4N6TA

Adhiron: a stable and versatile peptide display scaffold - full length adhiron
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
ENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGGKKKLYEAKVWVKPWENFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhiron
publication title Adhiron: a stable and versatile peptide display scaffold for molecular recognition applications.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 16
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6tA00
2O9UX 4IT7A 1TIJA 3UL5A 1FUWA 1M9GA 5A0OB 1R4CA 1ROAA 3L0RA 1WNHA 3Q2PA 1MOLA 1LXEA 5LC7A 3NX0A 1YVBI 4LZIA 4EYCA 4N6UA 3KSED 1A67A 1N5PA 1IV7A 3MWZA 2KXGA 3PXMA 4N6V0 3QRDA 1STFI 3KFQC 1DVCA 1IV9A 3PS8A 1FA3A 3PYJA 4TX4A 5ELUA 4N6NB 3UL6A 1N9JA 3S67A 1N5HA 1G96A 1KWIA 1NB3I 2W9PA 4N6MA 3LH4A 3K9MC 1A90A 3SVAA 2BO9B 4N6OB 3GAXA 1GD3A 1GD4A 2OCTA 1CYVA 1DVDA 1PFPA 5ELJA 5LC6A 2W9QA 3IMAB 1MNLA 4N6TA 1NB5I 1EQKA 1CYUA 4N6LA 5EQLA 1CEWI 4ZM8A 2CH9A 1RN7A 4CCVA
chains in the Genus database with same CATH superfamily
2XSOB 5STDA 2OOVA 5KP4A 5CF1A 1X1UA 1HZ1A 1RDSA 4WYKB 2C11A 5KP1A 2CFKA 1TIJA 3FSDA 3S29A 5JPPA 1RRHA 3EN8A 4LYLB 5G1KA 3KE7A 2JDIH 1IU7A 4R4KA 3HI7A 1W2ZA 1M9GA 2BIRA 1ROAA 3N8BA 1KSIA 1LOWA 3AMOA 3ECFA 4STDA 1C54A 2HMLB 4K90B 1EG9B 3D4AA 3Q2PA 4OUQA 4MJDA 2LQVA 3G6E3 3D3LA 1VQ63 1JZDA 1MOLA 1LXEA 3CMA3 2SBLA 2XGNA 1MWRA 4BTYA 4XBXA 1B20A 3SEDA 5BU4A 3DGLA 2WGOA 2XFSA 2CWVA 4KFDA 1VQK3 4HM7B 2QEX3 2QA43 3E99A 1W7CA 1N9EA 1JBTA 3WMDA 4BTWA 3CC43 1O7HB 5TGNA 3T0UA 4MMZB 3H51A 1D6UA 1A2PA 3AMOB 1W01A 3VSYA 1N5PA 4BL3A 4EXRA 2FNQA 1MGWA 2YFLB 3QK9A 1TFKA 4L8PA 5IG0A 3PCRA 2HMKB 2XEPA 3NBRA 4KVHA 2MF7A 2D42A 1JN5A 1ULIB 4FCMA 1ISKA 1YHQ3 4WP5A 1DVCA 3DUKA 1IV9A 1VQ43 2OQEC 2W0QA 1UUWB 1CQSA 2F56A 1W6GA 1BRGA 1FGMA 1N8QA 3OXAA 1YIJ3 2P09A 2ZDJA 4MEIA 2CK3H 1N8R4 1GY5A 1TFOA 1Y4KA 2KF5A 3LT9A 3CCR3 1IQXA 3NHXA 2HMNB 4HBRA 2M7OA 1B27A 4N6NB 3SOYA 3LTBA 1RGLA 3CCV3 3MG1A 1IYYA 3ROBA 2XFTA 3S67A 1C7HA 1U8CB 1KWIA 1K41A 2E2TA 4FMDA 2R41A 6RNTA 2GXFA 1SJWA 2RCDA 1YJ93 1DMMA 2UX0A 1JN5B 3MPHA 1IK3A 3STDA 3LTDA 2GU3A 3CXC2 1AV4A 4R1KA 2Z76A 3EC9A 3PZWA 1RLSA 1WTHA 1OUNA 3JUOA 3IPTA 1K734 2FXTA 1DMQA 1IT8A 1BGSA 2IA7A 3HZPA 5CLKA 3S27A 1GD3A 1RGCA 4EBGA 1LNHA 3X41A 1WMOA 1B2XA 1MWSA 1BRHA 2QIYA 3LOYA 1OHOA 5ELJA 3V99A 3KKGA 1ZS7A 3RGAA 3V92A 5LC6A 3F14A 4U13A 1NB5I 2CC3A 1YJW3 1S5AA 3B4OA 3G8ZA 1DETA 3JUQA 4CJNA 3CCE3 4FCJA 2Z7AA 4N6LA 1DYUA 5EQLA 3VGNA 2H0HA 2UUGC 1Q814 4K61A 5CF2A 3O8YA 1GSPA 2CFGA 1IVXA 5AEWB 3SXXA 3SYUA 2P0MA 2XGLA 4J8TA 1OGXA 2HMOB 1TTOA 2JQ5A 4HZBB 3NM7A 3BLZA 1JB4A 1T3BA 1QJGA 1I8VA 1ZGXA 4HM5B 4XDVA 1UCLA 4PEJA 1LQMB 1DMNA 1FUWA 3M8CA 2Z77A 4BTXA 5A0OB 1R4CA 4EV2A 1VQM3 1WNHA 5AIIA 5M19A 1K9M4 8RNTA 1STDA 3FF2A 3X3YA 3GRDA 5IENA 2F4YA 3FZWA 1GOUA 1J2BA 2F5WA 1FUTA 3URPA 7GSPA 1RGEA 2RBIA 4JF8A 1RTUA 3BNCA 3AHSA 4L7KA 2L1SA 1SQWA 4GHOA 1YGEA 4RNYA 1V57A 3G0KA 4FMAA 1MWUA 1O7NB 3MHEA 4LZIA 3KSPA 3N54B 3GZXB 1RN1A 3F9SA 1FGRA 4AKZA 1AVKA 1ZO2A 2L4VA 1EUIC 3FG4A 3B8LA 1YNVX 2XRXB 3AGOA 4HJLB 5IG3A 3CC23 2GEYA 1TU5A 2RFRA 1VQO3 1BRJA 3ZG0A 2ZL8A 3J7Yd 3WR2A 3ALAA 4N6V0 3FF0A 5AEUB 1M904 3QRDA 1STFI 3CC73 1NU3A 4GL6A 1MGRA 4XDWA 2XH9A 4JRFA 1BRNL 3UB1A 4IIAA 3BU4A 2OQEA 5HOHA 1LOXA 3B4PA 3I0YA 1LOVA 1RSNA 4AEQA 2IY2A 4ORLA 3UNLA 1LNIA 2INXA 3Q3FA 1Q42A 3PS8A 1K28A 1NO3A 1W00A 1ZX2A 5DRVA 3DM8A 1V74A 4OVMA 5ELUA 5IG4A 3I553 3U1WA 1UDII 1JV2B 1O7PB 1RJOA 1O7WB 1ASKA 3H3HA 4XBTA 1PU4A 1L5GB 1I0XA 9RNTA 1KD14 1G96A 4O8SA 1UGHI 4LGQA 1JRQA 1OACA 1Q864 3G713 1I2EA 1MWTA 2A15A 2J8XB 2Q07A 1BUQA 4HM1B 4HM6B 2MC8A 1B2SA 2W9PA 3NQZA 1FGTA 3GZBA 1QAKA 2KAAA 2BT3A 4N6MA 3LH4A 1UW1A 1OCVA 1QMAA 1U5OA 3DXOA 3HK4A 1Q7HA 2XSHB 1SARA 3ZG5A 1GOVA 3WA2X 3GAXA 1B2ZA 1T2IA 1GD4A 2OCTA 1IQ8A 3UJMA 3CPOA 1RRLA 2CG0A 3NV0A 2HMJB 3KIIA 1LOYA 3AGNA 4KZ1A 3CCJ3 2C4BA 3EBYA 3IMAB 4HAAA 1LRAA 1QVG2 1MNLA 3RDEA 4RNZA 1I2GA 1TJDA 3DMCA 3WA3A 3KZTA 4AKYA 1FGOA 2AADA 1WQLB 3MG3A 2GBWB 4R80A 1JBSA 1CYUA 1BRSA 3EF8A 2BMRB 2V1LA 5IERA 1BNRA 3LZAA 1JKGA 5AIHA 1UUGB 4KFFA 2AAEA 3GSPA 1JJ22 3CCU3 1B3SA 4WFOA 2GSPA 2H0IA 3EJVA 5BIRA 1RNTA 4IT7A 3F8XA 3D5IA 5RNTA 1NJI4 2BMOB 2YX9A 3ER7A 3NV0B 1QAFA 3UL5A 2CFWA 2P05A 3PGBA 1NNVA 5JBSA 5IG5A 3G16A 3CCM3 2STDA 3IJEB 1QALA 3FG1A 5D83A 3DY5A 2B24B 1Q9EA 1B2UA 5CXOA 1JZOA 3GZYB 1X1XA 4GB5A 4X2HA 5AIGA 1JKGB 1TUHA 2BMQB 2KCDA 2ZHXB 5LC7A 4MMXB 3HX8A 5AIFA 5FW5A 1R4YA 2K3DA 5EEOA 1AQZA 2I9WA 1US1A 3T8UA 4J9AA 3HIGA 4NREA 3PCSA 1IT7A 3BIRA 4EV5A 1RKYA 1BNJA 3SOAA 4HM0B 2IUJA 1KC84 1M1K4 4EYCA 4N6UA 5G2GA 1Q824 2CHCA 2R4IA 1G02A 3X42A 1JNQA 1OGZA 3WHOA 3X3XA 1BVIA 1UI7A 4KFEA 5G1LA 5KP3A 1ULJB 5EVHA 2KXGA 4N3VA 5AYSC 1I3FA 1YVSA 3CCL3 3K5TA 2HOHA 1RGHA 1BSCA 2CX1A 1RN4A 3KFQC 4J5KA 4XBYA 1X1YA 1BUJA 3FGYA 3AHWA 5IW9A 1RNBA 3N9HA 3G4S3 1TRQA 4HM4B 2OWPA 1DE3A 3D5GA 3LT8A 2OTJ3 2P38A 2KF4A 3K63A 4FMBA 1I2FA 3EHCA 2K0MA 3PYJA 2WOFA 1S723 1HU9A 3NQYA 2CW9A 2H0GA 3RGRA 5FGOA 3JUNA 1BNGA 3NBBA 2CWTA 1YJN3 1I70A 2C10A 4FMCA 3VF1A 4HM3B 1G0TA 1NB3I 1CH0A 1BRKA 2CFLA 1SIHA 1Z1SA 3FH1A 1RGKA 3TDGA 3K9MC 1FZUA 1UCJA 3D79A 3FG3A 3SX1A 4EC6A 1A90A 3SVAA 2W56A 3LMLA 4N6OB 4RZMA 3WOEB 3WODG 3HOHA 4CDLA 1VQN3 1RMSA 1GMRA 1GYBA 3Q1CA 1KQS2 1CYVA 3MYTA 3OWYA 2BNGA 1VQP3 4KT3B 3FCSB 1PFPA 4HZ9B 1QVF2 4BIRA 3CPW2 2CIUA 4K1VA 4I4KA 1RCLA 3SLUA 3I563 3CME3 2OTL3 4N6TA 3LTCA 1BU4A 1FUSA 2Y73A 3KN4A 2WOHA 2LYXA 3F40A 2W04A 1BNIA 4R9KA 5D82A 2B1XB 2F99A 3F8HA 5AYRB 1RHLA 4HOHA 4CCVA 7RNTA 2W56B 4H61A 2CG1A 4EW5A 1WMPA 1O7GB 3OV4A 5DREA 5BXQA 3EN1B 2O9UX 4K1UA 1VQ53 4Q53A 1E3RA 1A2KA 4QWTA 3CNMA 1RCKA 4RBNA 2OOVC 3HIIA 1I0VA 2O3OA 1AR0A 4OK0A 1BANA 1PYLA 1VZZA 4HM2B 1EEJA 2GU1A 3U97A 4BU4A 1JBRA 3BNEA 3L0RA 3B7CA 5D81A 1Q7Y4 1BRIA 3FKAA 1WMNA 3D9RA 1VQ93 2UGIA 3FLJA 3BB9A 2RSXA 3K0ZA 5IEOA 7STDA 2BHMA 2YFIB 1OHPA 2BU4A 3EX9A 1SIIA 1AY7A 2D1WA 3NM2A 1UUVB 4WHAA 2W2CA 1VQ73 3JUMA 3CU3A 3NX0A 4XM4A 1E97A 2RGQA 4NPBA 1UCKA 2IMJA 3EQQB 1PY3A 2XF3A 4X2OA 3MSOA 5M1AA 3S28A 2CFDA 5JPUA 3LTAA 1YI23 2CWUA 3OX9A 1YGWA 1YVBI 5BVBA 1IQYA 1A2VA 1LVNA 2P0XA 2XR8B 3JVCA 4HKVB 4O02B 1LQGC 3LYGA 1EA2A 1HYFA 3OWSA 5GSPA 8CHOA 5CK6A 3CCS3 4WWUC 1V58A 1YIT3 3F7SA 4HYZA 1FYSA 3DGNA 3MG2A 1E3VA 3KSED 2ZA4A 2E2UA 1A67A 2FGTA 2WGQA 1BNFA 5IEPA 1F8NA 2Y74A 1I3IA 3GWRA 1IV7A 3MWZA 3WDGB 3PXMA 3EB8A 3S5CA 3EE1A 4LEHA 1FW7A 1IVWA 3JUPA 1D6YA 1B21A 4HVNA 5HGRA 1VQL3 3CD63 3T8NA 1EKMA 3X3ZA 1TRPA 2Z6BA 4XB5A 3OWUA 1HKXA 4O3VA 6STDA 5I97A 1K8A4 3BNDA 3DGMA 3MKIA 3DH2A 4HM8B 1Q40A 3EBTA 3V98A 3WOFB 2ML6A 1FA3A 1IVVA 4CPKA 1BSBA 1OF5A 3A76A 2KF6A 4TX4A 3ZFZA 1IDPA 4FR9A 1NWWA 2YFJB 1B2MA 1BIRA 3Q90A 4R9LA 3UL6A 1FGQA 2HMMB 3DZLA 1BSDA 1ROVA 2F98A 2IYJA 2F86B 2W6JH 3K7CA 2RNTA 4G1MB 1N9JA 1OHSA 1W6YA 1W6CA 4MMYB 1M1XB 1N5HA 2PZVA 3LXUX 4NHFA 1JB5A 1W4NA 3F7XA 6GSPA 1OH0A 4LSOA 4GSPA 1T2HA 2IUKA 2KF3A 1SPUA 1RGFA 4DKIA 2QGUA 1T5YA 3BNBA 4BL2A 3OW22 1JB2A 2F5MA 4IPBA 1GY7A 1W2B2 1O7MB 5IF6A 4RNTA 3DGYA 1BOXA 1Q40B 1RGAA 1VQQA 3NUVA 4FCZA 4LMIA 2BO9B 1UGIA 3GZRA 2PNCA 3X40A 2K54A 2GBXB 1OF5B 1BSAA 1GS3A 2SARA 1DVDA 1W5ZA 2E2VA 4I5QA 3KCHA 1GOYA 1UCIA 4WYKA 4L8OA 1GMPA 1GY6A 1TP6A 2WO0A 3RNTA 2W9QA 1GMQA 2CKFB 1X1WA 2GEXA 3DGOA 3CCQ3 1NDOB 3A5EA 1EQKA 4H3UA 3CNXA 5AI1A 5M18A 3NBJA 1VQ83 2W03A 1BNEA 1BSEA 3NXJA 1CEWI 2ML5A 4O2HA 1AVLA 4ZM8A 1BNSA 1BAOA 4ILFA 1IVUA 2CH9A 4J5GA 1RN7A 1RGGA 1D6ZA 1W02A 1OPYA 2KRTA 1UI8A 2CX0A
chains in the Genus database with same CATH topology
2XSOB 5STDA 2OOVA 5KP4A 5CF1A 4WYKB 2C11A 5KP1A 2CFKA 1TIJA 3FSDA 3S29A 5JPPA 1RRHA 3EN8A 3KE7A 2JDIH 1IU7A 4R4KA 3HI7A 1W2ZA 1M9GA 1ROAA 3N8BA 1KSIA 3ECFA 3AMOA 4STDA 2HMLB 4K90B 1EG9B 3Q2PA 4OUQA 4MJDA 2LQVA 3G6E3 3D3LA 1VQ63 1MOLA 1LXEA 3CMA3 2SBLA 2XGNA 4BTYA 4XBXA 3SEDA 3DGLA 2WGOA 2XFSA 2CWVA 4KFDA 1VQK3 4HM7B 2QEX3 2QA43 3E99A 1W7CA 1N9EA 3WMDA 4BTWA 3CC43 1O7HB 5TGNA 3T0UA 4MMZB 3H51A 1D6UA 3AMOB 1W01A 3VSYA 1N5PA 4EXRA 2FNQA 2YFLB 3QK9A 1TFKA 4L8PA 5IG0A 3PCRA 2HMKB 2XEPA 3NBRA 4KVHA 2MF7A 2D42A 1JN5A 1ULIB 4FCMA 1ISKA 1YHQ3 4WP5A 1DVCA 3DUKA 1IV9A 1VQ43 2OQEC 2W0QA 1UUWB 1CQSA 1W6GA 3OXAA 1FGMA 1N8QA 1YIJ3 2P09A 2ZDJA 4MEIA 2CK3H 1N8R4 1GY5A 1TFOA 1Y4KA 3CCR3 3LT9A 1IQXA 3NHXA 2HMNB 4HBRA 2M7OA 4N6NB 3SOYA 3LTBA 3CCV3 3MG1A 3ROBA 2XFTA 3S67A 1C7HA 1U8CB 1KWIA 1K41A 2E2TA 4FMDA 2GXFA 1SJWA 2RCDA 1YJ93 1DMMA 2UX0A 1JN5B 3MPHA 1IK3A 3STDA 3LTDA 2GU3A 3CXC2 1AV4A 4R1KA 3EC9A 3PZWA 1WTHA 1OUNA 3JUOA 3IPTA 1K734 2FXTA 1DMQA 1IT8A 2IA7A 5CLKA 3HZPA 3S27A 1GD3A 4EBGA 1LNHA 3X41A 1WMOA 2QIYA 3LOYA 1OHOA 5ELJA 3V99A 3KKGA 3RGAA 3V92A 5LC6A 3F14A 4U13A 1NB5I 2CC3A 1YJW3 1S5AA 3B4OA 3G8ZA 3JUQA 3CCE3 4FCJA 2Z7AA 4N6LA 1DYUA 5EQLA 3VGNA 1Q814 4K61A 5CF2A 3O8YA 2CFGA 1IVXA 5AEWB 3SXXA 2P0MA 2XGLA 4J8TA 1OGXA 2HMOB 2JQ5A 4HZBB 3NM7A 3BLZA 1JB4A 1QJGA 4HM5B 4XDVA 4PEJA 1DMNA 1FUWA 3M8CA 2Z77A 4BTXA 5A0OB 1R4CA 4EV2A 1VQM3 1WNHA 5AIIA 1K9M4 1STDA 3FF2A 3X3YA 3GRDA 5IENA 3FZWA 1J2BA 4JF8A 3BNCA 4L7KA 1SQWA 1YGEA 4RNYA 3G0KA 4FMAA 4LZIA 1O7NB 3MHEA 3KSPA 3N54B 3GZXB 3F9SA 1FGRA 4AKZA 1AVKA 1ZO2A 2L4VA 3FG4A 4HJLB 3B8LA 5IG3A 2XRXB 3CC23 2GEYA 1TU5A 2RFRA 1VQO3 2ZL8A 3J7Yd 1M904 3ALAA 4N6V0 3FF0A 5AEUB 3QRDA 1STFI 3CC73 1NU3A 4GL6A 4XDWA 2XH9A 4JRFA 3UB1A 4IIAA 2OQEA 1LOXA 3B4PA 3I0YA 4AEQA 3UNLA 4ORLA 2INXA 1Q42A 3PS8A 1K28A 1NO3A 1W00A 1ZX2A 5DRVA 3DM8A 1V74A 4OVMA 5ELUA 5IG4A 3I553 3U1WA 1JV2B 1O7PB 1RJOA 1O7WB 1ASKA 3H3HA 4XBTA 1PU4A 1L5GB 1KD14 1G96A 4O8SA 4LGQA 1JRQA 1OACA 1Q864 3G713 2A15A 1BUQA 2Q07A 4HM1B 4HM6B 2MC8A 2W9PA 3NQZA 1FGTA 3GZBA 1QAKA 2BT3A 4N6MA 3LH4A 1UW1A 1OCVA 1QMAA 1U5OA 3DXOA 3HK4A 2XSHB 3WA2X 3GAXA 1GD4A 2OCTA 1IQ8A 3UJMA 3CPOA 1RRLA 2CG0A 3NV0A 2HMJB 3KIIA 3CCJ3 4KZ1A 3EBYA 3IMAB 1QVG2 1MNLA 3RDEA 4RNZA 3DMCA 3WA3A 3KZTA 4AKYA 1FGOA 1CYUA 1WQLB 3MG3A 2GBWB 4R80A 3EF8A 2BMRB 2V1LA 5IERA 3LZAA 1JKGA 5AIHA 4KFFA 1JJ22 3CCU3 4WFOA 3EJVA 4IT7A 3F8XA 1NJI4 2BMOB 2YX9A 3ER7A 3NV0B 1QAFA 3UL5A 2CFWA 2P05A 3PGBA 5JBSA 5IG5A 3G16A 3CCM3 2STDA 3IJEB 1QALA 3FG1A 5D83A 3DY5A 2B24B 5CXOA 3GZYB 4GB5A 4X2HA 5AIGA 1JKGB 1TUHA 2BMQB 2KCDA 5LC7A 4MMXB 3HX8A 5AIFA 5FW5A 5EEOA 2I9WA 1US1A 3T8UA 4J9AA 3HIGA 4NREA 3PCSA 1IT7A 4EV5A 1RKYA 3SOAA 4HM0B 2IUJA 1KC84 1M1K4 4EYCA 4N6UA 5G2GA 1Q824 2CHCA 2R4IA 3X42A 1JNQA 1OGZA 3X3XA 1UI7A 4KFEA 5KP3A 1ULJB 5EVHA 2KXGA 4N3VA 5AYSC 3CCL3 3K5TA 3KFQC 4XBYA 3FGYA 5IW9A 3N9HA 3G4S3 4HM4B 2OWPA 3LT8A 2OTJ3 2P38A 3K63A 4FMBA 3EHCA 2K0MA 3PYJA 2WOFA 1S723 1HU9A 3NQYA 2CW9A 3RGRA 5FGOA 3JUNA 3NBBA 2CWTA 1YJN3 2C10A 4FMCA 3VF1A 4HM3B 1NB3I 2CFLA 1SIHA 1Z1SA 3FH1A 3TDGA 3K9MC 3FG3A 3SX1A 4EC6A 1A90A 3SVAA 2W56A 3LMLA 4N6OB 4RZMA 3WOEB 3WODG 1VQN3 4CDLA 3Q1CA 1GYBA 1KQS2 1CYVA 3MYTA 3OWYA 2BNGA 1VQP3 1QVF2 3FCSB 1PFPA 4HZ9B 3CPW2 2CIUA 4K1VA 4I4KA 3SLUA 3I563 2KRTA 3CME3 2OTL3 4N6TA 3LTCA 2Y73A 3KN4A 2WOHA 2LYXA 3F40A 2W04A 4R9KA 5D82A 2B1XB 2F99A 3F8HA 5AYRB 4CCVA 2W56B 4H61A 1WMPA 1O7GB 3OV4A 5DREA 5BXQA 3EN1B 2O9UX 4K1UA 1VQ53 4Q53A 1E3RA 1A2KA 4QWTA 3CNMA 4RBNA 2OOVC 3HIIA 2O3OA 1AR0A 4OK0A 1VZZA 4HM2B 2GU1A 3U97A 3BNEA 3L0RA 3B7CA 5D81A 1Q7Y4 3FKAA 1WMNA 3D9RA 1VQ93 3FLJA 3BB9A 2RSXA 3K0ZA 5IEOA 7STDA 2BHMA 2YFIB 1OHPA 3EX9A 1SIIA 2D1WA 3NM2A 1VQ73 1UUVB 4WHAA 2W2CA 3JUMA 3CU3A 3NX0A 4XM4A 1E97A 2RGQA 2IMJA 3EQQB 2XF3A 4X2OA 5JPUA 3MSOA 3S28A 2CFDA 3LTAA 1YI23 2CWUA 3OX9A 1YVBI 5BVBA 1IQYA 1A2VA 1LVNA 2P0XA 2XR8B 3JVCA 4HKVB 4O02B 2CG1A 3LYGA 1EA2A 3OWSA 8CHOA 5CK6A 3CCS3 4WWUC 1YIT3 3F7SA 4HYZA 3DGNA 3MG2A 1E3VA 3KSED 2E2UA 1A67A 2FGTA 2WGQA 5IEPA 1F8NA 2Y74A 3GWRA 3WDGB 1IV7A 3MWZA 3PXMA 3EB8A 3S5CA 3EE1A 4LEHA 1IVWA 3JUPA 1D6YA 4HVNA 5HGRA 1VQL3 3CD63 3T8NA 1EKMA 3X3ZA 2Z6BA 4XB5A 3OWUA 1HKXA 4O3VA 6STDA 5I97A 1K8A4 3BNDA 3DGMA 3MKIA 4HM8B 1Q40A 3EBTA 3V98A 3WOFB 2ML6A 1FA3A 1IVVA 1OF5A 3A76A 4TX4A 1IDPA 4FR9A 1NWWA 2YFJB 3Q90A 4R9LA 3UL6A 1FGQA 2HMMB 3DZLA 1ROVA 3K7CA 2F98A 2W6JH 2F86B 4G1MB 4MMYB 1N9JA 1OHSA 1W6YA 1W6CA 1M1XB 1N5HA 2PZVA 3LXUX 4NHFA 1JB5A 1W4NA 3F7XA 1OH0A 4LSOA 2IUKA 1SPUA 3OW22 2QGUA 1T5YA 3BNBA 1JB2A 4IPBA 1GY7A 1W2B2 1O7MB 5IF6A 4LMIA 1Q40B 3NUVA 4FCZA 2BO9B 3X40A 3GZRA 2PNCA 2K54A 2GBXB 1OF5B 1GS3A 1DVDA 1W5ZA 2E2VA 4WYKA 4L8OA 1TP6A 1GY6A 2WO0A 2W9QA 2CKFB 2GEXA 3DGOA 3CCQ3 1NDOB 1EQKA 4H3UA 3CNXA 5AI1A 3NBJA 1VQ83 2W03A 3NXJA 1CEWI 2ML5A 4O2HA 1AVLA 4ZM8A 1IVUA 2CH9A 1RN7A 1D6ZA 1W02A 1OPYA 2Z76A 1UI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9U X;  4IT7 A;  1TIJ A;  3UL5 A;  1FUW A;  1M9G A;  5A0O B;  1R4C A;  1ROA A;  3L0R A;  1WNH A;  3Q2P A;  1MOL A;  1LXE A;  5LC7 A;  3NX0 A;  1YVB I;  4LZI A;  4EYC A;  4N6U A;  3KSE D;  1A67 A;  1N5P A;  1IV7 A;  3MWZ A;  2KXG A;  3PXM A;  4N6V 0;  3QRD A;  1STF I;  3KFQ C;  1DVC A;  1IV9 A;  3PS8 A;  1FA3 A;  3PYJ A;  4TX4 A;  5ELU A;  4N6N B;  3UL6 A;  1N9J A;  3S67 A;  1N5H A;  1G96 A;  1KWI A;  1NB3 I;  2W9P A;  4N6M A;  3LH4 A;  3K9M C;  1A90 A;  3SVA A;  2BO9 B;  4N6O B;  3GAX A;  1GD3 A;  1GD4 A;  2OCT A;  1CYV A;  1DVD A;  1PFP A;  5ELJ A;  5LC6 A;  2W9Q A;  3IMA B;  1MNL A;  4N6T A;  1NB5 I;  1EQK A;  1CYU A;  4N6L A;  5EQL A;  1CEW I;  4ZM8 A;  2CH9 A;  1RN7 A;  4CCV A; 
#chains in the Genus database with same CATH topology
 2XSO B;  5STD A;  2OOV A;  5KP4 A;  5CF1 A;  1X1U A;  1HZ1 A;  1RDS A;  4WYK B;  2C11 A;  5KP1 A;  2CFK A;  1TIJ A;  3FSD A;  3S29 A;  5JPP A;  1RRH A;  3EN8 A;  4LYL B;  5G1K A;  3KE7 A;  2JDI H;  1IU7 A;  4R4K A;  3HI7 A;  1W2Z A;  1M9G A;  2BIR A;  1ROA A;  3N8B A;  1KSI A;  1LOW A;  3AMO A;  3ECF A;  4STD A;  1C54 A;  2HML B;  4K90 B;  1EG9 B;  3D4A A;  3Q2P A;  4OUQ A;  4MJD A;  2LQV A;  3G6E 3;  3D3L A;  1VQ6 3;  1JZD A;  1MOL A;  1LXE A;  3CMA 3;  2SBL A;  2XGN A;  1MWR A;  4BTY A;  4XBX A;  1B20 A;  3SED A;  5BU4 A;  3DGL A;  2WGO A;  2XFS A;  2CWV A;  4KFD A;  1VQK 3;  4HM7 B;  2QEX 3;  2QA4 3;  3E99 A;  1W7C A;  1N9E A;  1JBT A;  3WMD A;  4BTW A;  3CC4 3;  1O7H B;  5TGN A;  3T0U A;  4MMZ B;  3H51 A;  1D6U A;  1A2P A;  3AMO B;  1W01 A;  3VSY A;  1N5P A;  4BL3 A;  4EXR A;  2FNQ A;  1MGW A;  2YFL B;  3QK9 A;  1TFK A;  4L8P A;  5IG0 A;  3PCR A;  2HMK B;  2XEP A;  3NBR A;  4KVH A;  2MF7 A;  2D42 A;  1JN5 A;  1ULI B;  4FCM A;  1ISK A;  1YHQ 3;  4WP5 A;  1DVC A;  3DUK A;  1IV9 A;  1VQ4 3;  2OQE C;  2W0Q A;  1UUW B;  1CQS A;  2F56 A;  1W6G A;  1BRG A;  1FGM A;  1N8Q A;  3OXA A;  1YIJ 3;  2P09 A;  2ZDJ A;  4MEI A;  2CK3 H;  1N8R 4;  1GY5 A;  1TFO A;  1Y4K A;  2KF5 A;  3LT9 A;  3CCR 3;  1IQX A;  3NHX A;  2HMN B;  4HBR A;  2M7O A;  1B27 A;  4N6N B;  3SOY A;  3LTB A;  1RGL A;  3CCV 3;  3MG1 A;  1IYY A;  3ROB A;  2XFT A;  3S67 A;  1C7H A;  1U8C B;  1KWI A;  1K41 A;  2E2T A;  4FMD A;  2R41 A;  6RNT A;  2GXF A;  1SJW A;  2RCD A;  1YJ9 3;  1DMM A;  2UX0 A;  1JN5 B;  3MPH A;  1IK3 A;  3STD A;  3LTD A;  2GU3 A;  3CXC 2;  1AV4 A;  4R1K A;  2Z76 A;  3EC9 A;  3PZW A;  1RLS A;  1WTH A;  1OUN A;  3JUO A;  3IPT A;  1K73 4;  2FXT A;  1DMQ A;  1IT8 A;  1BGS A;  2IA7 A;  3HZP A;  5CLK A;  3S27 A;  1GD3 A;  1RGC A;  4EBG A;  1LNH A;  3X41 A;  1WMO A;  1B2X A;  1MWS A;  1BRH A;  2QIY A;  3LOY A;  1OHO A;  5ELJ A;  3V99 A;  3KKG A;  1ZS7 A;  3RGA A;  3V92 A;  5LC6 A;  3F14 A;  4U13 A;  1NB5 I;  2CC3 A;  1YJW 3;  1S5A A;  3B4O A;  3G8Z A;  1DET A;  3JUQ A;  4CJN A;  3CCE 3;  4FCJ A;  2Z7A A;  4N6L A;  1DYU A;  5EQL A;  3VGN A;  2H0H A;  2UUG C;  1Q81 4;  4K61 A;  5CF2 A;  3O8Y A;  1GSP A;  2CFG A;  1IVX A;  5AEW B;  3SXX A;  3SYU A;  2P0M A;  2XGL A;  4J8T A;  1OGX A;  2HMO B;  1TTO A;  2JQ5 A;  4HZB B;  3NM7 A;  3BLZ A;  1JB4 A;  1T3B A;  1QJG A;  1I8V A;  1ZGX A;  4HM5 B;  4XDV A;  1UCL A;  4PEJ A;  1LQM B;  1DMN A;  1FUW A;  3M8C A;  2Z77 A;  4BTX A;  5A0O B;  1R4C A;  4EV2 A;  1VQM 3;  1WNH A;  5AII A;  5M19 A;  1K9M 4;  8RNT A;  1STD A;  3FF2 A;  3X3Y A;  3GRD A;  5IEN A;  2F4Y A;  3FZW A;  1GOU A;  1J2B A;  2F5W A;  1FUT A;  3URP A;  7GSP A;  1RGE A;  2RBI A;  4JF8 A;  1RTU A;  3BNC A;  3AHS A;  4L7K A;  2L1S A;  1SQW A;  4GHO A;  1YGE A;  4RNY A;  1V57 A;  3G0K A;  4FMA A;  1MWU A;  1O7N B;  3MHE A;  4LZI A;  3KSP A;  3N54 B;  3GZX B;  1RN1 A;  3F9S A;  1FGR A;  4AKZ A;  1AVK A;  1ZO2 A;  2L4V A;  1EUI C;  3FG4 A;  3B8L A;  1YNV X;  2XRX B;  3AGO A;  4HJL B;  5IG3 A;  3CC2 3;  2GEY A;  1TU5 A;  2RFR A;  1VQO 3;  1BRJ A;  3ZG0 A;  2ZL8 A;  3J7Y d;  3WR2 A;  3ALA A;  4N6V 0;  3FF0 A;  5AEU B;  1M90 4;  3QRD A;  1STF I;  3CC7 3;  1NU3 A;  4GL6 A;  1MGR A;  4XDW A;  2XH9 A;  4JRF A;  1BRN L;  3UB1 A;  4IIA A;  3BU4 A;  2OQE A;  5HOH A;  1LOX A;  3B4P A;  3I0Y A;  1LOV A;  1RSN A;  4AEQ A;  2IY2 A;  4ORL A;  3UNL A;  1LNI A;  2INX A;  3Q3F A;  1Q42 A;  3PS8 A;  1K28 A;  1NO3 A;  1W00 A;  1ZX2 A;  5DRV A;  3DM8 A;  1V74 A;  4OVM A;  5ELU A;  5IG4 A;  3I55 3;  3U1W A;  1UDI I;  1JV2 B;  1O7P B;  1RJO A;  1O7W B;  1ASK A;  3H3H A;  4XBT A;  1PU4 A;  1L5G B;  1I0X A;  9RNT A;  1KD1 4;  1G96 A;  4O8S A;  1UGH I;  4LGQ A;  1JRQ A;  1OAC A;  1Q86 4;  3G71 3;  1I2E A;  1MWT A;  2A15 A;  2J8X B;  2Q07 A;  1BUQ A;  4HM1 B;  4HM6 B;  2MC8 A;  1B2S A;  2W9P A;  3NQZ A;  1FGT A;  3GZB A;  1QAK A;  2KAA A;  2BT3 A;  4N6M A;  3LH4 A;  1UW1 A;  1OCV A;  1QMA A;  1U5O A;  3DXO A;  3HK4 A;  1Q7H A;  2XSH B;  1SAR A;  3ZG5 A;  1GOV A;  3WA2 X;  3GAX A;  1B2Z A;  1T2I A;  1GD4 A;  2OCT A;  1IQ8 A;  3UJM A;  3CPO A;  1RRL A;  2CG0 A;  3NV0 A;  2HMJ B;  3KII A;  1LOY A;  3AGN A;  4KZ1 A;  3CCJ 3;  2C4B A;  3EBY A;  3IMA B;  4HAA A;  1LRA A;  1QVG 2;  1MNL A;  3RDE A;  4RNZ A;  1I2G A;  1TJD A;  3DMC A;  3WA3 A;  3KZT A;  4AKY A;  1FGO A;  2AAD A;  1WQL B;  3MG3 A;  2GBW B;  4R80 A;  1JBS A;  1CYU A;  1BRS A;  3EF8 A;  2BMR B;  2V1L A;  5IER A;  1BNR A;  3LZA A;  1JKG A;  5AIH A;  1UUG B;  4KFF A;  2AAE A;  3GSP A;  1JJ2 2;  3CCU 3;  1B3S A;  4WFO A;  2GSP A;  2H0I A;  3EJV A;  5BIR A;  1RNT A;  4IT7 A;  3F8X A;  3D5I A;  5RNT A;  1NJI 4;  2BMO B;  2YX9 A;  3ER7 A;  3NV0 B;  1QAF A;  3UL5 A;  2CFW A;  2P05 A;  3PGB A;  1NNV A;  5JBS A;  5IG5 A;  3G16 A;  3CCM 3;  2STD A;  3IJE B;  1QAL A;  3FG1 A;  5D83 A;  3DY5 A;  2B24 B;  1Q9E A;  1B2U A;  5CXO A;  1JZO A;  3GZY B;  1X1X A;  4GB5 A;  4X2H A;  5AIG A;  1JKG B;  1TUH A;  2BMQ B;  2KCD A;  2ZHX B;  5LC7 A;  4MMX B;  3HX8 A;  5AIF A;  5FW5 A;  1R4Y A;  2K3D A;  5EEO A;  1AQZ A;  2I9W A;  1US1 A;  3T8U A;  4J9A A;  3HIG A;  4NRE A;  3PCS A;  1IT7 A;  3BIR A;  4EV5 A;  1RKY A;  1BNJ A;  3SOA A;  4HM0 B;  2IUJ A;  1KC8 4;  1M1K 4;  4EYC A;  4N6U A;  5G2G A;  1Q82 4;  2CHC A;  2R4I A;  1G02 A;  3X42 A;  1JNQ A;  1OGZ A;  3WHO A;  3X3X A;  1BVI A;  1UI7 A;  4KFE A;  5G1L A;  5KP3 A;  1ULJ B;  5EVH A;  2KXG A;  4N3V A;  5AYS C;  1I3F A;  1YVS A;  3CCL 3;  3K5T A;  2HOH A;  1RGH A;  1BSC A;  2CX1 A;  1RN4 A;  3KFQ C;  4J5K A;  4XBY A;  1X1Y A;  1BUJ A;  3FGY A;  3AHW A;  5IW9 A;  1RNB A;  3N9H A;  3G4S 3;  1TRQ A;  4HM4 B;  2OWP A;  1DE3 A;  3D5G A;  3LT8 A;  2OTJ 3;  2P38 A;  2KF4 A;  3K63 A;  4FMB A;  1I2F A;  3EHC A;  2K0M A;  3PYJ A;  2WOF A;  1S72 3;  1HU9 A;  3NQY A;  2CW9 A;  2H0G A;  3RGR A;  5FGO A;  3JUN A;  1BNG A;  3NBB A;  2CWT A;  1YJN 3;  1I70 A;  2C10 A;  4FMC A;  3VF1 A;  4HM3 B;  1G0T A;  1NB3 I;  1CH0 A;  1BRK A;  2CFL A;  1SIH A;  1Z1S A;  3FH1 A;  1RGK A;  3TDG A;  3K9M C;  1FZU A;  1UCJ A;  3D79 A;  3FG3 A;  3SX1 A;  4EC6 A;  1A90 A;  3SVA A;  2W56 A;  3LML A;  4N6O B;  4RZM A;  3WOE B;  3WOD G;  3HOH A;  4CDL A;  1VQN 3;  1RMS A;  1GMR A;  1GYB A;  3Q1C A;  1KQS 2;  1CYV A;  3MYT A;  3OWY A;  2BNG A;  1VQP 3;  4KT3 B;  3FCS B;  1PFP A;  4HZ9 B;  1QVF 2;  4BIR A;  3CPW 2;  2CIU A;  4K1V A;  4I4K A;  1RCL A;  3SLU A;  3I56 3;  3CME 3;  2OTL 3;  4N6T A;  3LTC A;  1BU4 A;  1FUS A;  2Y73 A;  3KN4 A;  2WOH A;  2LYX A;  3F40 A;  2W04 A;  1BNI A;  4R9K A;  5D82 A;  2B1X B;  2F99 A;  3F8H A;  5AYR B;  1RHL A;  4HOH A;  4CCV A;  7RNT A;  2W56 B;  4H61 A;  2CG1 A;  4EW5 A;  1WMP A;  1O7G B;  3OV4 A;  5DRE A;  5BXQ A;  3EN1 B;  2O9U X;  4K1U A;  1VQ5 3;  4Q53 A;  1E3R A;  1A2K A;  4QWT A;  3CNM A;  1RCK A;  4RBN A;  2OOV C;  3HII A;  1I0V A;  2O3O A;  1AR0 A;  4OK0 A;  1BAN A;  1PYL A;  1VZZ A;  4HM2 B;  1EEJ A;  2GU1 A;  3U97 A;  4BU4 A;  1JBR A;  3BNE A;  3L0R A;  3B7C A;  5D81 A;  1Q7Y 4;  1BRI A;  3FKA A;  1WMN A;  3D9R A;  1VQ9 3;  2UGI A;  3FLJ A;  3BB9 A;  2RSX A;  3K0Z A;  5IEO A;  7STD A;  2BHM A;  2YFI B;  1OHP A;  2BU4 A;  3EX9 A;  1SII A;  1AY7 A;  2D1W A;  3NM2 A;  1UUV B;  4WHA A;  2W2C A;  1VQ7 3;  3JUM A;  3CU3 A;  3NX0 A;  4XM4 A;  1E97 A;  2RGQ A;  4NPB A;  1UCK A;  2IMJ A;  3EQQ B;  1PY3 A;  2XF3 A;  4X2O A;  3MSO A;  5M1A A;  3S28 A;  2CFD A;  5JPU A;  3LTA A;  1YI2 3;  2CWU A;  3OX9 A;  1YGW A;  1YVB I;  5BVB A;  1IQY A;  1A2V A;  1LVN A;  2P0X A;  2XR8 B;  3JVC A;  4HKV B;  4O02 B;  1LQG C;  3LYG A;  1EA2 A;  1HYF A;  3OWS A;  5GSP A;  8CHO A;  5CK6 A;  3CCS 3;  4WWU C;  1V58 A;  1YIT 3;  3F7S A;  4HYZ A;  1FYS A;  3DGN A;  3MG2 A;  1E3V A;  3KSE D;  2ZA4 A;  2E2U A;  1A67 A;  2FGT A;  2WGQ A;  1BNF A;  5IEP A;  1F8N A;  2Y74 A;  1I3I A;  3GWR A;  1IV7 A;  3MWZ A;  3WDG B;  3PXM A;  3EB8 A;  3S5C A;  3EE1 A;  4LEH A;  1FW7 A;  1IVW A;  3JUP A;  1D6Y A;  1B21 A;  4HVN A;  5HGR A;  1VQL 3;  3CD6 3;  3T8N A;  1EKM A;  3X3Z A;  1TRP A;  2Z6B A;  4XB5 A;  3OWU A;  1HKX A;  4O3V A;  6STD A;  5I97 A;  1K8A 4;  3BND A;  3DGM A;  3MKI A;  3DH2 A;  4HM8 B;  1Q40 A;  3EBT A;  3V98 A;  3WOF B;  2ML6 A;  1FA3 A;  1IVV A;  4CPK A;  1BSB A;  1OF5 A;  3A76 A;  2KF6 A;  4TX4 A;  3ZFZ A;  1IDP A;  4FR9 A;  1NWW A;  2YFJ B;  1B2M A;  1BIR A;  3Q90 A;  4R9L A;  3UL6 A;  1FGQ A;  2HMM B;  3DZL A;  1BSD A;  1ROV A;  2F98 A;  2IYJ A;  2F86 B;  2W6J H;  3K7C A;  2RNT A;  4G1M B;  1N9J A;  1OHS A;  1W6Y A;  1W6C A;  4MMY B;  1M1X B;  1N5H A;  2PZV A;  3LXU X;  4NHF A;  1JB5 A;  1W4N A;  3F7X A;  6GSP A;  1OH0 A;  4LSO A;  4GSP A;  1T2H A;  2IUK A;  2KF3 A;  1SPU A;  1RGF A;  4DKI A;  2QGU A;  1T5Y A;  3BNB A;  4BL2 A;  3OW2 2;  1JB2 A;  2F5M A;  4IPB A;  1GY7 A;  1W2B 2;  1O7M B;  5IF6 A;  4RNT A;  3DGY A;  1BOX A;  1Q40 B;  1RGA A;  1VQQ A;  3NUV A;  4FCZ A;  4LMI A;  2BO9 B;  1UGI A;  3GZR A;  2PNC A;  3X40 A;  2K54 A;  2GBX B;  1OF5 B;  1BSA A;  1GS3 A;  2SAR A;  1DVD A;  1W5Z A;  2E2V A;  4I5Q A;  3KCH A;  1GOY A;  1UCI A;  4WYK A;  4L8O A;  1GMP A;  1GY6 A;  1TP6 A;  2WO0 A;  3RNT A;  2W9Q A;  1GMQ A;  2CKF B;  1X1W A;  2GEX A;  3DGO A;  3CCQ 3;  1NDO B;  3A5E A;  1EQK A;  4H3U A;  3CNX A;  5AI1 A;  5M18 A;  3NBJ A;  1VQ8 3;  2W03 A;  1BNE A;  1BSE A;  3NXJ A;  1CEW I;  2ML5 A;  4O2H A;  1AVL A;  4ZM8 A;  1BNS A;  1BAO A;  4ILF A;  1IVU A;  2CH9 A;  4J5G A;  1RN7 A;  1RGG A;  1D6Z A;  1W02 A;  1OPY A;  2KRT A;  1UI8 A;  2CX0 A; 
#chains in the Genus database with same CATH homology
 2XSO B;  5STD A;  2OOV A;  5KP4 A;  5CF1 A;  4WYK B;  2C11 A;  5KP1 A;  2CFK A;  1TIJ A;  3FSD A;  3S29 A;  5JPP A;  1RRH A;  3EN8 A;  3KE7 A;  2JDI H;  1IU7 A;  4R4K A;  3HI7 A;  1W2Z A;  1M9G A;  1ROA A;  3N8B A;  1KSI A;  3ECF A;  3AMO A;  4STD A;  2HML B;  4K90 B;  1EG9 B;  3Q2P A;  4OUQ A;  4MJD A;  2LQV A;  3G6E 3;  3D3L A;  1VQ6 3;  1MOL A;  1LXE A;  3CMA 3;  2SBL A;  2XGN A;  4BTY A;  4XBX A;  3SED A;  3DGL A;  2WGO A;  2XFS A;  2CWV A;  4KFD A;  1VQK 3;  4HM7 B;  2QEX 3;  2QA4 3;  3E99 A;  1W7C A;  1N9E A;  3WMD A;  4BTW A;  3CC4 3;  1O7H B;  5TGN A;  3T0U A;  4MMZ B;  3H51 A;  1D6U A;  3AMO B;  1W01 A;  3VSY A;  1N5P A;  4EXR A;  2FNQ A;  2YFL B;  3QK9 A;  1TFK A;  4L8P A;  5IG0 A;  3PCR A;  2HMK B;  2XEP A;  3NBR A;  4KVH A;  2MF7 A;  2D42 A;  1JN5 A;  1ULI B;  4FCM A;  1ISK A;  1YHQ 3;  4WP5 A;  1DVC A;  3DUK A;  1IV9 A;  1VQ4 3;  2OQE C;  2W0Q A;  1UUW B;  1CQS A;  1W6G A;  3OXA A;  1FGM A;  1N8Q A;  1YIJ 3;  2P09 A;  2ZDJ A;  4MEI A;  2CK3 H;  1N8R 4;  1GY5 A;  1TFO A;  1Y4K A;  3CCR 3;  3LT9 A;  1IQX A;  3NHX A;  2HMN B;  4HBR A;  2M7O A;  4N6N B;  3SOY A;  3LTB A;  3CCV 3;  3MG1 A;  3ROB A;  2XFT A;  3S67 A;  1C7H A;  1U8C B;  1KWI A;  1K41 A;  2E2T A;  4FMD A;  2GXF A;  1SJW A;  2RCD A;  1YJ9 3;  1DMM A;  2UX0 A;  1JN5 B;  3MPH A;  1IK3 A;  3STD A;  3LTD A;  2GU3 A;  3CXC 2;  1AV4 A;  4R1K A;  3EC9 A;  3PZW A;  1WTH A;  1OUN A;  3JUO A;  3IPT A;  1K73 4;  2FXT A;  1DMQ A;  1IT8 A;  2IA7 A;  5CLK A;  3HZP A;  3S27 A;  1GD3 A;  4EBG A;  1LNH A;  3X41 A;  1WMO A;  2QIY A;  3LOY A;  1OHO A;  5ELJ A;  3V99 A;  3KKG A;  3RGA A;  3V92 A;  5LC6 A;  3F14 A;  4U13 A;  1NB5 I;  2CC3 A;  1YJW 3;  1S5A A;  3B4O A;  3G8Z A;  3JUQ A;  3CCE 3;  4FCJ A;  2Z7A A;  4N6L A;  1DYU A;  5EQL A;  3VGN A;  1Q81 4;  4K61 A;  5CF2 A;  3O8Y A;  2CFG A;  1IVX A;  5AEW B;  3SXX A;  2P0M A;  2XGL A;  4J8T A;  1OGX A;  2HMO B;  2JQ5 A;  4HZB B;  3NM7 A;  3BLZ A;  1JB4 A;  1QJG A;  4HM5 B;  4XDV A;  4PEJ A;  1DMN A;  1FUW A;  3M8C A;  2Z77 A;  4BTX A;  5A0O B;  1R4C A;  4EV2 A;  1VQM 3;  1WNH A;  5AII A;  1K9M 4;  1STD A;  3FF2 A;  3X3Y A;  3GRD A;  5IEN A;  3FZW A;  1J2B A;  4JF8 A;  3BNC A;  4L7K A;  1SQW A;  1YGE A;  4RNY A;  3G0K A;  4FMA A;  4LZI A;  1O7N B;  3MHE A;  3KSP A;  3N54 B;  3GZX B;  3F9S A;  1FGR A;  4AKZ A;  1AVK A;  1ZO2 A;  2L4V A;  3FG4 A;  4HJL B;  3B8L A;  5IG3 A;  2XRX B;  3CC2 3;  2GEY A;  1TU5 A;  2RFR A;  1VQO 3;  2ZL8 A;  3J7Y d;  1M90 4;  3ALA A;  4N6V 0;  3FF0 A;  5AEU B;  3QRD A;  1STF I;  3CC7 3;  1NU3 A;  4GL6 A;  4XDW A;  2XH9 A;  4JRF A;  3UB1 A;  4IIA A;  2OQE A;  1LOX A;  3B4P A;  3I0Y A;  4AEQ A;  3UNL A;  4ORL A;  2INX A;  1Q42 A;  3PS8 A;  1K28 A;  1NO3 A;  1W00 A;  1ZX2 A;  5DRV A;  3DM8 A;  1V74 A;  4OVM A;  5ELU A;  5IG4 A;  3I55 3;  3U1W A;  1JV2 B;  1O7P B;  1RJO A;  1O7W B;  1ASK A;  3H3H A;  4XBT A;  1PU4 A;  1L5G B;  1KD1 4;  1G96 A;  4O8S A;  4LGQ A;  1JRQ A;  1OAC A;  1Q86 4;  3G71 3;  2A15 A;  1BUQ A;  2Q07 A;  4HM1 B;  4HM6 B;  2MC8 A;  2W9P A;  3NQZ A;  1FGT A;  3GZB A;  1QAK A;  2BT3 A;  4N6M A;  3LH4 A;  1UW1 A;  1OCV A;  1QMA A;  1U5O A;  3DXO A;  3HK4 A;  2XSH B;  3WA2 X;  3GAX A;  1GD4 A;  2OCT A;  1IQ8 A;  3UJM A;  3CPO A;  1RRL A;  2CG0 A;  3NV0 A;  2HMJ B;  3KII A;  3CCJ 3;  4KZ1 A;  3EBY A;  3IMA B;  1QVG 2;  1MNL A;  3RDE A;  4RNZ A;  3DMC A;  3WA3 A;  3KZT A;  4AKY A;  1FGO A;  1CYU A;  1WQL B;  3MG3 A;  2GBW B;  4R80 A;  3EF8 A;  2BMR B;  2V1L A;  5IER A;  3LZA A;  1JKG A;  5AIH A;  4KFF A;  1JJ2 2;  3CCU 3;  4WFO A;  3EJV A;  4IT7 A;  3F8X A;  1NJI 4;  2BMO B;  2YX9 A;  3ER7 A;  3NV0 B;  1QAF A;  3UL5 A;  2CFW A;  2P05 A;  3PGB A;  5JBS A;  5IG5 A;  3G16 A;  3CCM 3;  2STD A;  3IJE B;  1QAL A;  3FG1 A;  5D83 A;  3DY5 A;  2B24 B;  5CXO A;  3GZY B;  4GB5 A;  4X2H A;  5AIG A;  1JKG B;  1TUH A;  2BMQ B;  2KCD A;  5LC7 A;  4MMX B;  3HX8 A;  5AIF A;  5FW5 A;  5EEO A;  2I9W A;  1US1 A;  3T8U A;  4J9A A;  3HIG A;  4NRE A;  3PCS A;  1IT7 A;  4EV5 A;  1RKY A;  3SOA A;  4HM0 B;  2IUJ A;  1KC8 4;  1M1K 4;  4EYC A;  4N6U A;  5G2G A;  1Q82 4;  2CHC A;  2R4I A;  3X42 A;  1JNQ A;  1OGZ A;  3X3X A;  1UI7 A;  4KFE A;  5KP3 A;  1ULJ B;  5EVH A;  2KXG A;  4N3V A;  5AYS C;  3CCL 3;  3K5T A;  3KFQ C;  4XBY A;  3FGY A;  5IW9 A;  3N9H A;  3G4S 3;  4HM4 B;  2OWP A;  3LT8 A;  2OTJ 3;  2P38 A;  3K63 A;  4FMB A;  3EHC A;  2K0M A;  3PYJ A;  2WOF A;  1S72 3;  1HU9 A;  3NQY A;  2CW9 A;  3RGR A;  5FGO A;  3JUN A;  3NBB A;  2CWT A;  1YJN 3;  2C10 A;  4FMC A;  3VF1 A;  4HM3 B;  1NB3 I;  2CFL A;  1SIH A;  1Z1S A;  3FH1 A;  3TDG A;  3K9M C;  3FG3 A;  3SX1 A;  4EC6 A;  1A90 A;  3SVA A;  2W56 A;  3LML A;  4N6O B;  4RZM A;  3WOE B;  3WOD G;  1VQN 3;  4CDL A;  3Q1C A;  1GYB A;  1KQS 2;  1CYV A;  3MYT A;  3OWY A;  2BNG A;  1VQP 3;  1QVF 2;  3FCS B;  1PFP A;  4HZ9 B;  3CPW 2;  2CIU A;  4K1V A;  4I4K A;  3SLU A;  3I56 3;  2KRT A;  3CME 3;  2OTL 3;  4N6T A;  3LTC A;  2Y73 A;  3KN4 A;  2WOH A;  2LYX A;  3F40 A;  2W04 A;  4R9K A;  5D82 A;  2B1X B;  2F99 A;  3F8H A;  5AYR B;  4CCV A;  2W56 B;  4H61 A;  1WMP A;  1O7G B;  3OV4 A;  5DRE A;  5BXQ A;  3EN1 B;  2O9U X;  4K1U A;  1VQ5 3;  4Q53 A;  1E3R A;  1A2K A;  4QWT A;  3CNM A;  4RBN A;  2OOV C;  3HII A;  2O3O A;  1AR0 A;  4OK0 A;  1VZZ A;  4HM2 B;  2GU1 A;  3U97 A;  3BNE A;  3L0R A;  3B7C A;  5D81 A;  1Q7Y 4;  3FKA A;  1WMN A;  3D9R A;  1VQ9 3;  3FLJ A;  3BB9 A;  2RSX A;  3K0Z A;  5IEO A;  7STD A;  2BHM A;  2YFI B;  1OHP A;  3EX9 A;  1SII A;  2D1W A;  3NM2 A;  1VQ7 3;  1UUV B;  4WHA A;  2W2C A;  3JUM A;  3CU3 A;  3NX0 A;  4XM4 A;  1E97 A;  2RGQ A;  2IMJ A;  3EQQ B;  2XF3 A;  4X2O A;  5JPU A;  3MSO A;  3S28 A;  2CFD A;  3LTA A;  1YI2 3;  2CWU A;  3OX9 A;  1YVB I;  5BVB A;  1IQY A;  1A2V A;  1LVN A;  2P0X A;  2XR8 B;  3JVC A;  4HKV B;  4O02 B;  2CG1 A;  3LYG A;  1EA2 A;  3OWS A;  8CHO A;  5CK6 A;  3CCS 3;  4WWU C;  1YIT 3;  3F7S A;  4HYZ A;  3DGN A;  3MG2 A;  1E3V A;  3KSE D;  2E2U A;  1A67 A;  2FGT A;  2WGQ A;  5IEP A;  1F8N A;  2Y74 A;  3GWR A;  3WDG B;  1IV7 A;  3MWZ A;  3PXM A;  3EB8 A;  3S5C A;  3EE1 A;  4LEH A;  1IVW A;  3JUP A;  1D6Y A;  4HVN A;  5HGR A;  1VQL 3;  3CD6 3;  3T8N A;  1EKM A;  3X3Z A;  2Z6B A;  4XB5 A;  3OWU A;  1HKX A;  4O3V A;  6STD A;  5I97 A;  1K8A 4;  3BND A;  3DGM A;  3MKI A;  4HM8 B;  1Q40 A;  3EBT A;  3V98 A;  3WOF B;  2ML6 A;  1FA3 A;  1IVV A;  1OF5 A;  3A76 A;  4TX4 A;  1IDP A;  4FR9 A;  1NWW A;  2YFJ B;  3Q90 A;  4R9L A;  3UL6 A;  1FGQ A;  2HMM B;  3DZL A;  1ROV A;  3K7C A;  2F98 A;  2W6J H;  2F86 B;  4G1M B;  4MMY B;  1N9J A;  1OHS A;  1W6Y A;  1W6C A;  1M1X B;  1N5H A;  2PZV A;  3LXU X;  4NHF A;  1JB5 A;  1W4N A;  3F7X A;  1OH0 A;  4LSO A;  2IUK A;  1SPU A;  3OW2 2;  2QGU A;  1T5Y A;  3BNB A;  1JB2 A;  4IPB A;  1GY7 A;  1W2B 2;  1O7M B;  5IF6 A;  4LMI A;  1Q40 B;  3NUV A;  4FCZ A;  2BO9 B;  3X40 A;  3GZR A;  2PNC A;  2K54 A;  2GBX B;  1OF5 B;  1GS3 A;  1DVD A;  1W5Z A;  2E2V A;  4WYK A;  4L8O A;  1TP6 A;  1GY6 A;  2WO0 A;  2W9Q A;  2CKF B;  2GEX A;  3DGO A;  3CCQ 3;  1NDO B;  1EQK A;  4H3U A;  3CNX A;  5AI1 A;  3NBJ A;  1VQ8 3;  2W03 A;  3NXJ A;  1CEW I;  2ML5 A;  4O2H A;  1AVL A;  4ZM8 A;  1IVU A;  2CH9 A;  1RN7 A;  1D6Z A;  1W02 A;  1OPY A;  2Z76 A;  1UI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...