4N6TA

Adhiron: a stable and versatile peptide display scaffold - full length adhiron
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
ENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGGKKKLYEAKVWVKPWENFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adhiron: a stable and versatile peptide display scaffold for molecular recognition applications.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords Adhiron
total genus 16
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6tA00
3Q2PA 1PFPA 1GD3A 1IV7A 2BO9B 2CH9A 3GAXA 3LH4A 5LC6A 3UL6A 1WNHA 2O9UX 3MWZA 4IT7A 1ROAA 1STFI 4N6LA 4N6MA 3L0RA 2W9QA 1A90A 3PS8A 3NX0A 3SVAA 4EYCA 1DVCA 3QRDA 4ZM8A 2OCTA 1G96A 1YVBI 1MNLA 1CEWI 4N6TA 1GD4A 5ELUA 5EQLA 1FUWA 3PXMA 1MOLA 1CYVA 1CYUA 1EQKA 1N5PA 3KSED 4N6UA 3UL5A 1NB5I 3IMAB 3K9MC 1FA3A 2KXGA 4N6NB 4N6OB 4TX4A 4N6V0 1KWIA 5ELJA 1N9JA 4CCVA 1M9GA 1LXEA 1NB3I 3KFQC 3S67A 5A0OB 1N5HA 1A67A 1DVDA 1TIJA 4LZIA 3PYJA 5LC7A 2W9PA 1R4CA 1IV9A 1RN7A
chains in the Genus database with same CATH superfamily
4EBGA 5EVHA 1JBTA 1G0TA 1OPYA 3MYTA 4FMDA 2FXTA 1CH0A 4N6LA 4R4KA 2F4YA 5IEPA 1IT7A 2CKFB 1OGZA 2INXA 7STDA 3OX9A 3UB1A 1I0XA 3WDGB 2WGOA 5EQLA 4KT3B 1MOLA 3B8LA 4OK0A 3PZWA 4CPKA 1BRKA 3EB8A 1YJW3 2YFLB 2UGIA 4NREA 4BTWA 1OF5B 2A15A 1BSEA 1YGWA 4K1VA 3X42A 3VGNA 1W5ZA 3PCRA 2XSOB 3BB9A 2RCDA 2CX1A 4O02B 1NWWA 2K3DA 4MEIA 1IVUA 4R9LA 6RNTA 4ILFA 3IPTA 2O3OA 1OUNA 5AI1A 1BNJA 1WNHA 2I9WA 1DMNA 2Y73A 3CCL3 1UDII 3BNCA 1GYBA 3AMOB 4HM2B 1RNTA 2WOHA 4FMBA 3FCSB 4JRFA 3AHSA 1ZGXA 2C4BA 2OCTA 2K54A 3EBTA 1I2GA 1GOVA 1GY5A 3EHCA 5AEUB 3S28A 3F8XA 1BRIA 5CXOA 1FZUA 4RBNA 3G4S3 3RNTA 1BNRA 1W6CA 4RNYA 3EQQB 3JUPA 1FYSA 3SOAA 5ELJA 1A2VA 1K41A 1B3SA 5IEOA 1RNBA 3SLUA 2Y74A 1RKYA 1BVIA 5DRVA 1OACA 1IV9A 1T2HA 1IVVA 1RTUA 3LMLA 1I3FA 2HMOB 1QVG2 4HM0B 3A5EA 2F86B 1GD3A 4MMZB 2RNTA 5G1KA 4H3UA 3K63A 1OH0A 1LNIA 1LRAA 1W2ZA 1X1YA 2F99A 4HM8B 5GSPA 3GZRA 1YHQ3 1RGCA 1BAOA 3MG1A 5HOHA 4HM5B 1IQ8A 1FGQA 3FG4A 5ELUA 3CCV3 2L4VA 3PXMA 1BRJA 3AHWA 1MWTA 3T8UA 1B2MA 1JBRA 4RNZA 4K1UA 1TTOA 4IPBA 2V1LA 1DMMA 1QALA 1QVF2 5IF6A 1UUVB 4R9KA 1QAKA 3AMOA 3ROBA 1W7CA 1Q864 3EN8A 3X3YA 3PS8A 3F7XA 1WTHA 3U1WA 1O7HB 4MMXB 1IV7A 2KF4A 3U97A 1N8QA 4GL6A 3F14A 3KKGA 1JV2B 4XM4A 4IIAA 1NU3A 5G1LA 2ZHXB 1JB5A 1Y4KA 2CWTA 2RFRA 1TFKA 1DVCA 1RRLA 2W0QA 3BU4A 3EE1A 4OVMA 4ZM8A 4EXRA 4J9AA 5D83A 1YGEA 4BL2A 1LQMB 1JZDA 3D4AA 3LTAA 4WYKA 2PNCA 3UL5A 1RCLA 1QMAA 2KXGA 3D5IA 1RJOA 2F5MA 4N6OB 4STDA 5AIIA 2RSXA 2XF3A 5DREA 1I3IA 1BOXA 2QGUA 5CF1A 1RGGA 1W6GA 1Q40A 3GZYB 2GBXB 1LXEA 4XDWA 1UGHI 1GSPA 5JPPA 1IU7A 1WMPA 1STDA 1VQL3 2KF5A 5AEWB 1M1XB 3G16A 3NQYA 4KFFA 4KZ1A 1RN7A 5M18A 3CPW2 5KP1A 1TJDA 1K8A4 4XB5A 3T0UA 1BU4A 1O7PB 3D79A 3LH4A 2BMRB 1TUHA 1I2EA 3PGBA 1PU4A 2C11A 1MWSA 1STFI 1ULJB 2CIUA 3J7Yd 1LOWA 2W56A 4G1MB 5BU4A 4HM7B 2XR8B 3WA3A 3QRDA 3CCM3 3NUVA 1Q7HA 3CNXA 3WA2X 1FUWA 3RDEA 3S29A 1GS3A 2MF7A 4HM6B 2WOFA 2BNGA 1UI8A 4LYLB 3LT8A 2OWPA 3S5CA 3NBBA 1IQXA 1V74A 3JUOA 2YFIB 3OW22 3F7SA 1OHOA 1LOVA 1JN5B 1RGEA 1EEJA 2XFTA 3MG2A 3CCE3 4HOHA 1W00A 5LC7A 1GMQA 3ZG5A 3LOYA 3KIIA 3I563 1ZO2A 2CG0A 4HJLB 1ISKA 2SARA 1YI23 3JUQA 2XGNA 3L0RA 1B2UA 4EYCA 1BRNL 1T2IA 1MGRA 3NBJA 1LOXA 2HMKB 3VSYA 2GEYA 1EQKA 2FGTA 1LNHA 2QA43 3ER7A 3F40A 1IVWA 2C10A 3K9MC 4HAAA 1B2XA 3GRDA 3QK9A 3URPA 1SQWA 4AKYA 2E2VA 3EX9A 5RNTA 5A0OB 2RGQA 3LXUX 4XBXA 2OOVC 4LZIA 4K90B 4BU4A 1WMOA 1FUTA 1C54A 5EEOA 2J8XB 1D6YA 3SOYA 4BL3A 1RCKA 4WFOA 3WOEB 1L5GB 2CH9A 1W2B2 5BIRA 2ZDJA 2W6JH 2CW9A 1E3RA 1OHPA 3BNBA 4J5KA 2P05A 3FG3A 3NX0A 3ECFA 3G6E3 3LT9A 4LEHA 3OWSA 1W4NA 3K5TA 5CF2A 1N9EA 4L8PA 1N5PA 2UX0A 6STDA 1UUGB 1BSCA 3BNDA 1OHSA 3WMDA 3HI7A 1RDSA 4BTXA 5D81A 2H0GA 1LOYA 2PZVA 2IY2A 2LYXA 3LYGA 1RN4A 5IG0A 4R80A 3PYJA 2JQ5A 2GSPA 3BNEA 3F8HA 2AADA 4FMAA 4BTYA 2WGQA 5CLKA 3UL6A 5FGOA 5AIHA 3X41A 3RGRA 1ZS7A 3WHOA 1YJ93 4HKVB 7RNTA 5HGRA 1KD14 1US1A 1RGKA 2XGLA 3D5GA 1VQO3 3WR2A 5AIGA 2BIRA 1I70A 1YVBI 3KN4A 1ZX2A 3V99A 2P0MA 1GOUA 4WWUC 5IERA 1VQP3 8CHOA 1EG9B 3B7CA 3NQZA 5BVBA 1SJWA 2XH9A 9RNTA 1K28A 1RGFA 3HX8A 1TU5A 3HK4A 2CFDA 1QAFA 4HM1B 4KVHA 1J2BA 5M19A 2ML6A 1DVDA 3WOFB 1VQ93 2STDA 4KFDA 1YIT3 1BNGA 1BSDA 2CHCA 1FUSA 3CC23 1RSNA 5JPUA 2Z76A 1LVNA 3MKIA 4PEJA 1ROAA 3FGYA 3MSOA 2L1SA 3GZXB 4XBYA 4O8SA 3X3ZA 3SVAA 1Q42A 3FG1A 1M1K4 3EBYA 2GU1A 4N6TA 4R1KA 4OUQA 1HYFA 1NNVA 3UJMA 3FLJA 4HZBB 3V92A 1IDPA 4XDVA 1RGLA 2MC8A 3FH1A 3H3HA 3DUKA 3KE7A 4EC6A 1U5OA 1UGIA 3B4PA 1OGXA 2RBIA 1OCVA 1BNEA 2KCDA 3TDGA 3F9SA 1BIRA 2W56B 4GHOA 5IG3A 1YNVX 1SIHA 3NXJA 4HM4B 3CCR3 1GOYA 3EC9A 1O7WB 3O8YA 3CC73 1E97A 2BHMA 2D1WA 1D6UA 3MWZA 3CC43 4XBTA 3D3LA 1MWUA 3DXOA 3RGAA 3G0KA 2B1XB 3KZTA 1V58A 3DGYA 3LZAA 1HKXA 4I4KA 1B20A 1G96A 4ORLA 4AKZA 1CEWI 1SPUA 1MWRA 1CYVA 1SARA 1PY3A 3OV4A 3SYUA 3IMAB 1FGMA 4N6NB 3FSDA 2W2CA 3G713 1JNQA 2WO0A 3KFQC 4RZMA 1RRHA 4O3VA 1B2SA 2QEX3 3AGNA 1CQSA 1G02A 2KF6A 1JJ22 1YVSA 2H0HA 1GMPA 2F5WA 3SXXA 1M904 1BRGA 3CPOA 1RLSA 1LQGC 5LC6A 4CJNA 1K734 5BXQA 1NO3A 1UW1A 1UUWB 3NHXA 2ZL8A 1Q40B 1FGTA 4MMYB 4N6MA 2Z6BA 2IYJA 2CFLA 3GZBA 3LTBA 5JBSA 3FZWA 3I0YA 3E99A 2BU4A 3FF0A 4AEQA 4FCJA 4O2HA 1VQQA 1AR0A 2CWUA 4FR9A 4N6UA 1NDOB 1FW7A 2SBLA 1AV4A 4L7KA 5AYRB 5KP3A 3V98A 1FGRA 2HMLB 4N6V0 3T8NA 1BRSA 1N9JA 1U8CB 2ZA4A 2XFSA 1VQ73 1EKMA 1R4CA 1TRQA 1F8NA 1UCLA 2JDIH 1JRQA 1VZZA 3HIIA 1KQS2 4J5GA 4RNTA 4X2HA 1O7NB 3NBRA 2KAAA 2OQEC 2BMOB 1BUJA 2Q07A 2W03A 3DGNA 2W9QA 2UUGC 3K0ZA 3M8CA 1B21A 2IUJA 1JN5A 3N54B 3Q90A 4HZ9B 2Z77A 1D6ZA 3MPHA 1AVLA 3DY5A 3JVCA 4LMIA 1I8VA 4H61A 1HU9A 2OTJ3 3NM7A 1RMSA 4I5QA 1DE3A 1VQK3 5KP4A 3DM8A 1R4YA 4TX4A 2OQEA 1KWIA 2ML5A 1BRHA 3SEDA 1ULIB 2K0MA 1NB3I 5STDA 1BNFA 3JUNA 1A67A 3OXAA 5CK6A 4X2OA 2F56A 3WODG 1BSAA 2HOHA 1A2PA 2W04A 3GWRA 3G8ZA 5D82A 1PFPA 1OF5A 1W02A 2IMJA 1SIIA 2BO9B 2YFJB 3MHEA 8RNTA 3DGOA 1X1XA 2F98A 3NV0B 1EUIC 3PCSA 4FCMA 5TGNA 1GY6A 4EV5A 3CCQ3 3CU3A 3DGMA 2KF3A 3NM2A 1V57A 3Q3FA 2BMQB 1MGWA 2M7OA 4J8TA 6GSPA 3KSED 2IUKA 1FGOA 1IYYA 3ZFZA 2CX0A 2H0IA 2HMNB 1WQLB 1UCKA 4CCVA 3S27A 2XSHB 1AQZA 2FNQA 1VQ53 3JUMA 4LGQA 3OWYA 2CFWA 2W9PA 1AY7A 2R41A 3ALAA 2LQVA 3CCJ3 1EA2A 2GEXA 5IENA 3Q2PA 1VQ43 1WMNA 4WP5A 1AVKA 4HVNA 3GAXA 4KFEA 2P09A 4WYKB 3ZG0A 4IT7A 3CXC2 3UNLA 1PYLA 3CNMA 1JKGA 1ASKA 3CD63 3CME3 3N9HA 4HBRA 1IT8A 3FKAA 4K61A 1BANA 1JZOA 1MNLA 3DH2A 2P38A 2CFKA 3X3XA 3HIGA 3GSPA 1YIJ3 3MG3A 5IW9A 3HZPA 1N8R4 1C7HA 3BLZA 1O7GB 1Q7Y4 1Q9EA 3HOHA 3IJEB 1TFOA 3NV0A 4EW5A 3S67A 1N5HA 4FMCA 1O7MB 4HM3B 4QWTA 3BIRA 3EJVA 2HMJB 3EN1B 1JBSA 4MJDA 4EV2A 2CWVA 4BIRA 1UCJA 2HMMB 1JB4A 2P0XA 1VQ63 1Z1SA 2R4IA 2D42A 1B27A 3B4OA 2O9UX 5G2GA 1VQM3 1A90A 2XEPA 1T3BA 3OWUA 4WHAA 1T5YA 3N8BA 3Q1CA 3I553 1BSBA 4JF8A 2CK3H 5IG5A 1GD4A 1UI7A 1S5AA 2B24B 1Q824 3FF2A 2XRXB 2OTL3 1VQN3 1DMQA 4CDLA 1FA3A 4L8OA 1VQ83 2GU3A 1JB2A 1RGHA 1I0VA 1W6YA 2KRTA 2Z7AA 1BNSA 2CC3A 3EF8A 4FCZA 3CCU3 3A76A 3H51A 3LTCA 1JKGB 4NHFA 2OOVA 1Q814 3STDA 3X40A 7GSPA 2YX9A 1I2FA 1DYUA 1B2ZA 3SX1A 1QJGA 2IA7A 4HYZA 1NB5I 1HZ1A 5FW5A 2CG1A 3D9RA 1YJN3 1BGSA 5I97A 4GB5A 1RGAA 1RN1A 4NPBA 2AAEA 2E2UA 5AYSC 3CMA3 3KCHA 4N3VA 1NJI4 3K7CA 4DKIA 1K9M4 1E3VA 1UCIA 1ROVA 1GMRA 1BNIA 3DGLA 1KSIA 2GBWB 4U13A 3CCS3 1X1WA 1CYUA 2BT3A 2GXFA 1KC84 1X1UA 3DMCA 1IQYA 4LSOA 1IVXA 3KSPA 3AGOA 1GY7A 3VF1A 1S723 3DZLA 1W01A 1DETA 2CFGA 1BUQA 1M9GA 5M1AA 1A2KA 1RHLA 1TRPA 3LTDA 2E2TA 1TIJA 4Q53A 1IK3A 5AIFA 4GSPA 5IG4A 2QIYA 1TP6A
chains in the Genus database with same CATH topology
4EBGA 5EVHA 1OPYA 3MYTA 4FMDA 2FXTA 4N6LA 4R4KA 5IEPA 1IT7A 2CKFB 1OGZA 2INXA 7STDA 3OX9A 3UB1A 3WDGB 2WGOA 5EQLA 1MOLA 3B8LA 4OK0A 3PZWA 3EB8A 1YJW3 2YFLB 4NREA 4BTWA 1OF5B 2A15A 4K1VA 3X42A 3VGNA 1W5ZA 3PCRA 2XSOB 3BB9A 2RCDA 4O02B 1NWWA 4MEIA 1IVUA 4R9LA 3IPTA 2O3OA 1OUNA 5AI1A 1WNHA 2I9WA 1DMNA 2Y73A 3CCL3 3BNCA 1GYBA 3AMOB 4HM2B 2WOHA 4FMBA 3FCSB 4JRFA 2OCTA 3EBTA 2K54A 1GY5A 3EHCA 5AEUB 3S28A 3F8XA 5CXOA 4RBNA 3G4S3 1W6CA 4RNYA 3EQQB 3JUPA 3SOAA 5ELJA 1A2VA 1K41A 5IEOA 3SLUA 2Y74A 1RKYA 5DRVA 1OACA 1IV9A 1IVVA 3LMLA 2HMOB 4HM0B 4MMZB 2F86B 1GD3A 4H3UA 3K63A 1OH0A 1W2ZA 4HM8B 2F99A 3GZRA 1YHQ3 3MG1A 4HM5B 1IQ8A 1FGQA 3FG4A 5ELUA 3CCV3 2L4VA 3PXMA 3T8UA 4RNZA 4K1UA 4IPBA 2V1LA 1DMMA 1QALA 1QVF2 5IF6A 1UUVB 4R9KA 1QAKA 3AMOA 3ROBA 1W7CA 1Q864 3EN8A 3X3YA 3PS8A 3F7XA 1WTHA 3U1WA 1O7HB 4MMXB 1IV7A 3U97A 1N8QA 4GL6A 3F14A 3KKGA 1JV2B 4XM4A 4IIAA 1NU3A 1JB5A 1Y4KA 2CWTA 2RFRA 1TFKA 1DVCA 1RRLA 2W0QA 4OVMA 3EE1A 4ZM8A 4EXRA 4J9AA 5D83A 1YGEA 3LTAA 4WYKA 2PNCA 3UL5A 1QMAA 2KXGA 5AIIA 1RJOA 4N6OB 4STDA 5DREA 6STDA 2RSXA 2XF3A 5CF1A 2QGUA 1W6GA 1Q40A 3GZYB 2GBXB 1LXEA 4XDWA 5JPPA 1IU7A 1WMPA 1STDA 1VQL3 5AEWB 1M1XB 3G16A 3NQYA 4KFFA 4KZ1A 1RN7A 3CPW2 5KP1A 1K8A4 4XB5A 3T0UA 1O7PB 3LH4A 2BMRB 1TUHA 3PGBA 1PU4A 2C11A 1STFI 1ULJB 2CIUA 3J7Yd 2W56A 4G1MB 3WA3A 4HM7B 2XR8B 3QRDA 3CCM3 3NUVA 3CNXA 3WA2X 1FUWA 3RDEA 3S29A 1GS3A 2MF7A 4HM6B 2WOFA 2BNGA 1UI8A 3LT8A 2OWPA 3S5CA 3NBBA 1IQXA 1V74A 3JUOA 2YFIB 3OW22 3F7SA 1OHOA 2XFTA 1JN5B 3CCE3 3MG2A 5LC7A 1W00A 3LOYA 3KIIA 3I563 1ZO2A 2CG0A 4HJLB 1ISKA 1YI23 3JUQA 2XGNA 3L0RA 4EYCA 3NBJA 1EQKA 1LOXA 2HMKB 3VSYA 2GEYA 2FGTA 1LNHA 2QA43 3ER7A 3F40A 1IVWA 2C10A 3K9MC 3GRDA 3QK9A 1SQWA 4AKYA 2E2VA 3EX9A 5A0OB 2RGQA 3LXUX 4XBXA 2OOVC 4LZIA 4K90B 1WMOA 5EEOA 1D6YA 3SOYA 4WFOA 3WOEB 1L5GB 2CH9A 1W2B2 2ZDJA 2W6JH 2CW9A 1E3RA 1OHPA 3BNBA 2P05A 3FG3A 3NX0A 3ECFA 3G6E3 3LT9A 4LEHA 3OWSA 1W4NA 3K5TA 5CF2A 1N9EA 4L8PA 1N5PA 2UX0A 3BNDA 1OHSA 3WMDA 3HI7A 4BTXA 5D81A 2PZVA 2LYXA 3LYGA 5IG0A 4R80A 3PYJA 2JQ5A 4FMAA 3BNEA 3F8HA 4BTYA 2WGQA 5CLKA 3UL6A 5FGOA 5AIHA 3X41A 3RGRA 1YJ93 4HKVB 5HGRA 1KD14 1US1A 2XGLA 1VQO3 5AIGA 1YVBI 3KN4A 1ZX2A 3V99A 2P0MA 4WWUC 5IERA 1VQP3 8CHOA 1EG9B 3B7CA 3NQZA 5BVBA 1SJWA 2XH9A 1K28A 3HX8A 1TU5A 3HK4A 2CFDA 1QAFA 4HM1B 4KVHA 1J2BA 1DVDA 2ML6A 3WOFB 1VQ93 2STDA 4KFDA 1YIT3 2CHCA 3CC23 5JPUA 2Z76A 1LVNA 3MKIA 4PEJA 1ROAA 3FGYA 3MSOA 3GZXB 4XBYA 4O8SA 3X3ZA 3SVAA 1Q42A 3FG1A 1M1K4 3EBYA 2GU1A 4N6TA 4R1KA 4OUQA 3UJMA 3FLJA 4HZBB 3V92A 1IDPA 4XDVA 2MC8A 3FH1A 3H3HA 3DUKA 3KE7A 4EC6A 1U5OA 3B4PA 1OGXA 1OCVA 2KCDA 3TDGA 3F9SA 2W56B 5IG3A 3NXJA 1SIHA 4HM4B 3CCR3 3EC9A 1O7WB 3O8YA 3CC73 1E97A 2BHMA 2D1WA 1D6UA 3MWZA 3CC43 4XBTA 3D3LA 3DXOA 3RGAA 3G0KA 2B1XB 3KZTA 4ORLA 3LZAA 4AKZA 1HKXA 4I4KA 1QVG2 1G96A 1CEWI 1SPUA 1CYVA 3OV4A 3IMAB 1FGMA 4N6NB 3FSDA 2W2CA 3G713 1JNQA 2WO0A 3KFQC 4RZMA 1RRHA 4O3VA 2QEX3 1CQSA 1JJ22 3SXXA 1M904 3CPOA 5LC6A 1K734 5BXQA 1NO3A 1UW1A 1UUWB 3NHXA 2ZL8A 1Q40B 1FGTA 4MMYB 4N6MA 2Z6BA 4QWTA 2CFLA 3GZBA 3LTBA 5JBSA 3FZWA 3I0YA 3E99A 3FF0A 4AEQA 4FCJA 4O2HA 1AR0A 2CWUA 4FR9A 4N6UA 1NDOB 2SBLA 1AV4A 4L7KA 5AYRB 5KP3A 3V98A 1FGRA 2HMLB 4N6V0 3T8NA 1N9JA 1U8CB 2XFSA 1VQ73 1EKMA 1R4CA 1F8NA 2JDIH 1JRQA 1VZZA 3HIIA 1KQS2 4X2HA 1O7NB 3NBRA 2OQEC 2BMOB 2Q07A 2W03A 3DGNA 2W9QA 3M8CA 3K0ZA 2IUJA 1JN5A 3N54B 3Q90A 4HZ9B 2Z77A 1D6ZA 3MPHA 1AVLA 3DY5A 3JVCA 4LMIA 4H61A 2OTJ3 1HU9A 3NM7A 1VQK3 5KP4A 3DM8A 4TX4A 2OQEA 1KWIA 2ML5A 3SEDA 1ULIB 2K0MA 1NB3I 5STDA 3JUNA 1A67A 3OXAA 5CK6A 4X2OA 3WODG 2W04A 3GWRA 3G8ZA 5D82A 1PFPA 1OF5A 1W02A 2IMJA 1SIIA 2BO9B 2YFJB 3MHEA 3DGOA 3PCSA 2F98A 3NV0B 4FCMA 5TGNA 1GY6A 4EV5A 3CCQ3 3CU3A 3DGMA 3NM2A 4J8TA 2BMQB 2M7OA 3KSED 2IUKA 1FGOA 2HMNB 1WQLB 4CCVA 3S27A 2XSHB 2FNQA 1VQ53 3JUMA 4LGQA 3OWYA 2CFWA 2W9PA 3ALAA 2LQVA 3CCJ3 1EA2A 2GEXA 5IENA 3Q2PA 1VQ43 1WMNA 4WP5A 1AVKA 4HVNA 3GAXA 4KFEA 2P09A 4WYKB 4IT7A 3CXC2 3UNLA 3CNMA 1JKGA 1ASKA 3CD63 3CME3 3N9HA 4HBRA 1IT8A 3FKAA 4K61A 1MNLA 2P38A 2CFKA 3X3XA 3HIGA 1YIJ3 3MG3A 5IW9A 3HZPA 1N8R4 1C7HA 3BLZA 1O7GB 1Q7Y4 3IJEB 1TFOA 3NV0A 3S67A 1N5HA 4FMCA 1O7MB 4HM3B 3EJVA 2HMJB 3EN1B 4MJDA 4EV2A 2CWVA 2HMMB 1JB4A 2P0XA 1VQ63 1Z1SA 2R4IA 2D42A 3B4OA 2O9UX 5G2GA 1VQM3 1A90A 2XEPA 3OWUA 4WHAA 1T5YA 3N8BA 3Q1CA 3I553 4JF8A 2CK3H 5IG5A 1GD4A 1UI7A 1S5AA 2B24B 3FF2A 2XRXB 2OTL3 1VQN3 1DMQA 4CDLA 1FA3A 4L8OA 1VQ83 2GU3A 1JB2A 2KRTA 1W6YA 2Z7AA 4FCZA 3EF8A 2CC3A 4GB5A 3CCU3 1Q824 1Q814 3A76A 3H51A 3LTCA 1JKGB 4NHFA 2OOVA 3STDA 3X40A 2YX9A 1NB5I 1DYUA 3SX1A 1QJGA 2IA7A 4HYZA 5FW5A 2CG1A 3D9RA 1YJN3 5I97A 5AYSC 2E2UA 3CMA3 4N3VA 1NJI4 3K7CA 1K9M4 1E3VA 1ROVA 3DGLA 1KSIA 2GBWB 4U13A 3CCS3 1CYUA 2BT3A 2GXFA 1KC84 3DMCA 1IQYA 4LSOA 1IVXA 3KSPA 1GY7A 3VF1A 1S723 3DZLA 1W01A 2CFGA 1BUQA 1M9GA 1A2KA 3LTDA 2E2TA 1TIJA 4Q53A 1IK3A 5AIFA 5IG4A 2QIYA 1TP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2P A;  1PFP A;  1GD3 A;  1IV7 A;  2BO9 B;  2CH9 A;  3GAX A;  3LH4 A;  5LC6 A;  3UL6 A;  1WNH A;  2O9U X;  3MWZ A;  4IT7 A;  1ROA A;  1STF I;  4N6L A;  4N6M A;  3L0R A;  2W9Q A;  1A90 A;  3PS8 A;  3NX0 A;  3SVA A;  4EYC A;  1DVC A;  3QRD A;  4ZM8 A;  2OCT A;  1G96 A;  1YVB I;  1MNL A;  1CEW I;  4N6T A;  1GD4 A;  5ELU A;  5EQL A;  1FUW A;  3PXM A;  1MOL A;  1CYV A;  1CYU A;  1EQK A;  1N5P A;  3KSE D;  4N6U A;  3UL5 A;  1NB5 I;  3IMA B;  3K9M C;  1FA3 A;  2KXG A;  4N6N B;  4N6O B;  4TX4 A;  4N6V 0;  1KWI A;  5ELJ A;  1N9J A;  4CCV A;  1M9G A;  1LXE A;  1NB3 I;  3KFQ C;  3S67 A;  5A0O B;  1N5H A;  1A67 A;  1DVD A;  1TIJ A;  4LZI A;  3PYJ A;  5LC7 A;  2W9P A;  1R4C A;  1IV9 A;  1RN7 A; 
#chains in the Genus database with same CATH topology
 4EBG A;  5EVH A;  1JBT A;  1G0T A;  1OPY A;  3MYT A;  4FMD A;  2FXT A;  1CH0 A;  4N6L A;  4R4K A;  2F4Y A;  5IEP A;  1IT7 A;  2CKF B;  1OGZ A;  2INX A;  7STD A;  3OX9 A;  3UB1 A;  1I0X A;  3WDG B;  2WGO A;  5EQL A;  4KT3 B;  1MOL A;  3B8L A;  4OK0 A;  3PZW A;  4CPK A;  1BRK A;  3EB8 A;  1YJW 3;  2YFL B;  2UGI A;  4NRE A;  4BTW A;  1OF5 B;  2A15 A;  1BSE A;  1YGW A;  4K1V A;  3X42 A;  3VGN A;  1W5Z A;  3PCR A;  2XSO B;  3BB9 A;  2RCD A;  2CX1 A;  4O02 B;  1NWW A;  2K3D A;  4MEI A;  1IVU A;  4R9L A;  6RNT A;  4ILF A;  3IPT A;  2O3O A;  1OUN A;  5AI1 A;  1BNJ A;  1WNH A;  2I9W A;  1DMN A;  2Y73 A;  3CCL 3;  1UDI I;  3BNC A;  1GYB A;  3AMO B;  4HM2 B;  1RNT A;  2WOH A;  4FMB A;  3FCS B;  4JRF A;  3AHS A;  1ZGX A;  2C4B A;  2OCT A;  2K54 A;  3EBT A;  1I2G A;  1GOV A;  1GY5 A;  3EHC A;  5AEU B;  3S28 A;  3F8X A;  1BRI A;  5CXO A;  1FZU A;  4RBN A;  3G4S 3;  3RNT A;  1BNR A;  1W6C A;  4RNY A;  3EQQ B;  3JUP A;  1FYS A;  3SOA A;  5ELJ A;  1A2V A;  1K41 A;  1B3S A;  5IEO A;  1RNB A;  3SLU A;  2Y74 A;  1RKY A;  1BVI A;  5DRV A;  1OAC A;  1IV9 A;  1T2H A;  1IVV A;  1RTU A;  3LML A;  1I3F A;  2HMO B;  1QVG 2;  4HM0 B;  3A5E A;  2F86 B;  1GD3 A;  4MMZ B;  2RNT A;  5G1K A;  4H3U A;  3K63 A;  1OH0 A;  1LNI A;  1LRA A;  1W2Z A;  1X1Y A;  2F99 A;  4HM8 B;  5GSP A;  3GZR A;  1YHQ 3;  1RGC A;  1BAO A;  3MG1 A;  5HOH A;  4HM5 B;  1IQ8 A;  1FGQ A;  3FG4 A;  5ELU A;  3CCV 3;  2L4V A;  3PXM A;  1BRJ A;  3AHW A;  1MWT A;  3T8U A;  1B2M A;  1JBR A;  4RNZ A;  4K1U A;  1TTO A;  4IPB A;  2V1L A;  1DMM A;  1QAL A;  1QVF 2;  5IF6 A;  1UUV B;  4R9K A;  1QAK A;  3AMO A;  3ROB A;  1W7C A;  1Q86 4;  3EN8 A;  3X3Y A;  3PS8 A;  3F7X A;  1WTH A;  3U1W A;  1O7H B;  4MMX B;  1IV7 A;  2KF4 A;  3U97 A;  1N8Q A;  4GL6 A;  3F14 A;  3KKG A;  1JV2 B;  4XM4 A;  4IIA A;  1NU3 A;  5G1L A;  2ZHX B;  1JB5 A;  1Y4K A;  2CWT A;  2RFR A;  1TFK A;  1DVC A;  1RRL A;  2W0Q A;  3BU4 A;  3EE1 A;  4OVM A;  4ZM8 A;  4EXR A;  4J9A A;  5D83 A;  1YGE A;  4BL2 A;  1LQM B;  1JZD A;  3D4A A;  3LTA A;  4WYK A;  2PNC A;  3UL5 A;  1RCL A;  1QMA A;  2KXG A;  3D5I A;  1RJO A;  2F5M A;  4N6O B;  4STD A;  5AII A;  2RSX A;  2XF3 A;  5DRE A;  1I3I A;  1BOX A;  2QGU A;  5CF1 A;  1RGG A;  1W6G A;  1Q40 A;  3GZY B;  2GBX B;  1LXE A;  4XDW A;  1UGH I;  1GSP A;  5JPP A;  1IU7 A;  1WMP A;  1STD A;  1VQL 3;  2KF5 A;  5AEW B;  1M1X B;  3G16 A;  3NQY A;  4KFF A;  4KZ1 A;  1RN7 A;  5M18 A;  3CPW 2;  5KP1 A;  1TJD A;  1K8A 4;  4XB5 A;  3T0U A;  1BU4 A;  1O7P B;  3D79 A;  3LH4 A;  2BMR B;  1TUH A;  1I2E A;  3PGB A;  1PU4 A;  2C11 A;  1MWS A;  1STF I;  1ULJ B;  2CIU A;  3J7Y d;  1LOW A;  2W56 A;  4G1M B;  5BU4 A;  4HM7 B;  2XR8 B;  3WA3 A;  3QRD A;  3CCM 3;  3NUV A;  1Q7H A;  3CNX A;  3WA2 X;  1FUW A;  3RDE A;  3S29 A;  1GS3 A;  2MF7 A;  4HM6 B;  2WOF A;  2BNG A;  1UI8 A;  4LYL B;  3LT8 A;  2OWP A;  3S5C A;  3NBB A;  1IQX A;  1V74 A;  3JUO A;  2YFI B;  3OW2 2;  3F7S A;  1OHO A;  1LOV A;  1JN5 B;  1RGE A;  1EEJ A;  2XFT A;  3MG2 A;  3CCE 3;  4HOH A;  1W00 A;  5LC7 A;  1GMQ A;  3ZG5 A;  3LOY A;  3KII A;  3I56 3;  1ZO2 A;  2CG0 A;  4HJL B;  1ISK A;  2SAR A;  1YI2 3;  3JUQ A;  2XGN A;  3L0R A;  1B2U A;  4EYC A;  1BRN L;  1T2I A;  1MGR A;  3NBJ A;  1LOX A;  2HMK B;  3VSY A;  2GEY A;  1EQK A;  2FGT A;  1LNH A;  2QA4 3;  3ER7 A;  3F40 A;  1IVW A;  2C10 A;  3K9M C;  4HAA A;  1B2X A;  3GRD A;  3QK9 A;  3URP A;  1SQW A;  4AKY A;  2E2V A;  3EX9 A;  5RNT A;  5A0O B;  2RGQ A;  3LXU X;  4XBX A;  2OOV C;  4LZI A;  4K90 B;  4BU4 A;  1WMO A;  1FUT A;  1C54 A;  5EEO A;  2J8X B;  1D6Y A;  3SOY A;  4BL3 A;  1RCK A;  4WFO A;  3WOE B;  1L5G B;  2CH9 A;  1W2B 2;  5BIR A;  2ZDJ A;  2W6J H;  2CW9 A;  1E3R A;  1OHP A;  3BNB A;  4J5K A;  2P05 A;  3FG3 A;  3NX0 A;  3ECF A;  3G6E 3;  3LT9 A;  4LEH A;  3OWS A;  1W4N A;  3K5T A;  5CF2 A;  1N9E A;  4L8P A;  1N5P A;  2UX0 A;  6STD A;  1UUG B;  1BSC A;  3BND A;  1OHS A;  3WMD A;  3HI7 A;  1RDS A;  4BTX A;  5D81 A;  2H0G A;  1LOY A;  2PZV A;  2IY2 A;  2LYX A;  3LYG A;  1RN4 A;  5IG0 A;  4R80 A;  3PYJ A;  2JQ5 A;  2GSP A;  3BNE A;  3F8H A;  2AAD A;  4FMA A;  4BTY A;  2WGQ A;  5CLK A;  3UL6 A;  5FGO A;  5AIH A;  3X41 A;  3RGR A;  1ZS7 A;  3WHO A;  1YJ9 3;  4HKV B;  7RNT A;  5HGR A;  1KD1 4;  1US1 A;  1RGK A;  2XGL A;  3D5G A;  1VQO 3;  3WR2 A;  5AIG A;  2BIR A;  1I70 A;  1YVB I;  3KN4 A;  1ZX2 A;  3V99 A;  2P0M A;  1GOU A;  4WWU C;  5IER A;  1VQP 3;  8CHO A;  1EG9 B;  3B7C A;  3NQZ A;  5BVB A;  1SJW A;  2XH9 A;  9RNT A;  1K28 A;  1RGF A;  3HX8 A;  1TU5 A;  3HK4 A;  2CFD A;  1QAF A;  4HM1 B;  4KVH A;  1J2B A;  5M19 A;  2ML6 A;  1DVD A;  3WOF B;  1VQ9 3;  2STD A;  4KFD A;  1YIT 3;  1BNG A;  1BSD A;  2CHC A;  1FUS A;  3CC2 3;  1RSN A;  5JPU A;  2Z76 A;  1LVN A;  3MKI A;  4PEJ A;  1ROA A;  3FGY A;  3MSO A;  2L1S A;  3GZX B;  4XBY A;  4O8S A;  3X3Z A;  3SVA A;  1Q42 A;  3FG1 A;  1M1K 4;  3EBY A;  2GU1 A;  4N6T A;  4R1K A;  4OUQ A;  1HYF A;  1NNV A;  3UJM A;  3FLJ A;  4HZB B;  3V92 A;  1IDP A;  4XDV A;  1RGL A;  2MC8 A;  3FH1 A;  3H3H A;  3DUK A;  3KE7 A;  4EC6 A;  1U5O A;  1UGI A;  3B4P A;  1OGX A;  2RBI A;  1OCV A;  1BNE A;  2KCD A;  3TDG A;  3F9S A;  1BIR A;  2W56 B;  4GHO A;  5IG3 A;  1YNV X;  1SIH A;  3NXJ A;  4HM4 B;  3CCR 3;  1GOY A;  3EC9 A;  1O7W B;  3O8Y A;  3CC7 3;  1E97 A;  2BHM A;  2D1W A;  1D6U A;  3MWZ A;  3CC4 3;  4XBT A;  3D3L A;  1MWU A;  3DXO A;  3RGA A;  3G0K A;  2B1X B;  3KZT A;  1V58 A;  3DGY A;  3LZA A;  1HKX A;  4I4K A;  1B20 A;  1G96 A;  4ORL A;  4AKZ A;  1CEW I;  1SPU A;  1MWR A;  1CYV A;  1SAR A;  1PY3 A;  3OV4 A;  3SYU A;  3IMA B;  1FGM A;  4N6N B;  3FSD A;  2W2C A;  3G71 3;  1JNQ A;  2WO0 A;  3KFQ C;  4RZM A;  1RRH A;  4O3V A;  1B2S A;  2QEX 3;  3AGN A;  1CQS A;  1G02 A;  2KF6 A;  1JJ2 2;  1YVS A;  2H0H A;  1GMP A;  2F5W A;  3SXX A;  1M90 4;  1BRG A;  3CPO A;  1RLS A;  1LQG C;  5LC6 A;  4CJN A;  1K73 4;  5BXQ A;  1NO3 A;  1UW1 A;  1UUW B;  3NHX A;  2ZL8 A;  1Q40 B;  1FGT A;  4MMY B;  4N6M A;  2Z6B A;  2IYJ A;  2CFL A;  3GZB A;  3LTB A;  5JBS A;  3FZW A;  3I0Y A;  3E99 A;  2BU4 A;  3FF0 A;  4AEQ A;  4FCJ A;  4O2H A;  1VQQ A;  1AR0 A;  2CWU A;  4FR9 A;  4N6U A;  1NDO B;  1FW7 A;  2SBL A;  1AV4 A;  4L7K A;  5AYR B;  5KP3 A;  3V98 A;  1FGR A;  2HML B;  4N6V 0;  3T8N A;  1BRS A;  1N9J A;  1U8C B;  2ZA4 A;  2XFS A;  1VQ7 3;  1EKM A;  1R4C A;  1TRQ A;  1F8N A;  1UCL A;  2JDI H;  1JRQ A;  1VZZ A;  3HII A;  1KQS 2;  4J5G A;  4RNT A;  4X2H A;  1O7N B;  3NBR A;  2KAA A;  2OQE C;  2BMO B;  1BUJ A;  2Q07 A;  2W03 A;  3DGN A;  2W9Q A;  2UUG C;  3K0Z A;  3M8C A;  1B21 A;  2IUJ A;  1JN5 A;  3N54 B;  3Q90 A;  4HZ9 B;  2Z77 A;  1D6Z A;  3MPH A;  1AVL A;  3DY5 A;  3JVC A;  4LMI A;  1I8V A;  4H61 A;  1HU9 A;  2OTJ 3;  3NM7 A;  1RMS A;  4I5Q A;  1DE3 A;  1VQK 3;  5KP4 A;  3DM8 A;  1R4Y A;  4TX4 A;  2OQE A;  1KWI A;  2ML5 A;  1BRH A;  3SED A;  1ULI B;  2K0M A;  1NB3 I;  5STD A;  1BNF A;  3JUN A;  1A67 A;  3OXA A;  5CK6 A;  4X2O A;  2F56 A;  3WOD G;  1BSA A;  2HOH A;  1A2P A;  2W04 A;  3GWR A;  3G8Z A;  5D82 A;  1PFP A;  1OF5 A;  1W02 A;  2IMJ A;  1SII A;  2BO9 B;  2YFJ B;  3MHE A;  8RNT A;  3DGO A;  1X1X A;  2F98 A;  3NV0 B;  1EUI C;  3PCS A;  4FCM A;  5TGN A;  1GY6 A;  4EV5 A;  3CCQ 3;  3CU3 A;  3DGM A;  2KF3 A;  3NM2 A;  1V57 A;  3Q3F A;  2BMQ B;  1MGW A;  2M7O A;  4J8T A;  6GSP A;  3KSE D;  2IUK A;  1FGO A;  1IYY A;  3ZFZ A;  2CX0 A;  2H0I A;  2HMN B;  1WQL B;  1UCK A;  4CCV A;  3S27 A;  2XSH B;  1AQZ A;  2FNQ A;  1VQ5 3;  3JUM A;  4LGQ A;  3OWY A;  2CFW A;  2W9P A;  1AY7 A;  2R41 A;  3ALA A;  2LQV A;  3CCJ 3;  1EA2 A;  2GEX A;  5IEN A;  3Q2P A;  1VQ4 3;  1WMN A;  4WP5 A;  1AVK A;  4HVN A;  3GAX A;  4KFE A;  2P09 A;  4WYK B;  3ZG0 A;  4IT7 A;  3CXC 2;  3UNL A;  1PYL A;  3CNM A;  1JKG A;  1ASK A;  3CD6 3;  3CME 3;  3N9H A;  4HBR A;  1IT8 A;  3FKA A;  4K61 A;  1BAN A;  1JZO A;  1MNL A;  3DH2 A;  2P38 A;  2CFK A;  3X3X A;  3HIG A;  3GSP A;  1YIJ 3;  3MG3 A;  5IW9 A;  3HZP A;  1N8R 4;  1C7H A;  3BLZ A;  1O7G B;  1Q7Y 4;  1Q9E A;  3HOH A;  3IJE B;  1TFO A;  3NV0 A;  4EW5 A;  3S67 A;  1N5H A;  4FMC A;  1O7M B;  4HM3 B;  4QWT A;  3BIR A;  3EJV A;  2HMJ B;  3EN1 B;  1JBS A;  4MJD A;  4EV2 A;  2CWV A;  4BIR A;  1UCJ A;  2HMM B;  1JB4 A;  2P0X A;  1VQ6 3;  1Z1S A;  2R4I A;  2D42 A;  1B27 A;  3B4O A;  2O9U X;  5G2G A;  1VQM 3;  1A90 A;  2XEP A;  1T3B A;  3OWU A;  4WHA A;  1T5Y A;  3N8B A;  3Q1C A;  3I55 3;  1BSB A;  4JF8 A;  2CK3 H;  5IG5 A;  1GD4 A;  1UI7 A;  1S5A A;  2B24 B;  1Q82 4;  3FF2 A;  2XRX B;  2OTL 3;  1VQN 3;  1DMQ A;  4CDL A;  1FA3 A;  4L8O A;  1VQ8 3;  2GU3 A;  1JB2 A;  1RGH A;  1I0V A;  1W6Y A;  2KRT A;  2Z7A A;  1BNS A;  2CC3 A;  3EF8 A;  4FCZ A;  3CCU 3;  3A76 A;  3H51 A;  3LTC A;  1JKG B;  4NHF A;  2OOV A;  1Q81 4;  3STD A;  3X40 A;  7GSP A;  2YX9 A;  1I2F A;  1DYU A;  1B2Z A;  3SX1 A;  1QJG A;  2IA7 A;  4HYZ A;  1NB5 I;  1HZ1 A;  5FW5 A;  2CG1 A;  3D9R A;  1YJN 3;  1BGS A;  5I97 A;  4GB5 A;  1RGA A;  1RN1 A;  4NPB A;  2AAE A;  2E2U A;  5AYS C;  3CMA 3;  3KCH A;  4N3V A;  1NJI 4;  3K7C A;  4DKI A;  1K9M 4;  1E3V A;  1UCI A;  1ROV A;  1GMR A;  1BNI A;  3DGL A;  1KSI A;  2GBW B;  4U13 A;  3CCS 3;  1X1W A;  1CYU A;  2BT3 A;  2GXF A;  1KC8 4;  1X1U A;  3DMC A;  1IQY A;  4LSO A;  1IVX A;  3KSP A;  3AGO A;  1GY7 A;  3VF1 A;  1S72 3;  3DZL A;  1W01 A;  1DET A;  2CFG A;  1BUQ A;  1M9G A;  5M1A A;  1A2K A;  1RHL A;  1TRP A;  3LTD A;  2E2T A;  1TIJ A;  4Q53 A;  1IK3 A;  5AIF A;  4GSP A;  5IG4 A;  2QIY A;  1TP6 A; 
#chains in the Genus database with same CATH homology
 4EBG A;  5EVH A;  1OPY A;  3MYT A;  4FMD A;  2FXT A;  4N6L A;  4R4K A;  5IEP A;  1IT7 A;  2CKF B;  1OGZ A;  2INX A;  7STD A;  3OX9 A;  3UB1 A;  3WDG B;  2WGO A;  5EQL A;  1MOL A;  3B8L A;  4OK0 A;  3PZW A;  3EB8 A;  1YJW 3;  2YFL B;  4NRE A;  4BTW A;  1OF5 B;  2A15 A;  4K1V A;  3X42 A;  3VGN A;  1W5Z A;  3PCR A;  2XSO B;  3BB9 A;  2RCD A;  4O02 B;  1NWW A;  4MEI A;  1IVU A;  4R9L A;  3IPT A;  2O3O A;  1OUN A;  5AI1 A;  1WNH A;  2I9W A;  1DMN A;  2Y73 A;  3CCL 3;  3BNC A;  1GYB A;  3AMO B;  4HM2 B;  2WOH A;  4FMB A;  3FCS B;  4JRF A;  2OCT A;  3EBT A;  2K54 A;  1GY5 A;  3EHC A;  5AEU B;  3S28 A;  3F8X A;  5CXO A;  4RBN A;  3G4S 3;  1W6C A;  4RNY A;  3EQQ B;  3JUP A;  3SOA A;  5ELJ A;  1A2V A;  1K41 A;  5IEO A;  3SLU A;  2Y74 A;  1RKY A;  5DRV A;  1OAC A;  1IV9 A;  1IVV A;  3LML A;  2HMO B;  4HM0 B;  4MMZ B;  2F86 B;  1GD3 A;  4H3U A;  3K63 A;  1OH0 A;  1W2Z A;  4HM8 B;  2F99 A;  3GZR A;  1YHQ 3;  3MG1 A;  4HM5 B;  1IQ8 A;  1FGQ A;  3FG4 A;  5ELU A;  3CCV 3;  2L4V A;  3PXM A;  3T8U A;  4RNZ A;  4K1U A;  4IPB A;  2V1L A;  1DMM A;  1QAL A;  1QVF 2;  5IF6 A;  1UUV B;  4R9K A;  1QAK A;  3AMO A;  3ROB A;  1W7C A;  1Q86 4;  3EN8 A;  3X3Y A;  3PS8 A;  3F7X A;  1WTH A;  3U1W A;  1O7H B;  4MMX B;  1IV7 A;  3U97 A;  1N8Q A;  4GL6 A;  3F14 A;  3KKG A;  1JV2 B;  4XM4 A;  4IIA A;  1NU3 A;  1JB5 A;  1Y4K A;  2CWT A;  2RFR A;  1TFK A;  1DVC A;  1RRL A;  2W0Q A;  4OVM A;  3EE1 A;  4ZM8 A;  4EXR A;  4J9A A;  5D83 A;  1YGE A;  3LTA A;  4WYK A;  2PNC A;  3UL5 A;  1QMA A;  2KXG A;  5AII A;  1RJO A;  4N6O B;  4STD A;  5DRE A;  6STD A;  2RSX A;  2XF3 A;  5CF1 A;  2QGU A;  1W6G A;  1Q40 A;  3GZY B;  2GBX B;  1LXE A;  4XDW A;  5JPP A;  1IU7 A;  1WMP A;  1STD A;  1VQL 3;  5AEW B;  1M1X B;  3G16 A;  3NQY A;  4KFF A;  4KZ1 A;  1RN7 A;  3CPW 2;  5KP1 A;  1K8A 4;  4XB5 A;  3T0U A;  1O7P B;  3LH4 A;  2BMR B;  1TUH A;  3PGB A;  1PU4 A;  2C11 A;  1STF I;  1ULJ B;  2CIU A;  3J7Y d;  2W56 A;  4G1M B;  3WA3 A;  4HM7 B;  2XR8 B;  3QRD A;  3CCM 3;  3NUV A;  3CNX A;  3WA2 X;  1FUW A;  3RDE A;  3S29 A;  1GS3 A;  2MF7 A;  4HM6 B;  2WOF A;  2BNG A;  1UI8 A;  3LT8 A;  2OWP A;  3S5C A;  3NBB A;  1IQX A;  1V74 A;  3JUO A;  2YFI B;  3OW2 2;  3F7S A;  1OHO A;  2XFT A;  1JN5 B;  3CCE 3;  3MG2 A;  5LC7 A;  1W00 A;  3LOY A;  3KII A;  3I56 3;  1ZO2 A;  2CG0 A;  4HJL B;  1ISK A;  1YI2 3;  3JUQ A;  2XGN A;  3L0R A;  4EYC A;  3NBJ A;  1EQK A;  1LOX A;  2HMK B;  3VSY A;  2GEY A;  2FGT A;  1LNH A;  2QA4 3;  3ER7 A;  3F40 A;  1IVW A;  2C10 A;  3K9M C;  3GRD A;  3QK9 A;  1SQW A;  4AKY A;  2E2V A;  3EX9 A;  5A0O B;  2RGQ A;  3LXU X;  4XBX A;  2OOV C;  4LZI A;  4K90 B;  1WMO A;  5EEO A;  1D6Y A;  3SOY A;  4WFO A;  3WOE B;  1L5G B;  2CH9 A;  1W2B 2;  2ZDJ A;  2W6J H;  2CW9 A;  1E3R A;  1OHP A;  3BNB A;  2P05 A;  3FG3 A;  3NX0 A;  3ECF A;  3G6E 3;  3LT9 A;  4LEH A;  3OWS A;  1W4N A;  3K5T A;  5CF2 A;  1N9E A;  4L8P A;  1N5P A;  2UX0 A;  3BND A;  1OHS A;  3WMD A;  3HI7 A;  4BTX A;  5D81 A;  2PZV A;  2LYX A;  3LYG A;  5IG0 A;  4R80 A;  3PYJ A;  2JQ5 A;  4FMA A;  3BNE A;  3F8H A;  4BTY A;  2WGQ A;  5CLK A;  3UL6 A;  5FGO A;  5AIH A;  3X41 A;  3RGR A;  1YJ9 3;  4HKV B;  5HGR A;  1KD1 4;  1US1 A;  2XGL A;  1VQO 3;  5AIG A;  1YVB I;  3KN4 A;  1ZX2 A;  3V99 A;  2P0M A;  4WWU C;  5IER A;  1VQP 3;  8CHO A;  1EG9 B;  3B7C A;  3NQZ A;  5BVB A;  1SJW A;  2XH9 A;  1K28 A;  3HX8 A;  1TU5 A;  3HK4 A;  2CFD A;  1QAF A;  4HM1 B;  4KVH A;  1J2B A;  1DVD A;  2ML6 A;  3WOF B;  1VQ9 3;  2STD A;  4KFD A;  1YIT 3;  2CHC A;  3CC2 3;  5JPU A;  2Z76 A;  1LVN A;  3MKI A;  4PEJ A;  1ROA A;  3FGY A;  3MSO A;  3GZX B;  4XBY A;  4O8S A;  3X3Z A;  3SVA A;  1Q42 A;  3FG1 A;  1M1K 4;  3EBY A;  2GU1 A;  4N6T A;  4R1K A;  4OUQ A;  3UJM A;  3FLJ A;  4HZB B;  3V92 A;  1IDP A;  4XDV A;  2MC8 A;  3FH1 A;  3H3H A;  3DUK A;  3KE7 A;  4EC6 A;  1U5O A;  3B4P A;  1OGX A;  1OCV A;  2KCD A;  3TDG A;  3F9S A;  2W56 B;  5IG3 A;  3NXJ A;  1SIH A;  4HM4 B;  3CCR 3;  3EC9 A;  1O7W B;  3O8Y A;  3CC7 3;  1E97 A;  2BHM A;  2D1W A;  1D6U A;  3MWZ A;  3CC4 3;  4XBT A;  3D3L A;  3DXO A;  3RGA A;  3G0K A;  2B1X B;  3KZT A;  4ORL A;  3LZA A;  4AKZ A;  1HKX A;  4I4K A;  1QVG 2;  1G96 A;  1CEW I;  1SPU A;  1CYV A;  3OV4 A;  3IMA B;  1FGM A;  4N6N B;  3FSD A;  2W2C A;  3G71 3;  1JNQ A;  2WO0 A;  3KFQ C;  4RZM A;  1RRH A;  4O3V A;  2QEX 3;  1CQS A;  1JJ2 2;  3SXX A;  1M90 4;  3CPO A;  5LC6 A;  1K73 4;  5BXQ A;  1NO3 A;  1UW1 A;  1UUW B;  3NHX A;  2ZL8 A;  1Q40 B;  1FGT A;  4MMY B;  4N6M A;  2Z6B A;  4QWT A;  2CFL A;  3GZB A;  3LTB A;  5JBS A;  3FZW A;  3I0Y A;  3E99 A;  3FF0 A;  4AEQ A;  4FCJ A;  4O2H A;  1AR0 A;  2CWU A;  4FR9 A;  4N6U A;  1NDO B;  2SBL A;  1AV4 A;  4L7K A;  5AYR B;  5KP3 A;  3V98 A;  1FGR A;  2HML B;  4N6V 0;  3T8N A;  1N9J A;  1U8C B;  2XFS A;  1VQ7 3;  1EKM A;  1R4C A;  1F8N A;  2JDI H;  1JRQ A;  1VZZ A;  3HII A;  1KQS 2;  4X2H A;  1O7N B;  3NBR A;  2OQE C;  2BMO B;  2Q07 A;  2W03 A;  3DGN A;  2W9Q A;  3M8C A;  3K0Z A;  2IUJ A;  1JN5 A;  3N54 B;  3Q90 A;  4HZ9 B;  2Z77 A;  1D6Z A;  3MPH A;  1AVL A;  3DY5 A;  3JVC A;  4LMI A;  4H61 A;  2OTJ 3;  1HU9 A;  3NM7 A;  1VQK 3;  5KP4 A;  3DM8 A;  4TX4 A;  2OQE A;  1KWI A;  2ML5 A;  3SED A;  1ULI B;  2K0M A;  1NB3 I;  5STD A;  3JUN A;  1A67 A;  3OXA A;  5CK6 A;  4X2O A;  3WOD G;  2W04 A;  3GWR A;  3G8Z A;  5D82 A;  1PFP A;  1OF5 A;  1W02 A;  2IMJ A;  1SII A;  2BO9 B;  2YFJ B;  3MHE A;  3DGO A;  3PCS A;  2F98 A;  3NV0 B;  4FCM A;  5TGN A;  1GY6 A;  4EV5 A;  3CCQ 3;  3CU3 A;  3DGM A;  3NM2 A;  4J8T A;  2BMQ B;  2M7O A;  3KSE D;  2IUK A;  1FGO A;  2HMN B;  1WQL B;  4CCV A;  3S27 A;  2XSH B;  2FNQ A;  1VQ5 3;  3JUM A;  4LGQ A;  3OWY A;  2CFW A;  2W9P A;  3ALA A;  2LQV A;  3CCJ 3;  1EA2 A;  2GEX A;  5IEN A;  3Q2P A;  1VQ4 3;  1WMN A;  4WP5 A;  1AVK A;  4HVN A;  3GAX A;  4KFE A;  2P09 A;  4WYK B;  4IT7 A;  3CXC 2;  3UNL A;  3CNM A;  1JKG A;  1ASK A;  3CD6 3;  3CME 3;  3N9H A;  4HBR A;  1IT8 A;  3FKA A;  4K61 A;  1MNL A;  2P38 A;  2CFK A;  3X3X A;  3HIG A;  1YIJ 3;  3MG3 A;  5IW9 A;  3HZP A;  1N8R 4;  1C7H A;  3BLZ A;  1O7G B;  1Q7Y 4;  3IJE B;  1TFO A;  3NV0 A;  3S67 A;  1N5H A;  4FMC A;  1O7M B;  4HM3 B;  3EJV A;  2HMJ B;  3EN1 B;  4MJD A;  4EV2 A;  2CWV A;  2HMM B;  1JB4 A;  2P0X A;  1VQ6 3;  1Z1S A;  2R4I A;  2D42 A;  3B4O A;  2O9U X;  5G2G A;  1VQM 3;  1A90 A;  2XEP A;  3OWU A;  4WHA A;  1T5Y A;  3N8B A;  3Q1C A;  3I55 3;  4JF8 A;  2CK3 H;  5IG5 A;  1GD4 A;  1UI7 A;  1S5A A;  2B24 B;  3FF2 A;  2XRX B;  2OTL 3;  1VQN 3;  1DMQ A;  4CDL A;  1FA3 A;  4L8O A;  1VQ8 3;  2GU3 A;  1JB2 A;  2KRT A;  1W6Y A;  2Z7A A;  4FCZ A;  3EF8 A;  2CC3 A;  4GB5 A;  3CCU 3;  1Q82 4;  1Q81 4;  3A76 A;  3H51 A;  3LTC A;  1JKG B;  4NHF A;  2OOV A;  3STD A;  3X40 A;  2YX9 A;  1NB5 I;  1DYU A;  3SX1 A;  1QJG A;  2IA7 A;  4HYZ A;  5FW5 A;  2CG1 A;  3D9R A;  1YJN 3;  5I97 A;  5AYS C;  2E2U A;  3CMA 3;  4N3V A;  1NJI 4;  3K7C A;  1K9M 4;  1E3V A;  1ROV A;  3DGL A;  1KSI A;  2GBW B;  4U13 A;  3CCS 3;  1CYU A;  2BT3 A;  2GXF A;  1KC8 4;  3DMC A;  1IQY A;  4LSO A;  1IVX A;  3KSP A;  1GY7 A;  3VF1 A;  1S72 3;  3DZL A;  1W01 A;  2CFG A;  1BUQ A;  1M9G A;  1A2K A;  3LTD A;  2E2T A;  1TIJ A;  4Q53 A;  1IK3 A;  5AIF A;  5IG4 A;  2QIY A;  1TP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...