA 3WOFB 1C54A 3F8HA 4FMCA 1RGFA 2F86B 3JVCA 4WWUC 3WA3A 1AV4A 2QA43 1B20A 1US1A 2JQ5A 3GZBA 3SVAA 1YIT3 1N5PA 3AMOA 3H51A 4EYCA 3FGYA 1IVUA 3CCQ3 3LXUX 3B4OA 4LZIA 1BNIA 2GEXA 2F4YA 1DMQA 1R4CA 3CU3A 3NBJA 3UL5A 7GSPA 4NHFA 2P38A 2KRTA 1VQ43 1QVG2 4MMYB 1VQQA 3K9MC 4R1KA 1ZX2A 2HMKB 3HIGA 4R9LA 1LRAA 4EC6A 1GOVA 3CCM3 1K28A 1TUHA 3FF2A 3H3HA 1X1WA 3OXAA 2IUJA 3S28A 2XEPA 2AAEA 1W7CA 3EF8A 4J5GA 1PFPA 4K1UA 2OQEC 1OACA 1OCVA 1MOLA 1T2HA 1W6CA 2HMMB 5DRVA 2STDA 4HM6B 1LVNA 2CK3H 1IQXA 2GU1A 2ZL8A 3QK9A 3UL6A 3NXJA 2RGQA 2JDIH 1B2ZA 4MJDA 1C7HA 2K0MA 2F5WA 3EBTA 4EV2A 3DM8A 1FUWA 1BRHA 5FGOA 1AVKA 2H0GA 2H0IA 2J8XB 1MWSA 1QJGA 3K5TA 2KCDA 1N8QA 3SLUA 3HZPA 1JV2B 1JNQA 2RBIA 1G96A 1OGZA 3EHCA 5KP1A 8CHOA 3LTDA 1RNBA 2HMLB 1B2MA 4HM2B 1SPUA 3RNTA 3OW22 4HM4B 3V98A 2B1XB 1S5AA 3PGBA 3OWYA 1TFOA 2RCDA 2P0XA 3EB8A 2GBWB 4N6MA 4O02B 2W9PA 1A2KA 1KQS2 2C10A 1I3IA 3F8XA 3WA2X 3OV4A 4IIAA 2W03A 1BAOA 2E2TA 4O3VA 3AHSA 4G1MB 1TFKA 2Q07A 3EE1A 4H61A 1RLSA 1RN4A 4FCZA 3M8CA 3DGOA 3G4S3 1JN5B 1UCLA 1BRJA 4JF8A 1GOYA 1QMAA 2WOHA 3Q2PA 3D79A 5AYRB 1O7WB 1KC84 5KP3A 3LT9A 1RMSA 1GMRA 3CNMA 2OTL3 1JZDA 2P05A 3X41A 4HAAA 1K8A4 1BANA 2BMQB 1RGAA 2R41A 1W2ZA 3WODG 3FG4A 1IV9A 1A2PA 1O7MB 1NJI4 3KIIA 1LQMB 3STDA 4KZ1A 3HX8A 2KF4A 3IPTA 5G2GA 5IG0A 5IERA 4LMIA 3CNXA 3TDGA 4BU4A 4FMBA 1LNIA 1VQ93 1IQ8A 1JB5A 3SOAA 2OCTA 3CCS3 4FR9A 1RSNA 4CCVA 4EBGA 1N9JA 4KVHA 4GB5A 3BNDA 3CPOA 1EEJA 2E2UA 3F9SA 1YJ93 1ULIB 2O9UX 4WP5A 1FGQA 1RN1A 2HMJB 2XGLA 1K734 3BB9A 1DVCA 1SJWA 1I2GA 2GSPA 1RGEA 4HOHA 4OVMA 2UX0A 2GBXB 3FLJA 4I4KA 3NBBA 3SYUA 4N6TA 1GYBA 2W56B 1X1XA 4K1VA 1DYUA 4HM8B 1L5GB 3SOYA 5STDA 3GZRA 4RNYA 3DMCA 1VQ53 2YX9A 1T2IA 3CC43 1AQZA 5A0OB 1OHPA 3KZTA 3DY5A 5CF1A 2OTJ3 2BMRB 2QGUA 1B2SA 1M904 2WO0A 2XF3A 3HOHA 1TRQA 1JN5A 3CCV3 4U13A 5I97A 3BLZA 1MGRA 3U1WA 2IMJA 3F14A 3B4PA 5EQLA 1IVXA 3RGRA 1JBTA 1W5ZA 1DVDA 4J8TA 1BUJA 3S5CA 1STDA 1QVF2 5DREA 3JUPA 2ML6A 5IEPA 2ML5A 4KFFA 3WHOA 2L4VA 1YJW3 1CEWI 3D9RA 5JPUA 3NM7A 3CD63 3FG3A 4HZ9B 2CHCA 2LQVA 1DE3A 4HM1B 3VF1A 2XFSA 1RHLA 1W00A 1RDSA 2H0HA 4OUQA 2F5MA 1FYSA 1MGWA 1BOXA 1TIJA 4EW5A 1WMOA 3LZAA 3A5EA 3I0YA 3PCSA 4R9KA 5AEWB 1A90A 1RNTA 1JB2A 2P0MA 3ZG5A 2BU4A 3S67A 1JB4A 3GAXA 2FNQA 2ZA4A 2OQEA 1RCKA 5M19A 5AIIA 4XB5A 3CCJ3 1WQLB 3L0RA 1K9M4 1NO3A 1N9EA 6GSPA 3J7Yd 1NB5I 1FGOA 4FCMA 5HGRA 2IY2A 1AY7A 2A15A 4KFEA 4RNTA 1OUNA 2W56A 1O7NB 2W6JH 3NV0B 1CYVA 1LNHA 4N6UA 4QWTA 5IG4A 1GY7A 2CFGA 3ZFZA 3PCRA 1GY5A 3D3LA 1WMPA 3NQZA 1FGMA 1OHSA 4HKVB 2CFKA 2BIRA 1RN7A 5AIFA 4LEHA 1YNVX 1BVIA 4TX4A 4BIRA 3MG3A 4HBRA 4EV5A 3Q3FA 4AEQA 6STDA 2C4BA 4GSPA 3T8UA 4HVNA 2YFJB 1UCIA 1GS3A 1YGEA 5ELJA 3V99A 1M9GA 4LYLB 1HYFA 3Q90A 3QRDA 3JUQA 2FXTA 1EQKA 3DH2A 1DETA 2Y74A 3F7XA 5IG3A 4L8OA 1TTOA 1IQYA 1RGGA 3GZXB 3F40A 1IU7A 2XFTA 3CC73 2IUKA 3WR2A 2W2CA 5BIRA 1GY6A 2MF7A 1IV7A 2XGNA 1E3RA 3MYTA 2UGIA 4XBYA 3MPHA 1I0XA 1JJ22 3BIRA 1RJOA 1B2XA 1UGHI 1YHQ3 1RTUA 4I5QA 1FA3A 1WTHA 3FG1A 3KN4A 5IEOA 5AIHA 3SX1A 3KSPA 2CWTA 1RGKA 1G02A 2KF5A 1MNLA 2K3DA 4BTYA 1M1K4 3DGLA 2SBLA 3DZLA 3JUOA 1YJN3 1UDII 2IA7A 1BGSA 3EJVA 3FCSB 1D6YA 3CCR3 4K61A 1GD4A 5BVBA 1JRQA 3EN1B 3KSED 3LTAA 3T8NA 2FGTA 4RZMA 3NBRA 4OK0A 1IT7A 1JBSA 7STDA 2BT3A 1BNGA 2ZDJA 2OOVC 4N3VA 1BNSA 1M1XB 3CCE3 1SIIA 1O7HB 1UUWB 3K0ZA 1SQWA 1UGIA 1GSPA 3ALAA 1RGLA 3EBYA 2KF3A 3IMAB 3PS8A 2W0QA 3ECFA 3EC9A 5BU4A 3HI7A 5BXQA 1W6YA 2I9WA 3D5IA 2IYJA 3NV0A 4NREA 4HM0B 1VQO3 3DGNA 1S723 1HU9A 3MHEA 3MSOA 1OHOA 4DKIA 4Q53A 1Q7Y4 1NB3I 2BO9B 3AHWA 3NHXA 2CIUA 3B7CA 4R4KA 4NPBA 2AADA 1O7PB 3JUNA 4EXRA 3X3YA 1BU4A 4BL2A 3B8LA 2YFLB 5D81A 2O3OA 2D42A 1BSCA 1G0TA 4BTXA 2SARA 1BNEA 1TJDA 5GSPA 1X1UA 3LT8A 1U8CB 4XBTA 2PNCA 1IVWA 4ORLA 1VQK3 2HMOB 1YVSA 3G8ZA 1D6UA 4HM3B 2CH9A 4HZBB 4XDWA 3AGOA 5CF2A 3X3ZA 1BNRA 1RCLA 2XH9A 2CFWA 2C11A 4STDA 3CME3 4HM5B 5D83A 2K54A 3GSPA 4XDVA 1JKGB 3EX9A 2RFRA 2CX1A 3DGYA 3LTCA 5D82A 2YFIB 1ISKA 3VGNA 3SXXA 5ELUA 1KSIA 1W4NA 1BIRA 2RSXA 1BRGA 1FZUA 2D1WA 4HYZA 4JRFA 3X40A 6RNTA 1BRIA 1D6ZA 2CKFB 5IG5A 3GZYB 2L1SA 3F7SA 1NWWA 1MWUA 1BSEA 1RGHA 2R4IA 2F99A 3URPA 5M18A 1Z1SA 3BU4A 3BNCA 5EEOA 1MWTA 1BRSA 1OF5B 1HZ1A 2OWPA 4WYKB 5FW5A 2HOHA 1N8R4 1EUIC 1OPYA 1E3VA 4MMXB 1LQGC 1W6GA 3LMLA 1Q864 2CW9A 4FMAA 1BNJA 1TRPA 3PZWA 1BSAA 2KXGA 5EVHA 1RGCA 1VQL3 3G16A 3UB1A 3GWRA 1JZOA 3HK4A 3U97A 2WGQA 5HOHA 4MMZB 3BNEA 1PYLA 1YVBI 3GRDA 3SEDA 4AKYA 4CDLA 3X3XA 1UUVB 1VQ63 1IDPA 1K41A 1Q824 3NX0A 1W02A 1EA2A 4O2HA 2W9QA 3FF0A 3KE7A 4AKZA 1STFI 1ZGXA 1SARA 1B27A 1UCJA 3MG2A 4O8SA 1QAKA 5CLKA 1BNFA 1LOWA 2CFLA 3LTBA 3WOEB 1QAFA 3X42A 4CJNA 1VQ73 1V74A
chains in the Genus database with same CATH topology
1X1YA 1RGKA 1RN1A 1G02A 1GMQA 2KF5A 1GMPA 2F56A 1BSBA 1I3FA 1YGWA 1I2GA 2GSPA 1RGEA 3KCHA 1I8VA 4HOHA 1BGSA 1Q9EA 3SYUA 1C54A 2RNTA 1RGFA 1I2EA 1X1XA 1BNGA 1BNSA 1B20A 1GSPA 1T2IA 1RGLA 1AQZA 2KF3A 5BU4A 3D5IA 1BNIA 1LOYA 2F4YA 1GOUA 7GSPA 1B2SA 3HOHA 1IYYA 1TRQA 1LRAA 1GOVA 1X1WA 3AHWA 1FUTA 2AAEA 3D5GA 4J5GA 1MGRA 1JBTA 5RNTA 2AADA 1T2HA 1JBRA 1BU4A 1BUJA 1BSCA 2SARA 8RNTA 1B2ZA 1BNEA 2KAAA 3WHOA 1I2FA 2F5WA 1BSDA 4GHOA 5GSPA 1X1UA 1I0VA 1I70A 1BRHA 1DE3A 1B2UA 9RNTA 1YVSA 1RHLA 1RDSA 3AGOA 1BRNL 1BNRA 1RCLA 2F5MA 1FYSA 1MGWA 2RBIA 1BOXA 1FUSA 1B3SA 1RNBA 1B2MA 1BRKA 3GSPA 3A5EA 3RNTA 3DGYA 1RNTA 1B21A 2BU4A 1LOVA 2ZA4A 1RCKA 1BIRA 1BRGA 1FZUA 6GSPA 6RNTA 1BRIA 1I3IA 1AY7A 4RNTA 1BSEA 1RGHA 1BAOA 3URPA 3AHSA 3BU4A 1BRSA 1HZ1A 1RLSA 1RN4A 2BIRA 1UCLA 1FW7A 2HOHA 1BRJA 1GOYA 1YNVX 1BVIA 4BIRA 3Q3FA 2C4BA 1RMSA 4GSPA 1GMRA 1BNJA 1TRPA 1UCIA 2KF6A 4HAAA 1HYFA 1RGCA 1BANA 7RNTA 3DH2A 1DETA 1RGAA 5HOHA 1CH0A 1PYLA 1A2PA 1TTOA 1RGGA 1UCKA 1PY3A 3WR2A 5BIRA 2KF4A 4BU4A 1R4YA 1I0XA 3BIRA 1B2XA 1LNIA 3D4AA 1RTUA 1ZGXA 4J5KA 1SARA 1B27A 1UCJA 1RSNA 1JBSA 1BNFA 1LOWA 3AGNA 1BSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1Y A;  1RGK A;  1RN1 A;  1G02 A;  1GMQ A;  2KF5 A;  1GMP A;  2F56 A;  1BSB A;  1I3F A;  1YGW A;  1I2G A;  2GSP A;  1RGE A;  3KCH A;  1I8V A;  4HOH A;  1BGS A;  1Q9E A;  3SYU A;  1C54 A;  2RNT A;  1RGF A;  1I2E A;  1X1X A;  1BNG A;  1BNS A;  1B20 A;  1GSP A;  1T2I A;  1RGL A;  1AQZ A;  2KF3 A;  5BU4 A;  3D5I A;  1BNI A;  1LOY A;  2F4Y A;  1GOU A;  7GSP A;  1B2S A;  3HOH A;  1IYY A;  1TRQ A;  1LRA A;  1GOV A;  1X1W A;  3AHW A;  1FUT A;  2AAE A;  3D5G A;  4J5G A;  1MGR A;  1JBT A;  5RNT A;  2AAD A;  1T2H A;  1JBR A;  1BU4 A;  1BUJ A;  1BSC A;  2SAR A;  8RNT A;  1B2Z A;  1BNE A;  2KAA A;  3WHO A;  1I2F A;  2F5W A;  1BSD A;  4GHO A;  5GSP A;  1X1U A;  1I0V A;  1I70 A;  1BRH A;  1DE3 A;  1B2U A;  9RNT A;  1YVS A;  1RHL A;  1RDS A;  3AGO A;  1BRN L;  1BNR A;  1RCL A;  2F5M A;  1FYS A;  1MGW A;  2RBI A;  1BOX A;  1FUS A;  1B3S A;  1RNB A;  1B2M A;  1BRK A;  3GSP A;  3A5E A;  3RNT A;  3DGY A;  1RNT A;  1B21 A;  2BU4 A;  1LOV A;  2ZA4 A;  1RCK A;  1BIR A;  1BRG A;  1FZU A;  6GSP A;  6RNT A;  1BRI A;  1I3I A;  1AY7 A;  4RNT A;  1BSE A;  1RGH A;  1BAO A;  3URP A;  3AHS A;  3BU4 A;  1BRS A;  1HZ1 A;  1RLS A;  1RN4 A;  2BIR A;  1UCL A;  1FW7 A;  2HOH A;  1BRJ A;  1GOY A;  1YNV X;  1BVI A;  4BIR A;  3Q3F A;  2C4B A;  1RMS A;  4GSP A;  1GMR A;  1BNJ A;  1TRP A;  1UCI A;  2KF6 A;  4HAA A;  1HYF A;  1RGC A;  1BAN A;  7RNT A;  3DH2 A;  1DET A;  1RGA A;  5HOH A;  1CH0 A;  1PYL A;  1A2P A;  1TTO A;  1RGG A;  1UCK A;  1PY3 A;  3WR2 A;  5BIR A;  2KF4 A;  4BU4 A;  1R4Y A;  1I0X A;  3BIR A;  1B2X A;  1LNI A;  3D4A A;  1RTU A;  1ZGX A;  4J5K A;  1SAR A;  1B27 A;  1UCJ A;  1RSN A;  1JBS A;  1BNF A;  1LOW A;  3AGN A;  1BSA A; 
#chains in the Genus database with same CATH topology
 1ASK A;  2UUG C;  3DGM A;  4GL6 A;  1RRL A;  2F56 A;  1BSB A;  3IJE B;  5IF6 A;  3Q1C A;  1EG9 B;  2M7O A;  2XSO B;  1I8V A;  3KCH A;  2HMN B;  4ZM8 A;  3EN8 A;  2CG1 A;  1Q40 B;  2RNT A;  3A76 A;  1JKG A;  1VZZ A;  3EQQ B;  1I2E A;  2CFD A;  2GU3 A;  3K7C A;  4XBX A;  4PEJ A;  3N9H A;  1J2B A;  2XRX B;  1RKY A;  1F8N A;  2XR8 B;  1VQM 3;  4X2O A;  3ROB A;  3FKA A;  3PYJ A;  1OGX A;  1LOY A;  4MEI A;  1GOU A;  4R80 A;  5M1A A;  3UNL A;  3CPW 2;  3LYG A;  1OF5 A;  5CXO A;  4BTW A;  2QIY A;  1ZO2 A;  1Q7H A;  3WMD A;  3ZG0 A;  2CC3 A;  4WYK A;  3S27 A;  3I56 3;  1Q81 4;  1IYY A;  3HII A;  3S29 A;  1VQ8 3;  1KWI A;  2MC8 A;  3OX9 A;  1VQP 3;  3O8Y A;  1LXE A;  1CQS A;  1CYU A;  3KFQ C;  1Y4K A;  1FUT A;  1UI7 A;  3D5G A;  1ROV A;  3MWZ A;  5RNT A;  3VSY A;  4ILF A;  1JBR A;  2CWV A;  2E2V A;  3E99 A;  1AR0 A;  2Y73 A;  2ZHX B;  1FGR A;  2OOV A;  1LOX A;  8RNT A;  2KAA A;  1W2B 2;  4LGQ A;  2LYX A;  2Z77 A;  3CXC 2;  1I2F A;  1NNV A;  3CMA 3;  1BSD A;  1ULJ B;  4N6V 0;  4GHO A;  1IVV A;  1HKX A;  1I0V A;  4L8P A;  1I70 A;  1DMN A;  5TGN A;  1BUQ A;  3FZW A;  1ROA A;  2WOF A;  2BHM A;  5AI1 A;  1B2U A;  5LC7 A;  9RNT A;  3PXM A;  1A2V A;  2B24 B;  4FCJ A;  4LSO A;  1YIJ 3;  1BRN L;  4IPB A;  1UW1 A;  4WFO A;  2W04 A;  1VQN 3;  1EKM A;  2CWU A;  3N8B A;  1FUS A;  1B3S A;  1BRK A;  2BMO B;  1OH0 A;  4CPK A;  3CCU 3;  4K90 B;  1AVL A;  3G6E 3;  1B21 A;  3CC2 3;  1LOV A;  3I55 3;  4J9A A;  5IEN A;  3K63 A;  1E97 A;  3AMO B;  2CG0 A;  3LOY A;  1NU3 A;  1Q40 A;  1QAL A;  1T3B A;  1U5O A;  5IW9 A;  1WMN A;  3NM2 A;  4BL3 A;  3ER7 A;  4FMD A;  1SIH A;  2Z7A A;  3DXO A;  2V1L A;  1KD1 4;  1N5H A;  1FW7 A;  1FGT A;  3G71 3;  1V58 A;  4RBN A;  3BNB A;  4HM7 B;  4X2H A;  5LC6 A;  5JBS A;  1YI2 3;  2QEX 3;  3OWS A;  5JPP A;  1Q42 A;  2PZV A;  1TP6 A;  4N6O B;  1UI8 A;  2F98 A;  2WGO A;  5CK6 A;  1W01 A;  2KF6 A;  3UJM A;  7RNT A;  1A67 A;  3MKI A;  4N6N B;  3T0U A;  4WHA A;  5AYS C;  1CH0 A;  1IK3 A;  3LH4 A;  1UCK A;  2P09 A;  5G1K A;  1MWR A;  1PY3 A;  4RNZ A;  1V57 A;  3MG1 A;  2XSH B;  4HJL B;  3KKG A;  1UUG B;  4XM4 A;  1O7G B;  3RDE A;  1R4Y A;  1TU5 A;  2CX0 A;  1RRH A;  1WNH A;  2INX A;  3D4A A;  3FH1 A;  3WDG B;  3NQY A;  4J5K A;  4KFD A;  3FSD A;  4H3U A;  2GXF A;  5AEU B;  2Z6B A;  5G1L A;  3AGN A;  3DUK A;  3JUM A;  5KP4 A;  1DMM A;  2GEY A;  4L7K A;  3OWU A;  4N6L A;  1PU4 A;  1X1Y A;  1GD3 A;  1IT8 A;  1GMQ A;  1GMP A;  1NDO B;  4IT7 A;  3V92 A;  5AIG A;  2BNG A;  1I3F A;  3N54 B;  3CCL 3;  1YGW A;  3G0K A;  1T5Y A;  1ZS7 A;  3NUV A;  1Q9E A;  4KT3 B;  2Z76 A;  3RGA A;  3WOF B;  1C54 A;  3F8H A;  4FMC A;  1RGF A;  2F86 B;  3JVC A;  4WWU C;  3WA3 A;  1AV4 A;  2QA4 3;  1B20 A;  1US1 A;  2JQ5 A;  3GZB A;  3SVA A;  1YIT 3;  1N5P A;  3AMO A;  3H51 A;  4EYC A;  3FGY A;  1IVU A;  3CCQ 3;  3LXU X;  3B4O A;  4LZI A;  1BNI A;  2GEX A;  2F4Y A;  1DMQ A;  1R4C A;  3CU3 A;  3NBJ A;  3UL5 A;  7GSP A;  4NHF A;  2P38 A;  2KRT A;  1VQ4 3;  1QVG 2;  4MMY B;  1VQQ A;  3K9M C;  4R1K A;  1ZX2 A;  2HMK B;  3HIG A;  4R9L A;  1LRA A;  4EC6 A;  1GOV A;  3CCM 3;  1K28 A;  1TUH A;  3FF2 A;  3H3H A;  1X1W A;  3OXA A;  2IUJ A;  3S28 A;  2XEP A;  2AAE A;  1W7C A;  3EF8 A;  4J5G A;  1PFP A;  4K1U A;  2OQE C;  1OAC A;  1OCV A;  1MOL A;  1T2H A;  1W6C A;  2HMM B;  5DRV A;  2STD A;  4HM6 B;  1LVN A;  2CK3 H;  1IQX A;  2GU1 A;  2ZL8 A;  3QK9 A;  3UL6 A;  3NXJ A;  2RGQ A;  2JDI H;  1B2Z A;  4MJD A;  1C7H A;  2K0M A;  2F5W A;  3EBT A;  4EV2 A;  3DM8 A;  1FUW A;  1BRH A;  5FGO A;  1AVK A;  2H0G A;  2H0I A;  2J8X B;  1MWS A;  1QJG A;  3K5T A;  2KCD A;  1N8Q A;  3SLU A;  3HZP A;  1JV2 B;  1JNQ A;  2RBI A;  1G96 A;  1OGZ A;  3EHC A;  5KP1 A;  8CHO A;  3LTD A;  1RNB A;  2HML B;  1B2M A;  4HM2 B;  1SPU A;  3RNT A;  3OW2 2;  4HM4 B;  3V98 A;  2B1X B;  1S5A A;  3PGB A;  3OWY A;  1TFO A;  2RCD A;  2P0X A;  3EB8 A;  2GBW B;  4N6M A;  4O02 B;  2W9P A;  1A2K A;  1KQS 2;  2C10 A;  1I3I A;  3F8X A;  3WA2 X;  3OV4 A;  4IIA A;  2W03 A;  1BAO A;  2E2T A;  4O3V A;  3AHS A;  4G1M B;  1TFK A;  2Q07 A;  3EE1 A;  4H61 A;  1RLS A;  1RN4 A;  4FCZ A;  3M8C A;  3DGO A;  3G4S 3;  1JN5 B;  1UCL A;  1BRJ A;  4JF8 A;  1GOY A;  1QMA A;  2WOH A;  3Q2P A;  3D79 A;  5AYR B;  1O7W B;  1KC8 4;  5KP3 A;  3LT9 A;  1RMS A;  1GMR A;  3CNM A;  2OTL 3;  1JZD A;  2P05 A;  3X41 A;  4HAA A;  1K8A 4;  1BAN A;  2BMQ B;  1RGA A;  2R41 A;  1W2Z A;  3WOD G;  3FG4 A;  1IV9 A;  1A2P A;  1O7M B;  1NJI 4;  3KII A;  1LQM B;  3STD A;  4KZ1 A;  3HX8 A;  2KF4 A;  3IPT A;  5G2G A;  5IG0 A;  5IER A;  4LMI A;  3CNX A;  3TDG A;  4BU4 A;  4FMB A;  1LNI A;  1VQ9 3;  1IQ8 A;  1JB5 A;  3SOA A;  2OCT A;  3CCS 3;  4FR9 A;  1RSN A;  4CCV A;  4EBG A;  1N9J A;  4KVH A;  4GB5 A;  3BND A;  3CPO A;  1EEJ A;  2E2U A;  3F9S A;  1YJ9 3;  1ULI B;  2O9U X;  4WP5 A;  1FGQ A;  1RN1 A;  2HMJ B;  2XGL A;  1K73 4;  3BB9 A;  1DVC A;  1SJW A;  1I2G A;  2GSP A;  1RGE A;  4HOH A;  4OVM A;  2UX0 A;  2GBX B;  3FLJ A;  4I4K A;  3NBB A;  3SYU A;  4N6T A;  1GYB A;  2W56 B;  1X1X A;  4K1V A;  1DYU A;  4HM8 B;  1L5G B;  3SOY A;  5STD A;  3GZR A;  4RNY A;  3DMC A;  1VQ5 3;  2YX9 A;  1T2I A;  3CC4 3;  1AQZ A;  5A0O B;  1OHP A;  3KZT A;  3DY5 A;  5CF1 A;  2OTJ 3;  2BMR B;  2QGU A;  1B2S A;  1M90 4;  2WO0 A;  2XF3 A;  3HOH A;  1TRQ A;  1JN5 A;  3CCV 3;  4U13 A;  5I97 A;  3BLZ A;  1MGR A;  3U1W A;  2IMJ A;  3F14 A;  3B4P A;  5EQL A;  1IVX A;  3RGR A;  1JBT A;  1W5Z A;  1DVD A;  4J8T A;  1BUJ A;  3S5C A;  1STD A;  1QVF 2;  5DRE A;  3JUP A;  2ML6 A;  5IEP A;  2ML5 A;  4KFF A;  3WHO A;  2L4V A;  1YJW 3;  1CEW I;  3D9R A;  5JPU A;  3NM7 A;  3CD6 3;  3FG3 A;  4HZ9 B;  2CHC A;  2LQV A;  1DE3 A;  4HM1 B;  3VF1 A;  2XFS A;  1RHL A;  1W00 A;  1RDS A;  2H0H A;  4OUQ A;  2F5M A;  1FYS A;  1MGW A;  1BOX A;  1TIJ A;  4EW5 A;  1WMO A;  3LZA A;  3A5E A;  3I0Y A;  3PCS A;  4R9K A;  5AEW B;  1A90 A;  1RNT A;  1JB2 A;  2P0M A;  3ZG5 A;  2BU4 A;  3S67 A;  1JB4 A;  3GAX A;  2FNQ A;  2ZA4 A;  2OQE A;  1RCK A;  5M19 A;  5AII A;  4XB5 A;  3CCJ 3;  1WQL B;  3L0R A;  1K9M 4;  1NO3 A;  1N9E A;  6GSP A;  3J7Y d;  1NB5 I;  1FGO A;  4FCM A;  5HGR A;  2IY2 A;  1AY7 A;  2A15 A;  4KFE A;  4RNT A;  1OUN A;  2W56 A;  1O7N B;  2W6J H;  3NV0 B;  1CYV A;  1LNH A;  4N6U A;  4QWT A;  5IG4 A;  1GY7 A;  2CFG A;  3ZFZ A;  3PCR A;  1GY5 A;  3D3L A;  1WMP A;  3NQZ A;  1FGM A;  1OHS A;  4HKV B;  2CFK A;  2BIR A;  1RN7 A;  5AIF A;  4LEH A;  1YNV X;  1BVI A;  4TX4 A;  4BIR A;  3MG3 A;  4HBR A;  4EV5 A;  3Q3F A;  4AEQ A;  6STD A;  2C4B A;  4GSP A;  3T8U A;  4HVN A;  2YFJ B;  1UCI A;  1GS3 A;  1YGE A;  5ELJ A;  3V99 A;  1M9G A;  4LYL B;  1HYF A;  3Q90 A;  3QRD A;  3JUQ A;  2FXT A;  1EQK A;  3DH2 A;  1DET A;  2Y74 A;  3F7X A;  5IG3 A;  4L8O A;  1TTO A;  1IQY A;  1RGG A;  3GZX B;  3F40 A;  1IU7 A;  2XFT A;  3CC7 3;  2IUK A;  3WR2 A;  2W2C A;  5BIR A;  1GY6 A;  2MF7 A;  1IV7 A;  2XGN A;  1E3R A;  3MYT A;  2UGI A;  4XBY A;  3MPH A;  1I0X A;  1JJ2 2;  3BIR A;  1RJO A;  1B2X A;  1UGH I;  1YHQ 3;  1RTU A;  4I5Q A;  1FA3 A;  1WTH A;  3FG1 A;  3KN4 A;  5IEO A;  5AIH A;  3SX1 A;  3KSP A;  2CWT A;  1RGK A;  1G02 A;  2KF5 A;  1MNL A;  2K3D A;  4BTY A;  1M1K 4;  3DGL A;  2SBL A;  3DZL A;  3JUO A;  1YJN 3;  1UDI I;  2IA7 A;  1BGS A;  3EJV A;  3FCS B;  1D6Y A;  3CCR 3;  4K61 A;  1GD4 A;  5BVB A;  1JRQ A;  3EN1 B;  3KSE D;  3LTA A;  3T8N A;  2FGT A;  4RZM A;  3NBR A;  4OK0 A;  1IT7 A;  1JBS A;  7STD A;  2BT3 A;  1BNG A;  2ZDJ A;  2OOV C;  4N3V A;  1BNS A;  1M1X B;  3CCE 3;  1SII A;  1O7H B;  1UUW B;  3K0Z A;  1SQW A;  1UGI A;  1GSP A;  3ALA A;  1RGL A;  3EBY A;  2KF3 A;  3IMA B;  3PS8 A;  2W0Q A;  3ECF A;  3EC9 A;  5BU4 A;  3HI7 A;  5BXQ A;  1W6Y A;  2I9W A;  3D5I A;  2IYJ A;  3NV0 A;  4NRE A;  4HM0 B;  1VQO 3;  3DGN A;  1S72 3;  1HU9 A;  3MHE A;  3MSO A;  1OHO A;  4DKI A;  4Q53 A;  1Q7Y 4;  1NB3 I;  2BO9 B;  3AHW A;  3NHX A;  2CIU A;  3B7C A;  4R4K A;  4NPB A;  2AAD A;  1O7P B;  3JUN A;  4EXR A;  3X3Y A;  1BU4 A;  4BL2 A;  3B8L A;  2YFL B;  5D81 A;  2O3O A;  2D42 A;  1BSC A;  1G0T A;  4BTX A;  2SAR A;  1BNE A;  1TJD A;  5GSP A;  1X1U A;  3LT8 A;  1U8C B;  4XBT A;  2PNC A;  1IVW A;  4ORL A;  1VQK 3;  2HMO B;  1YVS A;  3G8Z A;  1D6U A;  4HM3 B;  2CH9 A;  4HZB B;  4XDW A;  3AGO A;  5CF2 A;  3X3Z A;  1BNR A;  1RCL A;  2XH9 A;  2CFW A;  2C11 A;  4STD A;  3CME 3;  4HM5 B;  5D83 A;  2K54 A;  3GSP A;  4XDV A;  1JKG B;  3EX9 A;  2RFR A;  2CX1 A;  3DGY A;  3LTC A;  5D82 A;  2YFI B;  1ISK A;  3VGN A;  3SXX A;  5ELU A;  1KSI A;  1W4N A;  1BIR A;  2RSX A;  1BRG A;  1FZU A;  2D1W A;  4HYZ A;  4JRF A;  3X40 A;  6RNT A;  1BRI A;  1D6Z A;  2CKF B;  5IG5 A;  3GZY B;  2L1S A;  3F7S A;  1NWW A;  1MWU A;  1BSE A;  1RGH A;  2R4I A;  2F99 A;  3URP A;  5M18 A;  1Z1S A;  3BU4 A;  3BNC A;  5EEO A;  1MWT A;  1BRS A;  1OF5 B;  1HZ1 A;  2OWP A;  4WYK B;  5FW5 A;  2HOH A;  1N8R 4;  1EUI C;  1OPY A;  1E3V A;  4MMX B;  1LQG C;  1W6G A;  3LML A;  1Q86 4;  2CW9 A;  4FMA A;  1BNJ A;  1TRP A;  3PZW A;  1BSA A;  2KXG A;  5EVH A;  1RGC A;  1VQL 3;  3G16 A;  3UB1 A;  3GWR A;  1JZO A;  3HK4 A;  3U97 A;  2WGQ A;  5HOH A;  4MMZ B;  3BNE A;  1PYL A;  1YVB I;  3GRD A;  3SED A;  4AKY A;  4CDL A;  3X3X A;  1UUV B;  1VQ6 3;  1IDP A;  1K41 A;  1Q82 4;  3NX0 A;  1W02 A;  1EA2 A;  4O2H A;  2W9Q A;  3FF0 A;  3KE7 A;  4AKZ A;  1STF I;  1ZGX A;  1SAR A;  1B27 A;  1UCJ A;  3MG2 A;  4O8S A;  1QAK A;  5CLK A;  1BNF A;  1LOW A;  2CFL A;  3LTB A;  3WOE B;  1QAF A;  3X42 A;  4CJN A;  1VQ7 3;  1V74 A; 
#chains in the Genus database with same CATH homology
 1X1Y A;  1RGK A;  1RN1 A;  1G02 A;  1GMQ A;  2KF5 A;  1GMP A;  2F56 A;  1BSB A;  1I3F A;  1YGW A;  1I2G A;  2GSP A;  1RGE A;  3KCH A;  1I8V A;  4HOH A;  1BGS A;  1Q9E A;  3SYU A;  1C54 A;  2RNT A;  1RGF A;  1I2E A;  1X1X A;  1BNG A;  1BNS A;  1B20 A;  1GSP A;  1T2I A;  1RGL A;  1AQZ A;  2KF3 A;  5BU4 A;  3D5I A;  1BNI A;  1LOY A;  2F4Y A;  1GOU A;  7GSP A;  1B2S A;  3HOH A;  1IYY A;  1TRQ A;  1LRA A;  1GOV A;  1X1W A;  3AHW A;  1FUT A;  2AAE A;  3D5G A;  4J5G A;  1MGR A;  1JBT A;  5RNT A;  2AAD A;  1T2H A;  1JBR A;  1BU4 A;  1BUJ A;  1BSC A;  2SAR A;  8RNT A;  1B2Z A;  1BNE A;  2KAA A;  3WHO A;  1I2F A;  2F5W A;  1BSD A;  4GHO A;  5GSP A;  1X1U A;  1I0V A;  1I70 A;  1BRH A;  1DE3 A;  1B2U A;  9RNT A;  1YVS A;  1RHL A;  1RDS A;  3AGO A;  1BRN L;  1BNR A;  1RCL A;  2F5M A;  1FYS A;  1MGW A;  2RBI A;  1BOX A;  1FUS A;  1B3S A;  1RNB A;  1B2M A;  1BRK A;  3GSP A;  3A5E A;  3RNT A;  3DGY A;  1RNT A;  1B21 A;  2BU4 A;  1LOV A;  2ZA4 A;  1RCK A;  1BIR A;  1BRG A;  1FZU A;  6GSP A;  6RNT A;  1BRI A;  1I3I A;  1AY7 A;  4RNT A;  1BSE A;  1RGH A;  1BAO A;  3URP A;  3AHS A;  3BU4 A;  1BRS A;  1HZ1 A;  1RLS A;  1RN4 A;  2BIR A;  1UCL A;  1FW7 A;  2HOH A;  1BRJ A;  1GOY A;  1YNV X;  1BVI A;  4BIR A;  3Q3F A;  2C4B A;  1RMS A;  4GSP A;  1GMR A;  1BNJ A;  1TRP A;  1UCI A;  2KF6 A;  4HAA A;  1HYF A;  1RGC A;  1BAN A;  7RNT A;  3DH2 A;  1DET A;  1RGA A;  5HOH A;  1CH0 A;  1PYL A;  1A2P A;  1TTO A;  1RGG A;  1UCK A;  1PY3 A;  3WR2 A;  5BIR A;  2KF4 A;  4BU4 A;  1R4Y A;  1I0X A;  3BIR A;  1B2X A;  1LNI A;  3D4A A;  1RTU A;  1ZGX A;  4J5K A;  1SAR A;  1B27 A;  1UCJ A;  1RSN A;  1JBS A;  1BNF A;  1LOW A;  3AGN A;  1BSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...