4N6TA

Adhiron: a stable and versatile peptide display scaffold - full length adhiron
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
ENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGGKKKLYEAKVWVKPWENFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Adhiron
publication title Adhiron: a stable and versatile peptide display scaffold for molecular recognition applications.
pubmed doi rcsb
source organism Artificial gene
total genus 16
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6tA00
3Q2PA 1G96A 4EYCA 4N6LA 2KXGA 3LH4A 4N6UA 1FUWA 3L0RA 2CH9A 1CEWI 1DVDA 3K9MC 1CYUA 2W9QA 1GD4A 4TX4A 1YVBI 3S67A 5ELJA 1N5PA 3QRDA 5LC6A 1EQKA 3UL6A 4N6V0 1FA3A 4N6MA 4CCVA 1ROAA 1GD3A 3PS8A 1MNLA 1KWIA 5LC7A 3SVAA 4LZIA 3NX0A 4IT7A 1CYVA 2BO9B 5A0OB 1A67A 1STFI 1TIJA 3GAXA 1NB5I 1A90A 1M9GA 2O9UX 3IMAB 1DVCA 3KFQC 4ZM8A 3PXMA 2W9PA 5ELUA 3PYJA 1RN7A 1LXEA 1NB3I 1N5HA 4N6NB 3UL5A 1N9JA 1PFPA 1MOLA 1R4CA 3KSED 1WNHA 1IV7A 2OCTA 4N6TA 5EQLA 1IV9A 3MWZA 4N6OB
chains in the Genus database with same CATH superfamily
5IG4A 3F40A 3Q2PA 1YGEA 2Z77A 2F5MA 1RGAA 1YGWA 1ZX2A 3GRDA 3L0RA 2CW9A 3FGYA 4J9AA 3WOEB 1X1WA 1JJ22 2BMRB 1SQWA 2WOHA 1CEWI 3LT9A 3UB1A 4L8PA 2KF3A 2P09A 3X40A 3EN8A 4EBGA 3B4PA 1RKYA 1UUVB 2I9WA 1S5AA 1CYUA 3CCR3 2P05A 1IT7A 1VZZA 4DKIA 1BRKA 5IENA 4NPBA 1BVIA 3T0UA 3HZPA 2XSHB 1ZO2A 3MHEA 3PGBA 4MJDA 2C4BA 1BSBA 4RZMA 1BU4A 1OGXA 2OQEA 3CCS3 1N5PA 3NM7A 3M8CA 7RNTA 1WQLB 1E97A 3DGNA 3CCJ3 2YFLB 1MGRA 1ROVA 3G713 4EC6A 3FG4A 1T2IA 5FW5A 4HJLB 3S29A 1VQL3 1A2KA 3SYUA 1HKXA 3DGMA 5AIHA 3SOYA 1BNGA 3ER7A 4KVHA 4N6V0 1BIRA 5IEPA 3CMA3 4XBXA 1JKGA 2Y74A 4HZ9B 2GSPA 2WOFA 3LMLA 4HM6B 5IG5A 1B3SA 1N8R4 3DH2A 1AY7A 3EE1A 1M1XB 3MSOA 4HM4B 3MPHA 4X2OA 2O3OA 4J5GA 2QEX3 4IPBA 2R41A 1BNRA 4LYLB 3D5GA 1QAFA 1BAOA 1QVG2 4RBNA 3NM2A 3EX9A 5JPUA 3LTCA 5CK6A 2HMKB 1BSAA 3IPTA 2F98A 2SARA 4NHFA 2CIUA 5IG3A 1VQ43 1I8VA 2A15A 1O7HB 1IQYA 2HMJB 1B2ZA 1LVNA 1M1K4 3BLZA 4H61A 2CHCA 5M1AA 2ZDJA 2ZHXB 5A0OB 5AEUB 4PEJA 2UUGC 1IDPA 4WHAA 4OK0A 4AEQA 3DGOA 1O7PB 1BSCA 1D6UA 2MF7A 4RNZA 3EHCA 1RGHA 3KSPA 2RGQA 1JBSA 3DM8A 1NNVA 1YIJ3 1DVCA 3KIIA 3KFQC 1YI23 1O7WB 1HZ1A 4G1MB 4FR9A 1I70A 1TUHA 1EKMA 3IJEB 4R9LA 3VF1A 3X3YA 5BVBA 2UX0A 1JZOA 1WMNA 2CX0A 3CNMA 3JUPA 3A76A 3EJVA 1Q824 3SLUA 2P0XA 5BIRA 3JUOA 2R4IA 1AV4A 4HM3B 1RN7A 4GL6A 3BU4A 1WMOA 1NB3I 2XR8B 1E3VA 1RGEA 2OOVC 3URPA 2CWVA 3T8NA 1SIHA 1PFPA 2HOHA 4FMBA 2Q07A 1FW7A 3LTDA 4K61A 2KF5A 4NREA 1R4CA 1UDII 2YFJB 1ULJB 4KFFA 3RGRA 3F7SA 3FG3A 1AVKA 2HMNB 4WWUC 3ROBA 1VQP3 1IV9A 1GOUA 3T8UA 2F99A 1DETA 3ZG5A 2E2TA 1B2UA 4O8SA 2D42A 4EYCA 1G96A 2UGIA 4N6LA 1W00A 2KXGA 2K0MA 1IYYA 3EF8A 4GHOA 1NJI4 3X41A 1UCIA 2K3DA 1OH0A 3DXOA 3F14A 3B7CA 2RNTA 3SEDA 3UNLA 3EB8A 3FF0A 3JVCA 3ZG0A 3AMOB 2CH9A 4EV2A 1PU4A 1T5YA 3NXJA 1W6YA 3MYTA 3MG3A 2ZL8A 4FCMA 4BIRA 1OUNA 3KCHA 1UI7A 3OX9A 2XFTA 4HM5B 3S28A 1UGHI 1YVSA 4AKYA 5G1KA 2C10A 1F8NA 2JQ5A 3CME3 1RCKA 3CC23 3LOYA 1VQ73 1W01A 3FG1A 1OHOA 1DE3A 3G16A 2W9QA 1GD4A 1D6ZA 1IU7A 1WTHA 1YJN3 1UCJA 1YVBI 2IUKA 3S67A 4BL3A 2E2VA 1FYSA 1QAKA 1A2VA 1OHSA 1BRJA 2BT3A 2HMOB 1Q9EA 1JRQA 1C7HA 2FXTA 1G0TA 2CG0A 4BTXA 1VQ53 2WGQA 1RN1A 2QIYA 1EQKA 3WA2X 1KD14 3UL6A 1US1A 2F5WA 2QA43 4HYZA 3WR2A 1JB2A 2LYXA 3GWRA 1U5OA 2RCDA 3D9RA 2RFRA 1GY6A 1IVWA 2BNGA 1G02A 1OGZA 1EUIC 2H0HA 1V74A 3G8ZA 4CCVA 1K734 1BRSA 3CXC2 1YIT3 4FMDA 1YJ93 1QMAA 2IMJA 1RTUA 9RNTA 3NQZA 3PCRA 2W6JH 3GZBA 1NWWA 2STDA 1BRNL 1X1UA 3CCM3 8CHOA 2BIRA 2W04A 2WO0A 3Q3FA 3LT8A 1LNHA 1I2FA 2GU3A 1KWIA 3AMOA 3KE7A 5LC7A 3X3ZA 1IVXA 1HYFA 1ULIB 3WODG 1N9EA 3D3LA 3FSDA 1UW1A 1L5GB 3CPW2 1NDOB 1IVVA 2B24B 3J7Yd 1RGGA 1Q7Y4 1K9M4 1PYLA 2GBXB 4JRFA 1CYVA 2BMOB 2BO9B 3NUVA 1STFI 3NHXA 4J5KA 2M7OA 2BU4A 1T2HA 1DMMA 2CWTA 1GY7A 3E99A 2K54A 1BGSA 4L8OA 2O9UX 2KCDA 3GZXB 2L1SA 3GZRA 1SARA 3JUNA 5STDA 3X3XA 1J2BA 3PXMA 2W9PA 2OTL3 5ELUA 2W56B 3QK9A 1S723 1FGOA 1KQS2 1W7CA 2CKFB 1UCLA 3BIRA 1RGFA 2FGTA 3UL5A 3PCSA 1RNTA 2OOVA 3K5TA 1N9JA 1OHPA 3LZAA 3ZFZA 1W4NA 3CPOA 4JF8A 3ECFA 1IVUA 1I3IA 1LQMB 2CWUA 1VQ83 1MWRA 3CCV3 3KZTA 2XRXB 2FNQA 3I0YA 1V57A 3I553 2OCTA 5AIIA 1PY3A 3EN1B 3NBJA 1RSNA 2CG1A 6RNTA 2AADA 2GEXA 4WP5A 3S5CA 1LOWA 4N6OB 4X2HA 4HVNA 1NO3A 5JBSA 1Q40B 3OXAA 2OTJ3 1A2PA 4HOHA 5IEOA 1TRPA 4ILFA 3LH4A 1LNIA 4J8TA 3X42A 4KFDA 2KAAA 1SPUA 1LOYA 3MKIA 1VQO3 3AHWA 1Q814 2RSXA 2CK3H 4HBRA 1B2MA 1DYUA 5G1LA 3OWUA 1CH0A 1QVF2 3FF2A 1UCKA 2ML5A 3K9MC 3BNBA 4GSPA 3F8XA 1EEJA 1UGIA 3PZWA 2IUJA 1FUWA 1FGTA 1QALA 4MMXB 4QWTA 1STDA 1VQ93 3DGYA 3D5IA 4Q53A 3SOAA 3SX1A 1OPYA 4HKVB 1RN4A 4HAAA 5DREA 5HOHA 2W56A 4WYKB 5IG0A 3S27A 4BL2A 5DRVA 1YNVX 1MWTA 1I2EA 3DZLA 2IYJA 4XBYA 1MWSA 3V92A 1LRAA 1VQK3 4HZBB 1IQ8A 2L4VA 3H51A 1JV2B 1O7NB 2SBLA 3NBBA 2HMLB 3QRDA 4STDA 5CF1A 2P38A 3B8LA 4RNTA 1VQN3 3Q90A 5LC6A 2F86B 1GOVA 4I4KA 5AEWB 4LGQA 1B21A 4O3VA 3AGOA 4N6MA 5D82A 3BB9A 3BNCA 4IIAA 1Q40A 4CJNA 1Q7HA 3JUMA 1RGLA 8RNTA 4EV5A 2XEPA 4LSOA 2D1WA 4WFOA 3WHOA 2CFGA 3V98A 1Y4KA 3SVAA 1RCLA 1TRQA 1QJGA 1I2GA 3HIIA 4HM1B 4LZIA 3WMDA 3DUKA 3B4OA 1RGKA 4I5QA 4IT7A 3U1WA 5IW9A 3JUQA 4HM7B 1BUJA 2BHMA 3GSPA 1GY5A 4RNYA 3CCL3 1BNFA 2W03A 1M904 4OVMA 3F9SA 3GAXA 3HX8A 1W5ZA 3OW22 4K1UA 1FUTA 2HMMB 1BRGA 1D6YA 1TFOA 5CXOA 5BXQA 2GBWB 3FH1A 6GSPA 5FGOA 3WOFB 1NB5I 4WYKA 1VQ63 4OUQA 2IA7A 2XGNA 4K90B 3IMAB 4XB5A 3O8YA 4FCJA 7STDA 1O7MB 1SJWA 3MG1A 4HM2B 1KC84 5TGNA 3LXUX 3EQQB 1OF5B 1C54A 3CCQ3 2H0GA 3DY5A 6STDA 3PYJA 1EG9B 1FGMA 3CD63 1SIIA 1RGCA 1BOXA 2W0QA 3LTBA 3VSYA 5CF2A 1TU5A 2V1LA 1B2XA 1LXEA 1TJDA 3NV0B 4KFEA 3CNXA 4EXRA 1N5HA 4R4KA 5AIGA 3D79A 5KP3A 4N3VA 1JN5B 1RNBA 3V99A 3N9HA 3OV4A 1IK3A 1VQM3 1GOYA 1LOXA 1DMNA 1MGWA 3KSED 3FLJA 2Z76A 2Z6BA 1JBTA 5KP1A 5KP4A 5EQLA 3MWZA 1UUGB 2PZVA 1DMQA 1Q864 1BSEA 1T3BA 3UJMA 3HOHA 2OWPA 1R4YA 3N8BA 3CU3A 1FGQA 4MEIA 4KZ1A 1I0XA 5AYRB 1JNQA 1GS3A 3KKGA 4N6UA 3CCE3 1LQGC 1Q42A 1B2SA 4ORLA 3RGAA 2Y73A 4H3UA 3BNDA 3HI7A 3FKAA 2ML6A 1X1XA 5JPPA 4BTYA 3G0KA 2BMQB 4FMAA 4CDLA 1W2B2 1Z1SA 1DVDA 4R1KA 5IERA 2MC8A 1ISKA 2INXA 3A5EA 2QGUA 1ASKA 1N8QA 3AHSA 2WGOA 5BU4A 4FCZA 1AR0A 2CC3A 4XDWA 2KF4A 3TDGA 4U13A 1OCVA 2KF6A 2XH9A 3EBYA 1TFKA 1OF5A 3U97A 4TX4A 1JZDA 3GZYB 4K1VA 3WA3A 3NQYA 5I97A 1TTOA 1GMRA 5ELJA 2OQEC 3WDGB 5M18A 1K8A4 4HM0B 2W2CA 7GSPA 3CC43 3NV0A 3OWSA 2AAEA 5AIFA 1K28A 1BSDA 1WMPA 2H0IA 3VGNA 1AQZA 1JN5A 1TP6A 4HM8B 3Q1CA 4XM4A 4XBTA 1BNIA 1BRHA 1CQSA 1I3FA 1W6GA 1U8CB 3LTAA 5IF6A 4AKZA 1RMSA 1YJW3 5AI1A 2KRTA 5GSPA 3RDEA 3STDA 1GMPA 1NU3A 2F56A 1ZGXA 1FA3A 1FGRA 3LYGA 1RDSA 3G4S3 2P0MA 4EW5A 2RBIA 1IQXA 1K41A 5AYSC 3HIGA 1ROAA 1W2ZA 1GSPA 1W6CA 1RJOA 1EA2A 3F7XA 2ZA4A 1GD3A 1BRIA 1MNLA 2GXFA 3PS8A 2E2UA 2XSOB 1GMQA 5RNTA 3CC73 2B1XB 1OACA 1RLSA 2GEYA 3DGLA 5D81A 3K7CA 2C11A 3NX0A 4MMYB 3DMCA 4R80A 2Z7AA 3RNTA 3AGNA 2XF3A 5EVHA 4CPKA 4BTWA 1A67A 2CFDA 1KSIA 2CFWA 1GYBA 1FZUA 1HU9A 3CCU3 3NBRA 5EEOA 1TIJA 3HK4A 1LOVA 2CX1A 3EC9A 1JB5A 3N54B 1IT8A 3I563 1RHLA 2CFKA 3D4AA 3ALAA 3KN4A 1A90A 4XDVA 1M9GA 3K0ZA 1FUSA 2YFIB 1UUWB 3EBTA 1JB4A 1BANA 1O7GB 4O02B 3MG2A 4ZM8A 4BU4A 1MWUA 1VQQA 3K63A 1JBRA 2IY2A 3FZWA 2XGLA 1UI8A 3F8HA 2GU1A 1I0VA 1B20A 2LQVA 4KT3B 3BNEA 1BNSA 5CLKA 1ZS7A 4O2HA 3SXXA 2CFLA 1V58A 5G2GA 1RRLA 4LMIA 4N6NB 1BNEA 3H3HA 4FMCA 3FCSB 4GB5A 1BNJA 1X1YA 2YX9A 1E3RA 1RRHA 1AVLA 5HGRA 1MOLA 2J8XB 4R9KA 1W02A 2PNCA 2JDIH 2XFSA 2F4YA 4LEHA 5D83A 1JKGB 5M19A 1BUQA 1WNHA 1IV7A 4L7KA 4N6TA 3G6E3 4MMZB 1B27A 1YHQ3 3OWYA
chains in the Genus database with same CATH topology
5IG4A 3F40A 3Q2PA 1YGEA 2Z77A 1ZX2A 3GRDA 3L0RA 2CW9A 3FGYA 4J9AA 3WOEB 1JJ22 2BMRB 1SQWA 2WOHA 1CEWI 3LT9A 3UB1A 4L8PA 2P09A 3X40A 3EN8A 4EBGA 3B4PA 1RKYA 1UUVB 2I9WA 1S5AA 1CYUA 3CCR3 2P05A 1IT7A 1VZZA 5IENA 3T0UA 3HZPA 2XSHB 1ZO2A 3MHEA 3PGBA 4MJDA 4RZMA 1OGXA 2OQEA 3CCS3 1N5PA 3NM7A 3M8CA 1WQLB 1E97A 3DGNA 3CCJ3 2YFLB 1ROVA 3G713 4EC6A 3FG4A 5FW5A 1VQL3 4HJLB 3S29A 1A2KA 1HKXA 3DGMA 5AIHA 3SOYA 3ER7A 4KVHA 4N6V0 5IEPA 3CMA3 4XBXA 1JKGA 2Y74A 4HZ9B 2WOFA 3LMLA 4HM6B 5IG5A 1N8R4 3EE1A 1M1XB 3MSOA 4HM4B 3MPHA 4X2OA 2O3OA 2QEX3 4IPBA 1QAFA 1QVG2 4RBNA 3NM2A 3EX9A 5JPUA 3LTCA 5CK6A 2HMKB 3IPTA 2F98A 4NHFA 2CIUA 5IG3A 1VQ43 2A15A 1O7HB 1IQYA 2HMJB 1LVNA 1M1K4 3BLZA 4H61A 2CHCA 2ZDJA 5A0OB 5AEUB 4PEJA 1IDPA 4WHAA 4OK0A 4AEQA 3DGOA 1O7PB 1D6UA 2MF7A 4RNZA 3EHCA 3KSPA 2RGQA 3DM8A 1YIJ3 1DVCA 3KIIA 3KFQC 1YI23 1O7WB 4R9LA 4G1MB 4FR9A 3IJEB 1TUHA 1EKMA 3VF1A 3X3YA 5BVBA 2UX0A 1WMNA 3CNMA 3JUPA 3A76A 3EJVA 1Q824 3SLUA 2P0XA 3JUOA 2R4IA 1AV4A 4HM3B 1RN7A 4GL6A 1WMOA 1NB3I 2XR8B 1E3VA 2OOVC 2CWVA 3T8NA 1SIHA 1PFPA 4FMBA 2Q07A 3LTDA 4K61A 4NREA 1R4CA 2YFJB 1ULJB 4KFFA 3RGRA 3F7SA 3FG3A 1AVKA 2HMNB 4WWUC 3ROBA 1VQP3 1IV9A 3T8UA 2F99A 2E2TA 4O8SA 2D42A 4EYCA 1G96A 4N6LA 1W00A 2KXGA 2K0MA 3EF8A 1NJI4 3X41A 1OH0A 3DXOA 3F14A 3B7CA 3SEDA 3UNLA 1FUWA 3EB8A 3FF0A 3JVCA 3AMOB 2CH9A 4EV2A 1PU4A 1T5YA 3NXJA 1W6YA 3MYTA 3MG3A 2ZL8A 4FCMA 1OUNA 1UI7A 3OX9A 2XFTA 4HM5B 3S28A 4AKYA 2C10A 1F8NA 2JQ5A 3CME3 3CC23 3LOYA 1VQ73 1W01A 3FG1A 1OHOA 3G16A 2W9QA 1GD4A 1D6ZA 1IU7A 1WTHA 1YJN3 2IUKA 1YVBI 3S67A 2E2VA 1QAKA 1A2VA 1OHSA 2HMOB 2BT3A 1JRQA 1C7HA 2FXTA 2CG0A 4BTXA 1VQ53 2WGQA 2QIYA 1EQKA 3WA2X 1KD14 3UL6A 1US1A 2QA43 4HYZA 1JB2A 2LYXA 3GWRA 1U5OA 2RCDA 3D9RA 2RFRA 1GY6A 1IVWA 2BNGA 1OGZA 3G8ZA 4CCVA 1V74A 1K734 3CXC2 1YIT3 4FMDA 1YJ93 1QMAA 2IMJA 3NQZA 3PCRA 2W6JH 3GZBA 1NWWA 2STDA 3CCM3 8CHOA 2WO0A 2W04A 3LT8A 1LNHA 2GU3A 1KWIA 3AMOA 3KE7A 5LC7A 3X3ZA 1IVXA 1ULIB 3WODG 1N9EA 3D3LA 3FSDA 1UW1A 1L5GB 3CPW2 1NDOB 1IVVA 2B24B 3J7Yd 1Q7Y4 1K9M4 2GBXB 4JRFA 1CYVA 2BMOB 2BO9B 3NUVA 1STFI 3NHXA 2M7OA 1DMMA 2CWTA 1GY7A 3E99A 2K54A 4L8OA 2O9UX 2KCDA 3GZXB 3GZRA 3JUNA 5STDA 3X3XA 1J2BA 3PXMA 2W9PA 2OTL3 5ELUA 2W56B 3QK9A 1S723 1FGOA 1KQS2 1W7CA 2CKFB 2FGTA 3UL5A 3PCSA 2OOVA 3K5TA 1N9JA 1OHPA 3LZAA 1W4NA 3CPOA 4JF8A 3ECFA 1IVUA 2CWUA 1VQ83 3CCV3 3KZTA 2XRXB 2FNQA 3I0YA 3I553 2OCTA 5AIIA 3NBJA 3EN1B 2CG1A 2GEXA 4WP5A 3S5CA 4N6OB 4X2HA 4HVNA 1NO3A 5JBSA 1Q40B 3OXAA 2OTJ3 5IEOA 3LH4A 4J8TA 3X42A 4KFDA 1SPUA 3MKIA 1VQO3 1Q814 2RSXA 2CK3H 4HBRA 1DYUA 3OWUA 1QVF2 3FF2A 2ML5A 3K9MC 3BNBA 3F8XA 3PZWA 2IUJA 1FGTA 1QALA 4MMXB 4QWTA 1STDA 1VQ93 4Q53A 3SOAA 3SX1A 1OPYA 4HKVB 5DREA 2W56A 4WYKB 5IG0A 3S27A 5DRVA 3DZLA 4XBYA 3V92A 1VQK3 4HZBB 1IQ8A 2L4VA 3H51A 1JV2B 1O7NB 2SBLA 3NBBA 2HMLB 3QRDA 4STDA 5CF1A 2P38A 3B8LA 1VQN3 3Q90A 5LC6A 2F86B 4I4KA 5AEWB 4LGQA 4O3VA 4N6MA 5D82A 3BB9A 3BNCA 4IIAA 1Q40A 3JUMA 4EV5A 2XEPA 4LSOA 2D1WA 4WFOA 2CFGA 3V98A 1Y4KA 3SVAA 1QJGA 3HIIA 4HM1B 4LZIA 3WMDA 3DUKA 3B4OA 4IT7A 3U1WA 5IW9A 3JUQA 4HM7B 2BHMA 1GY5A 4RNYA 3CCL3 2W03A 1M904 4OVMA 3F9SA 3GAXA 3HX8A 1W5ZA 3OW22 4K1UA 2HMMB 1D6YA 1TFOA 5CXOA 5BXQA 1VQ63 2GBWB 3FH1A 5FGOA 3WOFB 1NB5I 4WYKA 4OUQA 2IA7A 2XGNA 4K90B 3IMAB 4XB5A 3O8YA 4FCJA 7STDA 1O7MB 1SJWA 3MG1A 4HM2B 1KC84 5TGNA 3LXUX 3EQQB 1OF5B 3CCQ3 3DY5A 6STDA 3PYJA 1EG9B 1FGMA 3CD63 1SIIA 2W0QA 3LTBA 3VSYA 1TU5A 5CF2A 2V1LA 1LXEA 3NV0B 4KFEA 3CNXA 4EXRA 1N5HA 4R4KA 5AIGA 5KP3A 4N3VA 1JN5B 3V99A 3N9HA 3OV4A 1IK3A 1VQM3 1LOXA 1DMNA 3KSED 3FLJA 2Z76A 2Z6BA 5KP1A 5KP4A 5EQLA 3MWZA 2PZVA 1DMQA 1Q864 3UJMA 2OWPA 3N8BA 3CU3A 1FGQA 4MEIA 4KZ1A 5AYRB 1JNQA 1GS3A 3KKGA 4N6UA 3CCE3 1Q42A 4ORLA 3RGAA 2Y73A 4H3UA 3BNDA 3HI7A 3FKAA 2ML6A 5JPPA 4BTYA 3G0KA 2BMQB 4FMAA 4CDLA 1W2B2 1Z1SA 1DVDA 4R1KA 5IERA 2MC8A 1ISKA 2INXA 2QGUA 1ASKA 1N8QA 2WGOA 4FCZA 1AR0A 2CC3A 4XDWA 3TDGA 4U13A 1OCVA 2XH9A 3EBYA 1TFKA 1OF5A 3U97A 4TX4A 3GZYB 4K1VA 3WA3A 3NQYA 5I97A 5ELJA 2OQEC 3WDGB 1K8A4 4HM0B 2W2CA 3CC43 3NV0A 3OWSA 5AIFA 1K28A 1WMPA 3VGNA 1JN5A 1TP6A 4HM8B 3Q1CA 4XM4A 4XBTA 1CQSA 1W6GA 5IF6A 1U8CB 3LTAA 4AKZA 1YJW3 5AI1A 2KRTA 3STDA 3RDEA 1NU3A 1FA3A 1FGRA 3LYGA 3G4S3 2P0MA 1IQXA 1K41A 5AYSC 3HIGA 1ROAA 1W2ZA 1W6CA 1RJOA 1EA2A 3F7XA 1GD3A 2GXFA 1MNLA 3PS8A 2E2UA 2XSOB 3CC73 1OACA 2B1XB 2GEYA 3DGLA 5D81A 3K7CA 2C11A 3NX0A 4MMYB 3DMCA 4R80A 2Z7AA 2XF3A 5EVHA 4BTWA 1A67A 2CFDA 1KSIA 2CFWA 1GYBA 1HU9A 3CCU3 3NBRA 5EEOA 1TIJA 3HK4A 3EC9A 1JB5A 3N54B 1IT8A 3I563 2CFKA 3ALAA 3KN4A 1A90A 4XDVA 1M9GA 3K0ZA 2YFIB 1UUWB 3EBTA 1JB4A 1O7GB 4O02B 3MG2A 4ZM8A 3K63A 3FZWA 2XGLA 1UI8A 3F8HA 2GU1A 2LQVA 3BNEA 5CLKA 3SXXA 4O2HA 2CFLA 5G2GA 1RRLA 4LMIA 4N6NB 3H3HA 4FMCA 3FCSB 4GB5A 2YX9A 1E3RA 1RRHA 1AVLA 5HGRA 1MOLA 4R9KA 1W02A 2PNCA 2JDIH 2XFSA 4LEHA 5D83A 1BUQA 1JKGB 1WNHA 1IV7A 4L7KA 4N6TA 3G6E3 4MMZB 1YHQ3 3OWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2P A;  1G96 A;  4EYC A;  4N6L A;  2KXG A;  3LH4 A;  4N6U A;  1FUW A;  3L0R A;  2CH9 A;  1CEW I;  1DVD A;  3K9M C;  1CYU A;  2W9Q A;  1GD4 A;  4TX4 A;  1YVB I;  3S67 A;  5ELJ A;  1N5P A;  3QRD A;  5LC6 A;  1EQK A;  3UL6 A;  4N6V 0;  1FA3 A;  4N6M A;  4CCV A;  1ROA A;  1GD3 A;  3PS8 A;  1MNL A;  1KWI A;  5LC7 A;  3SVA A;  4LZI A;  3NX0 A;  4IT7 A;  1CYV A;  2BO9 B;  5A0O B;  1A67 A;  1STF I;  1TIJ A;  3GAX A;  1NB5 I;  1A90 A;  1M9G A;  2O9U X;  3IMA B;  1DVC A;  3KFQ C;  4ZM8 A;  3PXM A;  2W9P A;  5ELU A;  3PYJ A;  1RN7 A;  1LXE A;  1NB3 I;  1N5H A;  4N6N B;  3UL5 A;  1N9J A;  1PFP A;  1MOL A;  1R4C A;  3KSE D;  1WNH A;  1IV7 A;  2OCT A;  4N6T A;  5EQL A;  1IV9 A;  3MWZ A;  4N6O B; 
#chains in the Genus database with same CATH topology
 5IG4 A;  3F40 A;  3Q2P A;  1YGE A;  2Z77 A;  2F5M A;  1RGA A;  1YGW A;  1ZX2 A;  3GRD A;  3L0R A;  2CW9 A;  3FGY A;  4J9A A;  3WOE B;  1X1W A;  1JJ2 2;  2BMR B;  1SQW A;  2WOH A;  1CEW I;  3LT9 A;  3UB1 A;  4L8P A;  2KF3 A;  2P09 A;  3X40 A;  3EN8 A;  4EBG A;  3B4P A;  1RKY A;  1UUV B;  2I9W A;  1S5A A;  1CYU A;  3CCR 3;  2P05 A;  1IT7 A;  1VZZ A;  4DKI A;  1BRK A;  5IEN A;  4NPB A;  1BVI A;  3T0U A;  3HZP A;  2XSH B;  1ZO2 A;  3MHE A;  3PGB A;  4MJD A;  2C4B A;  1BSB A;  4RZM A;  1BU4 A;  1OGX A;  2OQE A;  3CCS 3;  1N5P A;  3NM7 A;  3M8C A;  7RNT A;  1WQL B;  1E97 A;  3DGN A;  3CCJ 3;  2YFL B;  1MGR A;  1ROV A;  3G71 3;  4EC6 A;  3FG4 A;  1T2I A;  5FW5 A;  4HJL B;  3S29 A;  1VQL 3;  1A2K A;  3SYU A;  1HKX A;  3DGM A;  5AIH A;  3SOY A;  1BNG A;  3ER7 A;  4KVH A;  4N6V 0;  1BIR A;  5IEP A;  3CMA 3;  4XBX A;  1JKG A;  2Y74 A;  4HZ9 B;  2GSP A;  2WOF A;  3LML A;  4HM6 B;  5IG5 A;  1B3S A;  1N8R 4;  3DH2 A;  1AY7 A;  3EE1 A;  1M1X B;  3MSO A;  4HM4 B;  3MPH A;  4X2O A;  2O3O A;  4J5G A;  2QEX 3;  4IPB A;  2R41 A;  1BNR A;  4LYL B;  3D5G A;  1QAF A;  1BAO A;  1QVG 2;  4RBN A;  3NM2 A;  3EX9 A;  5JPU A;  3LTC A;  5CK6 A;  2HMK B;  1BSA A;  3IPT A;  2F98 A;  2SAR A;  4NHF A;  2CIU A;  5IG3 A;  1VQ4 3;  1I8V A;  2A15 A;  1O7H B;  1IQY A;  2HMJ B;  1B2Z A;  1LVN A;  1M1K 4;  3BLZ A;  4H61 A;  2CHC A;  5M1A A;  2ZDJ A;  2ZHX B;  5A0O B;  5AEU B;  4PEJ A;  2UUG C;  1IDP A;  4WHA A;  4OK0 A;  4AEQ A;  3DGO A;  1O7P B;  1BSC A;  1D6U A;  2MF7 A;  4RNZ A;  3EHC A;  1RGH A;  3KSP A;  2RGQ A;  1JBS A;  3DM8 A;  1NNV A;  1YIJ 3;  1DVC A;  3KII A;  3KFQ C;  1YI2 3;  1O7W B;  1HZ1 A;  4G1M B;  4FR9 A;  1I70 A;  1TUH A;  1EKM A;  3IJE B;  4R9L A;  3VF1 A;  3X3Y A;  5BVB A;  2UX0 A;  1JZO A;  1WMN A;  2CX0 A;  3CNM A;  3JUP A;  3A76 A;  3EJV A;  1Q82 4;  3SLU A;  2P0X A;  5BIR A;  3JUO A;  2R4I A;  1AV4 A;  4HM3 B;  1RN7 A;  4GL6 A;  3BU4 A;  1WMO A;  1NB3 I;  2XR8 B;  1E3V A;  1RGE A;  2OOV C;  3URP A;  2CWV A;  3T8N A;  1SIH A;  1PFP A;  2HOH A;  4FMB A;  2Q07 A;  1FW7 A;  3LTD A;  4K61 A;  2KF5 A;  4NRE A;  1R4C A;  1UDI I;  2YFJ B;  1ULJ B;  4KFF A;  3RGR A;  3F7S A;  3FG3 A;  1AVK A;  2HMN B;  4WWU C;  3ROB A;  1VQP 3;  1IV9 A;  1GOU A;  3T8U A;  2F99 A;  1DET A;  3ZG5 A;  2E2T A;  1B2U A;  4O8S A;  2D42 A;  4EYC A;  1G96 A;  2UGI A;  4N6L A;  1W00 A;  2KXG A;  2K0M A;  1IYY A;  3EF8 A;  4GHO A;  1NJI 4;  3X41 A;  1UCI A;  2K3D A;  1OH0 A;  3DXO A;  3F14 A;  3B7C A;  2RNT A;  3SED A;  3UNL A;  3EB8 A;  3FF0 A;  3JVC A;  3ZG0 A;  3AMO B;  2CH9 A;  4EV2 A;  1PU4 A;  1T5Y A;  3NXJ A;  1W6Y A;  3MYT A;  3MG3 A;  2ZL8 A;  4FCM A;  4BIR A;  1OUN A;  3KCH A;  1UI7 A;  3OX9 A;  2XFT A;  4HM5 B;  3S28 A;  1UGH I;  1YVS A;  4AKY A;  5G1K A;  2C10 A;  1F8N A;  2JQ5 A;  3CME 3;  1RCK A;  3CC2 3;  3LOY A;  1VQ7 3;  1W01 A;  3FG1 A;  1OHO A;  1DE3 A;  3G16 A;  2W9Q A;  1GD4 A;  1D6Z A;  1IU7 A;  1WTH A;  1YJN 3;  1UCJ A;  1YVB I;  2IUK A;  3S67 A;  4BL3 A;  2E2V A;  1FYS A;  1QAK A;  1A2V A;  1OHS A;  1BRJ A;  2BT3 A;  2HMO B;  1Q9E A;  1JRQ A;  1C7H A;  2FXT A;  1G0T A;  2CG0 A;  4BTX A;  1VQ5 3;  2WGQ A;  1RN1 A;  2QIY A;  1EQK A;  3WA2 X;  1KD1 4;  3UL6 A;  1US1 A;  2F5W A;  2QA4 3;  4HYZ A;  3WR2 A;  1JB2 A;  2LYX A;  3GWR A;  1U5O A;  2RCD A;  3D9R A;  2RFR A;  1GY6 A;  1IVW A;  2BNG A;  1G02 A;  1OGZ A;  1EUI C;  2H0H A;  1V74 A;  3G8Z A;  4CCV A;  1K73 4;  1BRS A;  3CXC 2;  1YIT 3;  4FMD A;  1YJ9 3;  1QMA A;  2IMJ A;  1RTU A;  9RNT A;  3NQZ A;  3PCR A;  2W6J H;  3GZB A;  1NWW A;  2STD A;  1BRN L;  1X1U A;  3CCM 3;  8CHO A;  2BIR A;  2W04 A;  2WO0 A;  3Q3F A;  3LT8 A;  1LNH A;  1I2F A;  2GU3 A;  1KWI A;  3AMO A;  3KE7 A;  5LC7 A;  3X3Z A;  1IVX A;  1HYF A;  1ULI B;  3WOD G;  1N9E A;  3D3L A;  3FSD A;  1UW1 A;  1L5G B;  3CPW 2;  1NDO B;  1IVV A;  2B24 B;  3J7Y d;  1RGG A;  1Q7Y 4;  1K9M 4;  1PYL A;  2GBX B;  4JRF A;  1CYV A;  2BMO B;  2BO9 B;  3NUV A;  1STF I;  3NHX A;  4J5K A;  2M7O A;  2BU4 A;  1T2H A;  1DMM A;  2CWT A;  1GY7 A;  3E99 A;  2K54 A;  1BGS A;  4L8O A;  2O9U X;  2KCD A;  3GZX B;  2L1S A;  3GZR A;  1SAR A;  3JUN A;  5STD A;  3X3X A;  1J2B A;  3PXM A;  2W9P A;  2OTL 3;  5ELU A;  2W56 B;  3QK9 A;  1S72 3;  1FGO A;  1KQS 2;  1W7C A;  2CKF B;  1UCL A;  3BIR A;  1RGF A;  2FGT A;  3UL5 A;  3PCS A;  1RNT A;  2OOV A;  3K5T A;  1N9J A;  1OHP A;  3LZA A;  3ZFZ A;  1W4N A;  3CPO A;  4JF8 A;  3ECF A;  1IVU A;  1I3I A;  1LQM B;  2CWU A;  1VQ8 3;  1MWR A;  3CCV 3;  3KZT A;  2XRX B;  2FNQ A;  3I0Y A;  1V57 A;  3I55 3;  2OCT A;  5AII A;  1PY3 A;  3EN1 B;  3NBJ A;  1RSN A;  2CG1 A;  6RNT A;  2AAD A;  2GEX A;  4WP5 A;  3S5C A;  1LOW A;  4N6O B;  4X2H A;  4HVN A;  1NO3 A;  5JBS A;  1Q40 B;  3OXA A;  2OTJ 3;  1A2P A;  4HOH A;  5IEO A;  1TRP A;  4ILF A;  3LH4 A;  1LNI A;  4J8T A;  3X42 A;  4KFD A;  2KAA A;  1SPU A;  1LOY A;  3MKI A;  1VQO 3;  3AHW A;  1Q81 4;  2RSX A;  2CK3 H;  4HBR A;  1B2M A;  1DYU A;  5G1L A;  3OWU A;  1CH0 A;  1QVF 2;  3FF2 A;  1UCK A;  2ML5 A;  3K9M C;  3BNB A;  4GSP A;  3F8X A;  1EEJ A;  1UGI A;  3PZW A;  2IUJ A;  1FUW A;  1FGT A;  1QAL A;  4MMX B;  4QWT A;  1STD A;  1VQ9 3;  3DGY A;  3D5I A;  4Q53 A;  3SOA A;  3SX1 A;  1OPY A;  4HKV B;  1RN4 A;  4HAA A;  5DRE A;  5HOH A;  2W56 A;  4WYK B;  5IG0 A;  3S27 A;  4BL2 A;  5DRV A;  1YNV X;  1MWT A;  1I2E A;  3DZL A;  2IYJ A;  4XBY A;  1MWS A;  3V92 A;  1LRA A;  1VQK 3;  4HZB B;  1IQ8 A;  2L4V A;  3H51 A;  1JV2 B;  1O7N B;  2SBL A;  3NBB A;  2HML B;  3QRD A;  4STD A;  5CF1 A;  2P38 A;  3B8L A;  4RNT A;  1VQN 3;  3Q90 A;  5LC6 A;  2F86 B;  1GOV A;  4I4K A;  5AEW B;  4LGQ A;  1B21 A;  4O3V A;  3AGO A;  4N6M A;  5D82 A;  3BB9 A;  3BNC A;  4IIA A;  1Q40 A;  4CJN A;  1Q7H A;  3JUM A;  1RGL A;  8RNT A;  4EV5 A;  2XEP A;  4LSO A;  2D1W A;  4WFO A;  3WHO A;  2CFG A;  3V98 A;  1Y4K A;  3SVA A;  1RCL A;  1TRQ A;  1QJG A;  1I2G A;  3HII A;  4HM1 B;  4LZI A;  3WMD A;  3DUK A;  3B4O A;  1RGK A;  4I5Q A;  4IT7 A;  3U1W A;  5IW9 A;  3JUQ A;  4HM7 B;  1BUJ A;  2BHM A;  3GSP A;  1GY5 A;  4RNY A;  3CCL 3;  1BNF A;  2W03 A;  1M90 4;  4OVM A;  3F9S A;  3GAX A;  3HX8 A;  1W5Z A;  3OW2 2;  4K1U A;  1FUT A;  2HMM B;  1BRG A;  1D6Y A;  1TFO A;  5CXO A;  5BXQ A;  2GBW B;  3FH1 A;  6GSP A;  5FGO A;  3WOF B;  1NB5 I;  4WYK A;  1VQ6 3;  4OUQ A;  2IA7 A;  2XGN A;  4K90 B;  3IMA B;  4XB5 A;  3O8Y A;  4FCJ A;  7STD A;  1O7M B;  1SJW A;  3MG1 A;  4HM2 B;  1KC8 4;  5TGN A;  3LXU X;  3EQQ B;  1OF5 B;  1C54 A;  3CCQ 3;  2H0G A;  3DY5 A;  6STD A;  3PYJ A;  1EG9 B;  1FGM A;  3CD6 3;  1SII A;  1RGC A;  1BOX A;  2W0Q A;  3LTB A;  3VSY A;  5CF2 A;  1TU5 A;  2V1L A;  1B2X A;  1LXE A;  1TJD A;  3NV0 B;  4KFE A;  3CNX A;  4EXR A;  1N5H A;  4R4K A;  5AIG A;  3D79 A;  5KP3 A;  4N3V A;  1JN5 B;  1RNB A;  3V99 A;  3N9H A;  3OV4 A;  1IK3 A;  1VQM 3;  1GOY A;  1LOX A;  1DMN A;  1MGW A;  3KSE D;  3FLJ A;  2Z76 A;  2Z6B A;  1JBT A;  5KP1 A;  5KP4 A;  5EQL A;  3MWZ A;  1UUG B;  2PZV A;  1DMQ A;  1Q86 4;  1BSE A;  1T3B A;  3UJM A;  3HOH A;  2OWP A;  1R4Y A;  3N8B A;  3CU3 A;  1FGQ A;  4MEI A;  4KZ1 A;  1I0X A;  5AYR B;  1JNQ A;  1GS3 A;  3KKG A;  4N6U A;  3CCE 3;  1LQG C;  1Q42 A;  1B2S A;  4ORL A;  3RGA A;  2Y73 A;  4H3U A;  3BND A;  3HI7 A;  3FKA A;  2ML6 A;  1X1X A;  5JPP A;  4BTY A;  3G0K A;  2BMQ B;  4FMA A;  4CDL A;  1W2B 2;  1Z1S A;  1DVD A;  4R1K A;  5IER A;  2MC8 A;  1ISK A;  2INX A;  3A5E A;  2QGU A;  1ASK A;  1N8Q A;  3AHS A;  2WGO A;  5BU4 A;  4FCZ A;  1AR0 A;  2CC3 A;  4XDW A;  2KF4 A;  3TDG A;  4U13 A;  1OCV A;  2KF6 A;  2XH9 A;  3EBY A;  1TFK A;  1OF5 A;  3U97 A;  4TX4 A;  1JZD A;  3GZY B;  4K1V A;  3WA3 A;  3NQY A;  5I97 A;  1TTO A;  1GMR A;  5ELJ A;  2OQE C;  3WDG B;  5M18 A;  1K8A 4;  4HM0 B;  2W2C A;  7GSP A;  3CC4 3;  3NV0 A;  3OWS A;  2AAE A;  5AIF A;  1K28 A;  1BSD A;  1WMP A;  2H0I A;  3VGN A;  1AQZ A;  1JN5 A;  1TP6 A;  4HM8 B;  3Q1C A;  4XM4 A;  4XBT A;  1BNI A;  1BRH A;  1CQS A;  1I3F A;  1W6G A;  1U8C B;  3LTA A;  5IF6 A;  4AKZ A;  1RMS A;  1YJW 3;  5AI1 A;  2KRT A;  5GSP A;  3RDE A;  3STD A;  1GMP A;  1NU3 A;  2F56 A;  1ZGX A;  1FA3 A;  1FGR A;  3LYG A;  1RDS A;  3G4S 3;  2P0M A;  4EW5 A;  2RBI A;  1IQX A;  1K41 A;  5AYS C;  3HIG A;  1ROA A;  1W2Z A;  1GSP A;  1W6C A;  1RJO A;  1EA2 A;  3F7X A;  2ZA4 A;  1GD3 A;  1BRI A;  1MNL A;  2GXF A;  3PS8 A;  2E2U A;  2XSO B;  1GMQ A;  5RNT A;  3CC7 3;  2B1X B;  1OAC A;  1RLS A;  2GEY A;  3DGL A;  5D81 A;  3K7C A;  2C11 A;  3NX0 A;  4MMY B;  3DMC A;  4R80 A;  2Z7A A;  3RNT A;  3AGN A;  2XF3 A;  5EVH A;  4CPK A;  4BTW A;  1A67 A;  2CFD A;  1KSI A;  2CFW A;  1GYB A;  1FZU A;  1HU9 A;  3CCU 3;  3NBR A;  5EEO A;  1TIJ A;  3HK4 A;  1LOV A;  2CX1 A;  3EC9 A;  1JB5 A;  3N54 B;  1IT8 A;  3I56 3;  1RHL A;  2CFK A;  3D4A A;  3ALA A;  3KN4 A;  1A90 A;  4XDV A;  1M9G A;  3K0Z A;  1FUS A;  2YFI B;  1UUW B;  3EBT A;  1JB4 A;  1BAN A;  1O7G B;  4O02 B;  3MG2 A;  4ZM8 A;  4BU4 A;  1MWU A;  1VQQ A;  3K63 A;  1JBR A;  2IY2 A;  3FZW A;  2XGL A;  1UI8 A;  3F8H A;  2GU1 A;  1I0V A;  1B20 A;  2LQV A;  4KT3 B;  3BNE A;  1BNS A;  5CLK A;  1ZS7 A;  4O2H A;  3SXX A;  2CFL A;  1V58 A;  5G2G A;  1RRL A;  4LMI A;  4N6N B;  1BNE A;  3H3H A;  4FMC A;  3FCS B;  4GB5 A;  1BNJ A;  1X1Y A;  2YX9 A;  1E3R A;  1RRH A;  1AVL A;  5HGR A;  1MOL A;  2J8X B;  4R9K A;  1W02 A;  2PNC A;  2JDI H;  2XFS A;  2F4Y A;  4LEH A;  5D83 A;  1JKG B;  5M19 A;  1BUQ A;  1WNH A;  1IV7 A;  4L7K A;  4N6T A;  3G6E 3;  4MMZ B;  1B27 A;  1YHQ 3;  3OWY A; 
#chains in the Genus database with same CATH homology
 5IG4 A;  3F40 A;  3Q2P A;  1YGE A;  2Z77 A;  1ZX2 A;  3GRD A;  3L0R A;  2CW9 A;  3FGY A;  4J9A A;  3WOE B;  1JJ2 2;  2BMR B;  1SQW A;  2WOH A;  1CEW I;  3LT9 A;  3UB1 A;  4L8P A;  2P09 A;  3X40 A;  3EN8 A;  4EBG A;  3B4P A;  1RKY A;  1UUV B;  2I9W A;  1S5A A;  1CYU A;  3CCR 3;  2P05 A;  1IT7 A;  1VZZ A;  5IEN A;  3T0U A;  3HZP A;  2XSH B;  1ZO2 A;  3MHE A;  3PGB A;  4MJD A;  4RZM A;  1OGX A;  2OQE A;  3CCS 3;  1N5P A;  3NM7 A;  3M8C A;  1WQL B;  1E97 A;  3DGN A;  3CCJ 3;  2YFL B;  1ROV A;  3G71 3;  4EC6 A;  3FG4 A;  5FW5 A;  1VQL 3;  4HJL B;  3S29 A;  1A2K A;  1HKX A;  3DGM A;  5AIH A;  3SOY A;  3ER7 A;  4KVH A;  4N6V 0;  5IEP A;  3CMA 3;  4XBX A;  1JKG A;  2Y74 A;  4HZ9 B;  2WOF A;  3LML A;  4HM6 B;  5IG5 A;  1N8R 4;  3EE1 A;  1M1X B;  3MSO A;  4HM4 B;  3MPH A;  4X2O A;  2O3O A;  2QEX 3;  4IPB A;  1QAF A;  1QVG 2;  4RBN A;  3NM2 A;  3EX9 A;  5JPU A;  3LTC A;  5CK6 A;  2HMK B;  3IPT A;  2F98 A;  4NHF A;  2CIU A;  5IG3 A;  1VQ4 3;  2A15 A;  1O7H B;  1IQY A;  2HMJ B;  1LVN A;  1M1K 4;  3BLZ A;  4H61 A;  2CHC A;  2ZDJ A;  5A0O B;  5AEU B;  4PEJ A;  1IDP A;  4WHA A;  4OK0 A;  4AEQ A;  3DGO A;  1O7P B;  1D6U A;  2MF7 A;  4RNZ A;  3EHC A;  3KSP A;  2RGQ A;  3DM8 A;  1YIJ 3;  1DVC A;  3KII A;  3KFQ C;  1YI2 3;  1O7W B;  4R9L A;  4G1M B;  4FR9 A;  3IJE B;  1TUH A;  1EKM A;  3VF1 A;  3X3Y A;  5BVB A;  2UX0 A;  1WMN A;  3CNM A;  3JUP A;  3A76 A;  3EJV A;  1Q82 4;  3SLU A;  2P0X A;  3JUO A;  2R4I A;  1AV4 A;  4HM3 B;  1RN7 A;  4GL6 A;  1WMO A;  1NB3 I;  2XR8 B;  1E3V A;  2OOV C;  2CWV A;  3T8N A;  1SIH A;  1PFP A;  4FMB A;  2Q07 A;  3LTD A;  4K61 A;  4NRE A;  1R4C A;  2YFJ B;  1ULJ B;  4KFF A;  3RGR A;  3F7S A;  3FG3 A;  1AVK A;  2HMN B;  4WWU C;  3ROB A;  1VQP 3;  1IV9 A;  3T8U A;  2F99 A;  2E2T A;  4O8S A;  2D42 A;  4EYC A;  1G96 A;  4N6L A;  1W00 A;  2KXG A;  2K0M A;  3EF8 A;  1NJI 4;  3X41 A;  1OH0 A;  3DXO A;  3F14 A;  3B7C A;  3SED A;  3UNL A;  1FUW A;  3EB8 A;  3FF0 A;  3JVC A;  3AMO B;  2CH9 A;  4EV2 A;  1PU4 A;  1T5Y A;  3NXJ A;  1W6Y A;  3MYT A;  3MG3 A;  2ZL8 A;  4FCM A;  1OUN A;  1UI7 A;  3OX9 A;  2XFT A;  4HM5 B;  3S28 A;  4AKY A;  2C10 A;  1F8N A;  2JQ5 A;  3CME 3;  3CC2 3;  3LOY A;  1VQ7 3;  1W01 A;  3FG1 A;  1OHO A;  3G16 A;  2W9Q A;  1GD4 A;  1D6Z A;  1IU7 A;  1WTH A;  1YJN 3;  2IUK A;  1YVB I;  3S67 A;  2E2V A;  1QAK A;  1A2V A;  1OHS A;  2HMO B;  2BT3 A;  1JRQ A;  1C7H A;  2FXT A;  2CG0 A;  4BTX A;  1VQ5 3;  2WGQ A;  2QIY A;  1EQK A;  3WA2 X;  1KD1 4;  3UL6 A;  1US1 A;  2QA4 3;  4HYZ A;  1JB2 A;  2LYX A;  3GWR A;  1U5O A;  2RCD A;  3D9R A;  2RFR A;  1GY6 A;  1IVW A;  2BNG A;  1OGZ A;  3G8Z A;  4CCV A;  1V74 A;  1K73 4;  3CXC 2;  1YIT 3;  4FMD A;  1YJ9 3;  1QMA A;  2IMJ A;  3NQZ A;  3PCR A;  2W6J H;  3GZB A;  1NWW A;  2STD A;  3CCM 3;  8CHO A;  2WO0 A;  2W04 A;  3LT8 A;  1LNH A;  2GU3 A;  1KWI A;  3AMO A;  3KE7 A;  5LC7 A;  3X3Z A;  1IVX A;  1ULI B;  3WOD G;  1N9E A;  3D3L A;  3FSD A;  1UW1 A;  1L5G B;  3CPW 2;  1NDO B;  1IVV A;  2B24 B;  3J7Y d;  1Q7Y 4;  1K9M 4;  2GBX B;  4JRF A;  1CYV A;  2BMO B;  2BO9 B;  3NUV A;  1STF I;  3NHX A;  2M7O A;  1DMM A;  2CWT A;  1GY7 A;  3E99 A;  2K54 A;  4L8O A;  2O9U X;  2KCD A;  3GZX B;  3GZR A;  3JUN A;  5STD A;  3X3X A;  1J2B A;  3PXM A;  2W9P A;  2OTL 3;  5ELU A;  2W56 B;  3QK9 A;  1S72 3;  1FGO A;  1KQS 2;  1W7C A;  2CKF B;  2FGT A;  3UL5 A;  3PCS A;  2OOV A;  3K5T A;  1N9J A;  1OHP A;  3LZA A;  1W4N A;  3CPO A;  4JF8 A;  3ECF A;  1IVU A;  2CWU A;  1VQ8 3;  3CCV 3;  3KZT A;  2XRX B;  2FNQ A;  3I0Y A;  3I55 3;  2OCT A;  5AII A;  3NBJ A;  3EN1 B;  2CG1 A;  2GEX A;  4WP5 A;  3S5C A;  4N6O B;  4X2H A;  4HVN A;  1NO3 A;  5JBS A;  1Q40 B;  3OXA A;  2OTJ 3;  5IEO A;  3LH4 A;  4J8T A;  3X42 A;  4KFD A;  1SPU A;  3MKI A;  1VQO 3;  1Q81 4;  2RSX A;  2CK3 H;  4HBR A;  1DYU A;  3OWU A;  1QVF 2;  3FF2 A;  2ML5 A;  3K9M C;  3BNB A;  3F8X A;  3PZW A;  2IUJ A;  1FGT A;  1QAL A;  4MMX B;  4QWT A;  1STD A;  1VQ9 3;  4Q53 A;  3SOA A;  3SX1 A;  1OPY A;  4HKV B;  5DRE A;  2W56 A;  4WYK B;  5IG0 A;  3S27 A;  5DRV A;  3DZL A;  4XBY A;  3V92 A;  1VQK 3;  4HZB B;  1IQ8 A;  2L4V A;  3H51 A;  1JV2 B;  1O7N B;  2SBL A;  3NBB A;  2HML B;  3QRD A;  4STD A;  5CF1 A;  2P38 A;  3B8L A;  1VQN 3;  3Q90 A;  5LC6 A;  2F86 B;  4I4K A;  5AEW B;  4LGQ A;  4O3V A;  4N6M A;  5D82 A;  3BB9 A;  3BNC A;  4IIA A;  1Q40 A;  3JUM A;  4EV5 A;  2XEP A;  4LSO A;  2D1W A;  4WFO A;  2CFG A;  3V98 A;  1Y4K A;  3SVA A;  1QJG A;  3HII A;  4HM1 B;  4LZI A;  3WMD A;  3DUK A;  3B4O A;  4IT7 A;  3U1W A;  5IW9 A;  3JUQ A;  4HM7 B;  2BHM A;  1GY5 A;  4RNY A;  3CCL 3;  2W03 A;  1M90 4;  4OVM A;  3F9S A;  3GAX A;  3HX8 A;  1W5Z A;  3OW2 2;  4K1U A;  2HMM B;  1D6Y A;  1TFO A;  5CXO A;  5BXQ A;  1VQ6 3;  2GBW B;  3FH1 A;  5FGO A;  3WOF B;  1NB5 I;  4WYK A;  4OUQ A;  2IA7 A;  2XGN A;  4K90 B;  3IMA B;  4XB5 A;  3O8Y A;  4FCJ A;  7STD A;  1O7M B;  1SJW A;  3MG1 A;  4HM2 B;  1KC8 4;  5TGN A;  3LXU X;  3EQQ B;  1OF5 B;  3CCQ 3;  3DY5 A;  6STD A;  3PYJ A;  1EG9 B;  1FGM A;  3CD6 3;  1SII A;  2W0Q A;  3LTB A;  3VSY A;  1TU5 A;  5CF2 A;  2V1L A;  1LXE A;  3NV0 B;  4KFE A;  3CNX A;  4EXR A;  1N5H A;  4R4K A;  5AIG A;  5KP3 A;  4N3V A;  1JN5 B;  3V99 A;  3N9H A;  3OV4 A;  1IK3 A;  1VQM 3;  1LOX A;  1DMN A;  3KSE D;  3FLJ A;  2Z76 A;  2Z6B A;  5KP1 A;  5KP4 A;  5EQL A;  3MWZ A;  2PZV A;  1DMQ A;  1Q86 4;  3UJM A;  2OWP A;  3N8B A;  3CU3 A;  1FGQ A;  4MEI A;  4KZ1 A;  5AYR B;  1JNQ A;  1GS3 A;  3KKG A;  4N6U A;  3CCE 3;  1Q42 A;  4ORL A;  3RGA A;  2Y73 A;  4H3U A;  3BND A;  3HI7 A;  3FKA A;  2ML6 A;  5JPP A;  4BTY A;  3G0K A;  2BMQ B;  4FMA A;  4CDL A;  1W2B 2;  1Z1S A;  1DVD A;  4R1K A;  5IER A;  2MC8 A;  1ISK A;  2INX A;  2QGU A;  1ASK A;  1N8Q A;  2WGO A;  4FCZ A;  1AR0 A;  2CC3 A;  4XDW A;  3TDG A;  4U13 A;  1OCV A;  2XH9 A;  3EBY A;  1TFK A;  1OF5 A;  3U97 A;  4TX4 A;  3GZY B;  4K1V A;  3WA3 A;  3NQY A;  5I97 A;  5ELJ A;  2OQE C;  3WDG B;  1K8A 4;  4HM0 B;  2W2C A;  3CC4 3;  3NV0 A;  3OWS A;  5AIF A;  1K28 A;  1WMP A;  3VGN A;  1JN5 A;  1TP6 A;  4HM8 B;  3Q1C A;  4XM4 A;  4XBT A;  1CQS A;  1W6G A;  5IF6 A;  1U8C B;  3LTA A;  4AKZ A;  1YJW 3;  5AI1 A;  2KRT A;  3STD A;  3RDE A;  1NU3 A;  1FA3 A;  1FGR A;  3LYG A;  3G4S 3;  2P0M A;  1IQX A;  1K41 A;  5AYS C;  3HIG A;  1ROA A;  1W2Z A;  1W6C A;  1RJO A;  1EA2 A;  3F7X A;  1GD3 A;  2GXF A;  1MNL A;  3PS8 A;  2E2U A;  2XSO B;  3CC7 3;  1OAC A;  2B1X B;  2GEY A;  3DGL A;  5D81 A;  3K7C A;  2C11 A;  3NX0 A;  4MMY B;  3DMC A;  4R80 A;  2Z7A A;  2XF3 A;  5EVH A;  4BTW A;  1A67 A;  2CFD A;  1KSI A;  2CFW A;  1GYB A;  1HU9 A;  3CCU 3;  3NBR A;  5EEO A;  1TIJ A;  3HK4 A;  3EC9 A;  1JB5 A;  3N54 B;  1IT8 A;  3I56 3;  2CFK A;  3ALA A;  3KN4 A;  1A90 A;  4XDV A;  1M9G A;  3K0Z A;  2YFI B;  1UUW B;  3EBT A;  1JB4 A;  1O7G B;  4O02 B;  3MG2 A;  4ZM8 A;  3K63 A;  3FZW A;  2XGL A;  1UI8 A;  3F8H A;  2GU1 A;  2LQV A;  3BNE A;  5CLK A;  3SXX A;  4O2H A;  2CFL A;  5G2G A;  1RRL A;  4LMI A;  4N6N B;  3H3H A;  4FMC A;  3FCS B;  4GB5 A;  2YX9 A;  1E3R A;  1RRH A;  1AVL A;  5HGR A;  1MOL A;  4R9K A;  1W02 A;  2PNC A;  2JDI H;  2XFS A;  4LEH A;  5D83 A;  1BUQ A;  1JKG B;  1WNH A;  1IV7 A;  4L7K A;  4N6T A;  3G6E 3;  4MMZ B;  1YHQ 3;  3OWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...