4N6TA

Adhiron: a stable and versatile peptide display scaffold - full length adhiron
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
79
structure length
79
Chain Sequence
b'ENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGGKKKLYEAKVWVKPWENFKELQEFKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhiron
publication title Adhiron: a stable and versatile peptide display scaffold for molecular recognition applications.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 16
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6tA00
4TX4A 1MNLA 4N6LA 1CYVA 1YVBI 4N6MA 2O9UX 1DVCA 2BO9B 3PS8A 3S67A 4N6NB 4IT7A 1CEWI 2W9PA 1CYUA 4N6OB 2OCTA 1A67A 1M9GA 3KSED 3MWZA 1G96A 1GD4A 1A90A 1MOLA 1TIJA 5LC6A 4EYCA 1STFI 3NX0A 3L0RA 1KWIA 1N9JA 4LZIA 4N6UA 3LH4A 1NB3I 1FA3A 2CH9A 2W9QA 1ROAA 4N6TA 3KFQC 5EQLA 1LXEA 3IMAB 4ZM8A 1GD3A 3UL5A 4CCVA 1N5PA 3QRDA 3GAXA 1EQKA 1IV9A 2KXGA 1IV7A 5LC7A 3PYJA 1FUWA 1PFPA 3SVAA 5ELUA 3UL6A 1WNHA 3Q2PA 3K9MC 1R4CA 5A0OB 1N5HA 1NB5I 3PXMA 1RN7A 5ELJA 4N6V0 1DVDA
chains in the Genus database with same CATH superfamily
1B3SA 3SOAA 1AY7A 1B21A 4HM6B 1MGRA 4EBGA 5BIRA 3KSPA 1VQ93 3KCHA 4I5QA 1BSDA 4TX4A 1BRKA 1TFOA 2STDA 3LTDA 1UUWB 1WTHA 4HZBB 3WR2A 1BU4A 1X1UA 1V74A 3VF1A 1CYVA 1BRNL 4J5GA 1FGOA 1NNVA 2BMQB 3FF2A 3GZYB 1VQ73 2GU1A 3DY5A 2IY2A 3WA3A 2H0GA 2OWPA 3ROBA 1GYBA 1FGTA 2BO9B 1LQGC 3Q3FA 4HM4B 3X3XA 1CEWI 5JBSA 1TU5A 3X40A 1CYUA 1Q7Y4 1VQO3 3D5IA 2GEYA 5G1LA 1A2KA 3CNMA 2B1XB 1BVIA 1NWWA 1RCKA 3HOHA 3OW22 1A67A 3DM8A 3V92A 1X1YA 1TRPA 3KSED 1UI7A 3FG3A 3B8LA 3NXJA 3X3YA 3LOYA 1IQXA 2W6JH 2H0HA 3MWZA 2HOHA 1BRJA 4HM7B 5D82A 1WMPA 2Z6BA 1DMQA 1I0XA 1UCJA 1Q824 3S29A 1BRHA 1US1A 2RSXA 3DUKA 1F8NA 1MWUA 5IEPA 1JKGA 1T3BA 2UUGC 1OHPA 1N9EA 3DMCA 1JZDA 1MOLA 3FGYA 3H3HA 3WA2X 1B2XA 4HZ9B 1SQWA 3DGNA 1FYSA 3RNTA 4EYCA 3DGOA 1YJ93 1ISKA 3DGMA 4O2HA 3TDGA 1WQLB 2XSHB 1QVG2 4XBYA 1VQ83 3AMOB 4ORLA 3L0RA 4R9KA 1KWIA 4LZIA 1FGMA 1R4YA 1JV2B 2ZL8A 2RNTA 3FCSB 3T8UA 2INXA 5BVBA 1I2GA 4GSPA 2B24B 5BU4A 1I8VA 4HKVB 1W2B2 1UUGB 1QALA 2P0XA 1HZ1A 3X3ZA 1PU4A 3RDEA 2XF3A 2P05A 1Q814 1WMOA 2C4BA 3GZBA 4GL6A 3A76A 2XR8B 4L8OA 2FXTA 2R41A 1B2MA 3CC23 1JBTA 1IQYA 3IMAB 4ZM8A 3ER7A 1K41A 3K5TA 1FUTA 3G8ZA 5M18A 1GD3A 1BANA 1RLSA 3EB8A 5KP4A 1M904 2I9WA 1D6UA 1HYFA 1S723 3CPOA 1BNSA 1GY6A 1RGFA 4NHFA 3MSOA 1IV9A 2XFTA 4BIRA 5LC7A 1OGZA 5D83A 2L1SA 3ECFA 1OHSA 5AYRB 1NJI4 1I0VA 2CFKA 2MC8A 7RNTA 2FNQA 1BSCA 1PFPA 1KQS2 3U97A 3CCV3 1W02A 2BT3A 1O7NB 3MG3A 1BNEA 1RRLA 1NB5I 2UGIA 1IYYA 2RGQA 4O8SA 4CPKA 1T2IA 4FCMA 1YIJ3 3EQQB 1HU9A 1RCLA 4WYKA 3EN8A 2HMNB 4GHOA 4KFFA 3OWUA 5ELJA 3MG1A 1K8A4 1V57A 3NM7A 4N6V0 4Q53A 4JRFA 1RJOA 2F98A 2Q07A 1YIT3 1OF5A 4LGQA 3FG4A 5G1KA 4MMYB 1K734 2HMJB 5AIHA 3MKIA 1GS3A 3F40A 3A5EA 1DMNA 3G0KA 1VQL3 4RNTA 1ASKA 4WP5A 4H61A 2CK3H 4MMXB 1LOXA 3H51A 4K90B 1K9M4 5IERA 3UJMA 1AVKA 2YX9A 3PS8A 3S67A 4N6NB 5AEWB 3CC43 2W9PA 3DXOA 2P09A 4LEHA 2QGUA 1AV4A 1IVWA 3JUPA 1RRHA 1EA2A 3MG2A 5BXQA 2CG0A 1MGWA 1LOVA 3SOYA 3CCR3 3I0YA 1RGLA 1ZO2A 1O7WB 1RNBA 1DETA 4JF8A 1W6GA 1UCLA 5EEOA 2W2CA 1G96A 6GSPA 4IPBA 1B27A 1NO3A 1RGGA 1LOYA 1UUVB 2HMLB 2R4IA 2IYJA 2V1LA 3M8CA 3PCRA 3G6E3 1EEJA 4HYZA 1IVUA 3RGRA 1A90A 1Q42A 4WHAA 3I553 2GSPA 3HI7A 3KZTA 3STDA 1FGRA 1E3RA 1X1XA 3O8YA 2IUJA 1TIJA 4PEJA 1VQN3 3F7SA 5LC6A 2M7OA 4RBNA 1YHQ3 1QJGA 2Z7AA 2W0QA 3X42A 3OWSA 1W6YA 2WOHA 3NX0A 1YVSA 3BU4A 3VSYA 3KKGA 4N3VA 1BRIA 1UGIA 3EX9A 3CCU3 4KFDA 4KVHA 2A15A 2ZDJA 2J8XB 2KF6A 2ZHXB 1KSIA 3GSPA 3D3LA 1FA3A 3JUMA 3MHEA 1TJDA 1TFKA 2HMMB 1GOUA 1JKGB 4BU4A 4OVMA 1ULIB 2LYXA 2W9QA 4HM2B 4HM5B 5GSPA 4EXRA 2H0IA 1RSNA 2D1WA 3KFQC 2F99A 1FUSA 3PCSA 3S28A 1LXEA 4FMAA 5HOHA 2KF3A 1M1XB 1GMQA 2GBWB 5M1AA 2KCDA 3GWRA 1VQ43 5IG5A 3CMA3 3UL5A 2HMKB 2IA7A 3NQYA 3QRDA 3VGNA 5CF2A 3CXC2 1OACA 2XEPA 4MMZB 1BNRA 3CCJ3 1IVXA 4BL2A 4BTWA 1IU7A 2JQ5A 4FMDA 4WFOA 5AIFA 1UDII 4HJLB 3F14A 4H3UA 1JNQA 3UL6A 6RNTA 2CWTA 3CNXA 3Q2PA 4FMBA 1ZX2A 2PZVA 1R4CA 5A0OB 3FG1A 1N5HA 1BSAA 2CFLA 3CCM3 3CD63 5DRVA 1GY7A 3NHXA 1AQZA 3NV0B 3BB9A 1UW1A 2KRTA 3NQZA 1E97A 1RTUA 3IPTA 1YGWA 1OGXA 1U5OA 2GU3A 1IT8A 2OTJ3 5CXOA 3NBRA 3F8HA 2BU4A 1LNIA 2QIYA 4RZMA 4BTXA 1RGCA 1YJN3 1IT7A 3EC9A 3GZRA 3PGBA 3CCE3 2ML5A 3AMOA 3EBTA 1YNVX 3N54B 1FW7A 7STDA 3FSDA 1W4NA 2W56B 1I70A 1SIHA 1RN4A 1SIIA 3DGLA 1RGKA 3LXUX 3BIRA 4J5KA 3K0ZA 5TGNA 1TTOA 4FCZA 4J8TA 3EJVA 3Q1CA 1RDSA 1VQ53 1Z1SA 2K54A 2P0MA 1B2SA 3KE7A 3BNBA 3OXAA 2O9UX 4N6MA 1VQK3 2CWVA 1DVCA 3EHCA 3BNDA 4FR9A 3UB1A 5IENA 3OWYA 1Q40B 1X1WA 1V58A 2E2TA 1RGAA 2YFLB 3N8BA 1MWTA 4IT7A 6STDA 4N6OB 5DREA 3F7XA 1ULJB 1OPYA 5IG3A 1RHLA 1BNJA 1BSEA 2CHCA 3MPHA 1OF5B 1G0TA 2ML6A 1M9GA 1QAFA 1CQSA 2BMOB 3E99A 1W00A 1ZGXA 3CME3 1B2ZA 1JN5A 2RFRA 4G1MB 3NBJA 8RNTA 4K1VA 2K3DA 2GBXB 3BNCA 4L7KA 3SLUA 2QEX3 1LOWA 2W03A 3SYUA 1KD14 4HVNA 2SBLA 1QAKA 4MJDA 3AGNA 1O7MB 2BNGA 5IW9A 1KC84 2OTL3 1D6YA 1T5YA 2BHMA 1IVVA 1AR0A 3FLJA 1BUQA 1RNTA 3LTAA 3PZWA 4I4KA 3MYTA 5CF1A 3D9RA 5AI1A 4EC6A 2AADA 1BUJA 4CJNA 3B4OA 5STDA 5HGRA 1CH0A 1YJW3 1STFI 1I2EA 2CFWA 3WDGB 4FCJA 2F4YA 4N6UA 2F5WA 4KFEA 3FF0A 3G713 1OUNA 1JRQA 1NB3I 5KP1A 4X2OA 1YGEA 3U1WA 3HIIA 1GSPA 1W2ZA 3CCQ3 1EKMA 5CLKA 3CCS3 1PY3A 1DYUA 3WOFB 4KZ1A 1FGQA 4RNYA 2OOVA 4N6TA 1M1K4 1Q7HA 4NREA 5EQLA 1UCKA 4AKYA 2E2VA 4XM4A 1TUHA 3BLZA 4GB5A 4LYLB 2CX1A 4CDLA 3LYGA 3WOEB 2GEXA 3F8XA 3WMDA 3CU3A 4CCVA 5JPUA 3WODG 2XH9A 4FMCA 4R9LA 3K7CA 2KF5A 2OOVC 3GAXA 3EE1A 1RGHA 5IG4A 3HX8A 3B7CA 2KXGA 3CC73 2XGLA 1JZOA 3SEDA 1W6CA 3D4AA 2CKFB 1A2VA 3PYJA 4OUQA 1IQ8A 3LTBA 1K28A 3RGAA 1BGSA 4BTYA 1JB5A 1HKXA 4QWTA 3SVAA 2CX0A 5ELUA 5JPPA 4LMIA 1BOXA 1WNHA 2ZA4A 2LQVA 2YFIB 3JUQA 1UI8A 1UGHI 1JJ22 2Z76A 1QVF2 3BNEA 1JBRA 3LTCA 2RCDA 2L4VA 3EF8A 1EUIC 1SPUA 1E3VA 5AIIA 1RMSA 1W5ZA 2MF7A 5AEUB 5IEOA 1L5GB 3V98A 1Y4KA 1BNIA 5I97A 1B2UA 1GOVA 4MEIA 3FH1A 5AIGA 1OHOA 3SX1A 1QMAA 1LNHA 3LT8A 2WGOA 4O3VA 3B4PA 3JUOA 3WHOA 1D6ZA 1GMPA 1MWSA 1TP6A 3URPA 3S5CA 2F5MA 3JUNA 3K63A 3D5GA 4O02B 2RBIA 1A2PA 3V99A 1IDPA 1GY5A 2IMJA 1MNLA 3GZXB 2Y73A 4N6LA 5AYSC 1I3IA 4HM8B 4NPBA 3OV4A 1I3FA 3LT9A 2WOFA 4HM0B 5RNTA 1C54A 1YVBI 3CPW2 2CG1A 5IF6A 8CHOA 2PNCA 2WGQA 3EBYA 3T8NA 3J7Yd 2BIRA 1VZZA 3FZWA 1STDA 4IIAA 4ILFA 3I563 3SXXA 4WWUC 2OCTA 4X2HA 1VQM3 2F56A 4HM3B 2D42A 3HK4A 1AVLA 4L8PA 3S27A 9RNTA 4KT3B 1BSBA 1MWRA 4R80A 1JBSA 1BRSA 2XGNA 2K0MA 1NDOB 4LSOA 2UX0A 2Y74A 4HBRA 1YI23 1VQP3 1GD4A 2CIUA 1LVNA 2AAEA 2CFDA 1VQ63 2CC3A 2HMOB 5CK6A 3T0UA 3AHWA 2P38A 2W04A 2XSOB 4U13A 2C10A 1OH0A 4HOHA 3ZFZA 1J2BA 1O7GB 5IG0A 2OQEA 1O7PB 3F9SA 3NV0A 4EW5A 4WYKB 2GXFA 2CW9A 4XBXA 1TRQA 3X41A 4XBTA 3QK9A 2CFGA 5D81A 1U8CB 1DE3A 2OQEC 1JN5B 1OCVA 2C11A 2KAAA 1SARA 1IK3A 1JB4A 1N9JA 2F86B 1BAOA 1W7CA 3ALAA 3LH4A 1ROVA 2W56A 1BIRA 4RNZA 2CH9A 4AEQA 3AHSA 1LRAA 2SARA 1EG9B 2O3OA 1GMRA 2JDIH 5EVHA 2QA43 1FZUA 3G16A 3KIIA 4R4KA 1ROAA 3DGYA 2WO0A 3HIGA 3ZG5A 1JB2A 1BNGA 4XDWA 1PYLA 5FGOA 4EV5A 1VQQA 1DMMA 3OX9A 4HM1B 1Q9EA 1W01A 4K1UA 2YFJB 1Q40A 2CWUA 3NM2A 4EV2A 3NBBA 3Q90A 1RGEA 1NU3A 3FKAA 3LMLA 3IJEB 1N5PA 1EQKA 5FW5A 4K61A 1WMNA 3N9HA 4R1KA 3KN4A 1IV7A 2KF4A 3HZPA 1ZS7A 4DKIA 1RKYA 1N8QA 7GSPA 1GOYA 1FUWA 4OK0A 3EN1B 1S5AA 4XB5A 3UNLA 2XRXB 1RN1A 3DH2A 3GRDA 1O7HB 3K9MC 4BL3A 1B20A 1T2HA 5M19A 2E2UA 2BMRB 3CCL3 3PXMA 2IUKA 2FGTA 3JVCA 4J9AA 2Z77A 3AGOA 4XDVA 1G02A 3NUVA 1RN7A 1I2FA 4HAAA 3DZLA 4STDA 1BRGA 3LZAA 5G2GA 1BNFA 3D79A 3ZG0A 3G4S3 1C7HA 1SJWA 4AKZA 1Q864 1DVDA 5KP3A 2XFSA 1UCIA 1N8R4 1LQMB
chains in the Genus database with same CATH topology
3SOAA 4HM6B 4EBGA 3KSPA 4TX4A 2STDA 1TFOA 3LTDA 4HZBB 1UUWB 1WTHA 1V74A 3VF1A 1CYVA 1FGOA 2BMQB 3FF2A 3GZYB 1VQ73 2GU1A 3DY5A 3WA3A 2OWPA 3ROBA 1GYBA 1FGTA 2BO9B 4HM4B 3X3XA 1CEWI 5JBSA 1TU5A 3X40A 1CYUA 1Q7Y4 1VQO3 2GEYA 1A2KA 3CNMA 2B1XB 1NWWA 3OW22 1A67A 3DM8A 3V92A 3KSED 1UI7A 3FG3A 3B8LA 3NXJA 3X3YA 3LOYA 1IQXA 2W6JH 3MWZA 4HM7B 5D82A 1WMPA 2Z6BA 1DMQA 1Q824 3S29A 1US1A 2RSXA 3DUKA 1F8NA 5IEPA 1JKGA 3DMCA 1OHPA 1N9EA 3FGYA 1MOLA 3H3HA 3WA2X 4HZ9B 1SQWA 3DGNA 4EYCA 3DGOA 1YJ93 1ISKA 3DGMA 4O2HA 3TDGA 1WQLB 2XSHB 1QVG2 4XBYA 1VQ83 3AMOB 4ORLA 3L0RA 4R9KA 1KWIA 4LZIA 1FGMA 1JV2B 2ZL8A 3FCSB 3T8UA 2INXA 5BVBA 2B24B 4HKVB 1W2B2 1QALA 2P0XA 3X3ZA 1PU4A 3RDEA 2XF3A 2P05A 1Q814 1WMOA 3GZBA 4GL6A 3A76A 2XR8B 4L8OA 2FXTA 3CC23 1IQYA 3IMAB 4ZM8A 3ER7A 1K41A 3K5TA 1M904 3G8ZA 1GD3A 3EB8A 5KP4A 2I9WA 1D6UA 1S723 3CPOA 1GY6A 4NHFA 3MSOA 1IV9A 2XFTA 5LC7A 1OGZA 5D83A 3ECFA 1OHSA 5AYRB 1NJI4 2CFKA 2MC8A 2FNQA 1PFPA 1KQS2 3U97A 3CCV3 1W02A 2BT3A 1O7NB 3MG3A 1RRLA 1NB5I 2RGQA 4O8SA 1YIJ3 4FCMA 3EQQB 1HU9A 4WYKA 3EN8A 2HMNB 4KFFA 3OWUA 5ELJA 3MG1A 1K8A4 3NM7A 4N6V0 4Q53A 4JRFA 1RJOA 2F98A 2Q07A 1YIT3 1OF5A 4LGQA 3FG4A 1K734 4MMYB 2HMJB 5AIHA 3MKIA 1GS3A 3F40A 1DMNA 3G0KA 1VQL3 1ASKA 4WP5A 4H61A 2CK3H 4MMXB 1LOXA 3H51A 4K90B 1K9M4 5IERA 3UJMA 1AVKA 2YX9A 3PS8A 3S67A 4N6NB 5AEWB 3CC43 2W9PA 3DXOA 2P09A 4LEHA 2QGUA 1AV4A 1IVWA 3JUPA 1RRHA 1EA2A 3MG2A 5BXQA 2CG0A 3SOYA 3CCR3 3I0YA 1ZO2A 1O7WB 4JF8A 1W6GA 5EEOA 2W2CA 1G96A 4IPBA 1NO3A 3G6E3 2HMLB 1UUVB 2R4IA 2V1LA 3M8CA 3PCRA 3CCJ3 4HYZA 1IVUA 3RGRA 1A90A 1Q42A 4WHAA 3I553 3HI7A 3STDA 3KZTA 1FGRA 1E3RA 3O8YA 2IUJA 1TIJA 4PEJA 1VQN3 3F7SA 5LC6A 2M7OA 4RBNA 1YHQ3 1QJGA 2Z7AA 2W0QA 3X42A 3OWSA 1W6YA 2WOHA 3NX0A 3VSYA 3KKGA 4N3VA 3EX9A 3CCU3 4KFDA 4KVHA 2A15A 2ZDJA 1KSIA 1FA3A 3D3LA 3JUMA 3MHEA 1TFKA 2HMMB 1JKGB 4OVMA 1ULIB 2LYXA 2W9QA 4HM2B 4HM5B 4EXRA 2D1WA 3KFQC 2F99A 3PCSA 3S28A 1LXEA 4FMAA 1M1XB 2GBWB 2KCDA 3GWRA 1VQ43 5IG5A 3CMA3 3UL5A 2HMKB 2IA7A 3NQYA 3QRDA 3VGNA 5CF2A 3CXC2 1OACA 2XEPA 4MMZB 1IVXA 4BTWA 1IU7A 2JQ5A 4FMDA 4WFOA 5AIFA 4HJLB 3F14A 4H3UA 1JNQA 3UL6A 2CWTA 3CNXA 3Q2PA 4FMBA 1ZX2A 2PZVA 1R4CA 5A0OB 3FG1A 1N5HA 2CFLA 3CCM3 3CD63 5DRVA 1GY7A 3NHXA 3NV0B 3BB9A 1UW1A 2KRTA 3NQZA 1E97A 3IPTA 1OGXA 1U5OA 2GU3A 1IT8A 2OTJ3 5CXOA 3NBRA 3F8HA 2QIYA 4RZMA 4BTXA 1YJN3 1IT7A 3EC9A 3GZRA 3PGBA 3CCE3 2ML5A 3AMOA 3EBTA 3N54B 7STDA 3FSDA 1W4NA 2W56B 1SIHA 1SIIA 3DGLA 3LXUX 3K0ZA 5TGNA 4FCZA 4J8TA 3EJVA 3Q1CA 1VQ53 1Z1SA 2K54A 2P0MA 3KE7A 3OXAA 3BNBA 4N6MA 2O9UX 1VQK3 2CWVA 1DVCA 3EHCA 3BNDA 4FR9A 3UB1A 5IENA 3OWYA 1Q40B 3N8BA 2E2TA 4IT7A 2YFLB 6STDA 4N6OB 5DREA 3F7XA 1ULJB 1OPYA 5IG3A 2CHCA 3MPHA 1OF5B 2ML6A 1M9GA 1QAFA 1CQSA 2BMOB 3E99A 1W00A 3CME3 2RFRA 1JN5A 4G1MB 3NBJA 4K1VA 2GBXB 3BNCA 4L7KA 3SLUA 2QEX3 2W03A 1KD14 4HVNA 2SBLA 1QAKA 4MJDA 5IW9A 1O7MB 2BNGA 1KC84 2OTL3 1D6YA 1T5YA 2BHMA 1IVVA 1AR0A 3FLJA 1BUQA 3LTAA 3PZWA 4I4KA 3MYTA 5CF1A 3D9RA 5AI1A 4EC6A 3B4OA 5STDA 5HGRA 1YJW3 1STFI 2CFWA 3WDGB 4FCJA 4N6UA 4KFEA 3FF0A 3G713 1OUNA 1JRQA 1NB3I 5KP1A 4X2OA 1YGEA 3U1WA 3HIIA 3CCQ3 1W2ZA 1EKMA 5CLKA 3CCS3 1DYUA 3WOFB 4KZ1A 1FGQA 4RNYA 2OOVA 4N6TA 1M1K4 4NREA 5EQLA 4AKYA 2E2VA 4XM4A 1TUHA 3BLZA 4GB5A 4CDLA 3LYGA 3WOEB 2GEXA 3F8XA 3WMDA 3CU3A 4CCVA 5JPUA 3WODG 2XH9A 4FMCA 4R9LA 3K7CA 2OOVC 3GAXA 3EE1A 5IG4A 3HX8A 3B7CA 2KXGA 3CC73 2XGLA 3SEDA 1W6CA 2CKFB 1A2VA 3PYJA 4OUQA 1IQ8A 3LTBA 1K28A 3RGAA 4BTYA 1JB5A 1HKXA 4QWTA 3SVAA 5JPPA 5ELUA 4LMIA 1WNHA 2LQVA 2YFIB 3JUQA 1UI8A 1JJ22 2Z76A 1QVF2 3BNEA 3LTCA 2RCDA 2L4VA 3EF8A 1SPUA 5AIIA 1E3VA 5AEUB 2MF7A 1W5ZA 5IEOA 1L5GB 3V98A 1Y4KA 5I97A 1DVDA 5AIGA 4MEIA 3FH1A 3SX1A 1OHOA 1VQ93 1QMAA 1LNHA 3LT8A 2WGOA 4O3VA 3B4PA 3JUOA 1D6ZA 1TP6A 3S5CA 3JUNA 3K63A 4O02B 3V99A 1IDPA 1GY5A 2IMJA 1MNLA 3GZXB 2Y73A 4N6LA 5AYSC 4HM8B 3OV4A 3LT9A 2WOFA 4HM0B 1YVBI 3CPW2 2CG1A 5IF6A 8CHOA 2PNCA 2WGQA 3EBYA 3T8NA 3J7Yd 1VZZA 3FZWA 1STDA 4IIAA 3I563 3SXXA 4WWUC 2OCTA 4X2HA 1VQM3 4HM3B 2D42A 3HK4A 1AVLA 4L8PA 3S27A 4R80A 2XGNA 2K0MA 1NDOB 4LSOA 2UX0A 2Y74A 4HBRA 1YI23 1VQP3 1GD4A 2CIUA 1LVNA 2CFDA 1VQ63 2CC3A 2HMOB 5CK6A 3T0UA 2P38A 2W04A 2XSOB 4U13A 2C10A 1OH0A 1J2BA 1O7GB 5IG0A 2OQEA 1O7PB 3F9SA 3NV0A 4WYKB 2GXFA 2CW9A 4XBXA 3X41A 4XBTA 3QK9A 2CFGA 5D81A 1U8CB 2OQEC 1JN5B 1OCVA 2C11A 1IK3A 1JB4A 1N9JA 2F86B 1W7CA 3ALAA 3LH4A 1ROVA 2W56A 4RNZA 2CH9A 4AEQA 1EG9B 2O3OA 2JDIH 5EVHA 2QA43 3G16A 3KIIA 4R4KA 1ROAA 1N8R4 2WO0A 3HIGA 4EV5A 1JB2A 4XDWA 5FGOA 1DMMA 3OX9A 4HM1B 4K1UA 1W01A 2YFJB 1Q40A 2CWUA 3NM2A 4EV2A 3NBBA 3Q90A 3FKAA 1NU3A 3LMLA 3IJEB 1N5PA 1EQKA 5FW5A 4K61A 1WMNA 3N9HA 4R1KA 3KN4A 1IV7A 3HZPA 1RKYA 1N8QA 1FUWA 4OK0A 3EN1B 1S5AA 4XB5A 3UNLA 2XRXB 3GRDA 1O7HB 3K9MC 2E2UA 2BMRB 3CCL3 3PXMA 2IUKA 2FGTA 3JVCA 4J9AA 2Z77A 4XDVA 3NUVA 1RN7A 4STDA 3DZLA 3LZAA 5G2GA 3G4S3 1C7HA 1SJWA 4AKZA 1Q864 5KP3A 2XFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX4 A;  1MNL A;  4N6L A;  1CYV A;  1YVB I;  4N6M A;  2O9U X;  1DVC A;  2BO9 B;  3PS8 A;  3S67 A;  4N6N B;  4IT7 A;  1CEW I;  2W9P A;  1CYU A;  4N6O B;  2OCT A;  1A67 A;  1M9G A;  3KSE D;  3MWZ A;  1G96 A;  1GD4 A;  1A90 A;  1MOL A;  1TIJ A;  5LC6 A;  4EYC A;  1STF I;  3NX0 A;  3L0R A;  1KWI A;  1N9J A;  4LZI A;  4N6U A;  3LH4 A;  1NB3 I;  1FA3 A;  2CH9 A;  2W9Q A;  1ROA A;  4N6T A;  3KFQ C;  5EQL A;  1LXE A;  3IMA B;  4ZM8 A;  1GD3 A;  3UL5 A;  4CCV A;  1N5P A;  3QRD A;  3GAX A;  1EQK A;  1IV9 A;  2KXG A;  1IV7 A;  5LC7 A;  3PYJ A;  1FUW A;  1PFP A;  3SVA A;  5ELU A;  3UL6 A;  1WNH A;  3Q2P A;  3K9M C;  1R4C A;  5A0O B;  1N5H A;  1NB5 I;  3PXM A;  1RN7 A;  5ELJ A;  4N6V 0;  1DVD A; 
#chains in the Genus database with same CATH topology
 1B3S A;  3SOA A;  1AY7 A;  1B21 A;  4HM6 B;  1MGR A;  4EBG A;  5BIR A;  3KSP A;  1VQ9 3;  3KCH A;  4I5Q A;  1BSD A;  4TX4 A;  1BRK A;  1TFO A;  2STD A;  3LTD A;  1UUW B;  1WTH A;  4HZB B;  3WR2 A;  1BU4 A;  1X1U A;  1V74 A;  3VF1 A;  1CYV A;  1BRN L;  4J5G A;  1FGO A;  1NNV A;  2BMQ B;  3FF2 A;  3GZY B;  1VQ7 3;  2GU1 A;  3DY5 A;  2IY2 A;  3WA3 A;  2H0G A;  2OWP A;  3ROB A;  1GYB A;  1FGT A;  2BO9 B;  1LQG C;  3Q3F A;  4HM4 B;  3X3X A;  1CEW I;  5JBS A;  1TU5 A;  3X40 A;  1CYU A;  1Q7Y 4;  1VQO 3;  3D5I A;  2GEY A;  5G1L A;  1A2K A;  3CNM A;  2B1X B;  1BVI A;  1NWW A;  1RCK A;  3HOH A;  3OW2 2;  1A67 A;  3DM8 A;  3V92 A;  1X1Y A;  1TRP A;  3KSE D;  1UI7 A;  3FG3 A;  3B8L A;  3NXJ A;  3X3Y A;  3LOY A;  1IQX A;  2W6J H;  2H0H A;  3MWZ A;  2HOH A;  1BRJ A;  4HM7 B;  5D82 A;  1WMP A;  2Z6B A;  1DMQ A;  1I0X A;  1UCJ A;  1Q82 4;  3S29 A;  1BRH A;  1US1 A;  2RSX A;  3DUK A;  1F8N A;  1MWU A;  5IEP A;  1JKG A;  1T3B A;  2UUG C;  1OHP A;  1N9E A;  3DMC A;  1JZD A;  1MOL A;  3FGY A;  3H3H A;  3WA2 X;  1B2X A;  4HZ9 B;  1SQW A;  3DGN A;  1FYS A;  3RNT A;  4EYC A;  3DGO A;  1YJ9 3;  1ISK A;  3DGM A;  4O2H A;  3TDG A;  1WQL B;  2XSH B;  1QVG 2;  4XBY A;  1VQ8 3;  3AMO B;  4ORL A;  3L0R A;  4R9K A;  1KWI A;  4LZI A;  1FGM A;  1R4Y A;  1JV2 B;  2ZL8 A;  2RNT A;  3FCS B;  3T8U A;  2INX A;  5BVB A;  1I2G A;  4GSP A;  2B24 B;  5BU4 A;  1I8V A;  4HKV B;  1W2B 2;  1UUG B;  1QAL A;  2P0X A;  1HZ1 A;  3X3Z A;  1PU4 A;  3RDE A;  2XF3 A;  2P05 A;  1Q81 4;  1WMO A;  2C4B A;  3GZB A;  4GL6 A;  3A76 A;  2XR8 B;  4L8O A;  2FXT A;  2R41 A;  1B2M A;  3CC2 3;  1JBT A;  1IQY A;  3IMA B;  4ZM8 A;  3ER7 A;  1K41 A;  3K5T A;  1FUT A;  3G8Z A;  5M18 A;  1GD3 A;  1BAN A;  1RLS A;  3EB8 A;  5KP4 A;  1M90 4;  2I9W A;  1D6U A;  1HYF A;  1S72 3;  3CPO A;  1BNS A;  1GY6 A;  1RGF A;  4NHF A;  3MSO A;  1IV9 A;  2XFT A;  4BIR A;  5LC7 A;  1OGZ A;  5D83 A;  2L1S A;  3ECF A;  1OHS A;  5AYR B;  1NJI 4;  1I0V A;  2CFK A;  2MC8 A;  7RNT A;  2FNQ A;  1BSC A;  1PFP A;  1KQS 2;  3U97 A;  3CCV 3;  1W02 A;  2BT3 A;  1O7N B;  3MG3 A;  1BNE A;  1RRL A;  1NB5 I;  2UGI A;  1IYY A;  2RGQ A;  4O8S A;  4CPK A;  1T2I A;  4FCM A;  1YIJ 3;  3EQQ B;  1HU9 A;  1RCL A;  4WYK A;  3EN8 A;  2HMN B;  4GHO A;  4KFF A;  3OWU A;  5ELJ A;  3MG1 A;  1K8A 4;  1V57 A;  3NM7 A;  4N6V 0;  4Q53 A;  4JRF A;  1RJO A;  2F98 A;  2Q07 A;  1YIT 3;  1OF5 A;  4LGQ A;  3FG4 A;  5G1K A;  4MMY B;  1K73 4;  2HMJ B;  5AIH A;  3MKI A;  1GS3 A;  3F40 A;  3A5E A;  1DMN A;  3G0K A;  1VQL 3;  4RNT A;  1ASK A;  4WP5 A;  4H61 A;  2CK3 H;  4MMX B;  1LOX A;  3H51 A;  4K90 B;  1K9M 4;  5IER A;  3UJM A;  1AVK A;  2YX9 A;  3PS8 A;  3S67 A;  4N6N B;  5AEW B;  3CC4 3;  2W9P A;  3DXO A;  2P09 A;  4LEH A;  2QGU A;  1AV4 A;  1IVW A;  3JUP A;  1RRH A;  1EA2 A;  3MG2 A;  5BXQ A;  2CG0 A;  1MGW A;  1LOV A;  3SOY A;  3CCR 3;  3I0Y A;  1RGL A;  1ZO2 A;  1O7W B;  1RNB A;  1DET A;  4JF8 A;  1W6G A;  1UCL A;  5EEO A;  2W2C A;  1G96 A;  6GSP A;  4IPB A;  1B27 A;  1NO3 A;  1RGG A;  1LOY A;  1UUV B;  2HML B;  2R4I A;  2IYJ A;  2V1L A;  3M8C A;  3PCR A;  3G6E 3;  1EEJ A;  4HYZ A;  1IVU A;  3RGR A;  1A90 A;  1Q42 A;  4WHA A;  3I55 3;  2GSP A;  3HI7 A;  3KZT A;  3STD A;  1FGR A;  1E3R A;  1X1X A;  3O8Y A;  2IUJ A;  1TIJ A;  4PEJ A;  1VQN 3;  3F7S A;  5LC6 A;  2M7O A;  4RBN A;  1YHQ 3;  1QJG A;  2Z7A A;  2W0Q A;  3X42 A;  3OWS A;  1W6Y A;  2WOH A;  3NX0 A;  1YVS A;  3BU4 A;  3VSY A;  3KKG A;  4N3V A;  1BRI A;  1UGI A;  3EX9 A;  3CCU 3;  4KFD A;  4KVH A;  2A15 A;  2ZDJ A;  2J8X B;  2KF6 A;  2ZHX B;  1KSI A;  3GSP A;  3D3L A;  1FA3 A;  3JUM A;  3MHE A;  1TJD A;  1TFK A;  2HMM B;  1GOU A;  1JKG B;  4BU4 A;  4OVM A;  1ULI B;  2LYX A;  2W9Q A;  4HM2 B;  4HM5 B;  5GSP A;  4EXR A;  2H0I A;  1RSN A;  2D1W A;  3KFQ C;  2F99 A;  1FUS A;  3PCS A;  3S28 A;  1LXE A;  4FMA A;  5HOH A;  2KF3 A;  1M1X B;  1GMQ A;  2GBW B;  5M1A A;  2KCD A;  3GWR A;  1VQ4 3;  5IG5 A;  3CMA 3;  3UL5 A;  2HMK B;  2IA7 A;  3NQY A;  3QRD A;  3VGN A;  5CF2 A;  3CXC 2;  1OAC A;  2XEP A;  4MMZ B;  1BNR A;  3CCJ 3;  1IVX A;  4BL2 A;  4BTW A;  1IU7 A;  2JQ5 A;  4FMD A;  4WFO A;  5AIF A;  1UDI I;  4HJL B;  3F14 A;  4H3U A;  1JNQ A;  3UL6 A;  6RNT A;  2CWT A;  3CNX A;  3Q2P A;  4FMB A;  1ZX2 A;  2PZV A;  1R4C A;  5A0O B;  3FG1 A;  1N5H A;  1BSA A;  2CFL A;  3CCM 3;  3CD6 3;  5DRV A;  1GY7 A;  3NHX A;  1AQZ A;  3NV0 B;  3BB9 A;  1UW1 A;  2KRT A;  3NQZ A;  1E97 A;  1RTU A;  3IPT A;  1YGW A;  1OGX A;  1U5O A;  2GU3 A;  1IT8 A;  2OTJ 3;  5CXO A;  3NBR A;  3F8H A;  2BU4 A;  1LNI A;  2QIY A;  4RZM A;  4BTX A;  1RGC A;  1YJN 3;  1IT7 A;  3EC9 A;  3GZR A;  3PGB A;  3CCE 3;  2ML5 A;  3AMO A;  3EBT A;  1YNV X;  3N54 B;  1FW7 A;  7STD A;  3FSD A;  1W4N A;  2W56 B;  1I70 A;  1SIH A;  1RN4 A;  1SII A;  3DGL A;  1RGK A;  3LXU X;  3BIR A;  4J5K A;  3K0Z A;  5TGN A;  1TTO A;  4FCZ A;  4J8T A;  3EJV A;  3Q1C A;  1RDS A;  1VQ5 3;  1Z1S A;  2K54 A;  2P0M A;  1B2S A;  3KE7 A;  3BNB A;  3OXA A;  2O9U X;  4N6M A;  1VQK 3;  2CWV A;  1DVC A;  3EHC A;  3BND A;  4FR9 A;  3UB1 A;  5IEN A;  3OWY A;  1Q40 B;  1X1W A;  1V58 A;  2E2T A;  1RGA A;  2YFL B;  3N8B A;  1MWT A;  4IT7 A;  6STD A;  4N6O B;  5DRE A;  3F7X A;  1ULJ B;  1OPY A;  5IG3 A;  1RHL A;  1BNJ A;  1BSE A;  2CHC A;  3MPH A;  1OF5 B;  1G0T A;  2ML6 A;  1M9G A;  1QAF A;  1CQS A;  2BMO B;  3E99 A;  1W00 A;  1ZGX A;  3CME 3;  1B2Z A;  1JN5 A;  2RFR A;  4G1M B;  3NBJ A;  8RNT A;  4K1V A;  2K3D A;  2GBX B;  3BNC A;  4L7K A;  3SLU A;  2QEX 3;  1LOW A;  2W03 A;  3SYU A;  1KD1 4;  4HVN A;  2SBL A;  1QAK A;  4MJD A;  3AGN A;  1O7M B;  2BNG A;  5IW9 A;  1KC8 4;  2OTL 3;  1D6Y A;  1T5Y A;  2BHM A;  1IVV A;  1AR0 A;  3FLJ A;  1BUQ A;  1RNT A;  3LTA A;  3PZW A;  4I4K A;  3MYT A;  5CF1 A;  3D9R A;  5AI1 A;  4EC6 A;  2AAD A;  1BUJ A;  4CJN A;  3B4O A;  5STD A;  5HGR A;  1CH0 A;  1YJW 3;  1STF I;  1I2E A;  2CFW A;  3WDG B;  4FCJ A;  2F4Y A;  4N6U A;  2F5W A;  4KFE A;  3FF0 A;  3G71 3;  1OUN A;  1JRQ A;  1NB3 I;  5KP1 A;  4X2O A;  1YGE A;  3U1W A;  3HII A;  1GSP A;  1W2Z A;  3CCQ 3;  1EKM A;  5CLK A;  3CCS 3;  1PY3 A;  1DYU A;  3WOF B;  4KZ1 A;  1FGQ A;  4RNY A;  2OOV A;  4N6T A;  1M1K 4;  1Q7H A;  4NRE A;  5EQL A;  1UCK A;  4AKY A;  2E2V A;  4XM4 A;  1TUH A;  3BLZ A;  4GB5 A;  4LYL B;  2CX1 A;  4CDL A;  3LYG A;  3WOE B;  2GEX A;  3F8X A;  3WMD A;  3CU3 A;  4CCV A;  5JPU A;  3WOD G;  2XH9 A;  4FMC A;  4R9L A;  3K7C A;  2KF5 A;  2OOV C;  3GAX A;  3EE1 A;  1RGH A;  5IG4 A;  3HX8 A;  3B7C A;  2KXG A;  3CC7 3;  2XGL A;  1JZO A;  3SED A;  1W6C A;  3D4A A;  2CKF B;  1A2V A;  3PYJ A;  4OUQ A;  1IQ8 A;  3LTB A;  1K28 A;  3RGA A;  1BGS A;  4BTY A;  1JB5 A;  1HKX A;  4QWT A;  3SVA A;  2CX0 A;  5ELU A;  5JPP A;  4LMI A;  1BOX A;  1WNH A;  2ZA4 A;  2LQV A;  2YFI B;  3JUQ A;  1UI8 A;  1UGH I;  1JJ2 2;  2Z76 A;  1QVF 2;  3BNE A;  1JBR A;  3LTC A;  2RCD A;  2L4V A;  3EF8 A;  1EUI C;  1SPU A;  1E3V A;  5AII A;  1RMS A;  1W5Z A;  2MF7 A;  5AEU B;  5IEO A;  1L5G B;  3V98 A;  1Y4K A;  1BNI A;  5I97 A;  1B2U A;  1GOV A;  4MEI A;  3FH1 A;  5AIG A;  1OHO A;  3SX1 A;  1QMA A;  1LNH A;  3LT8 A;  2WGO A;  4O3V A;  3B4P A;  3JUO A;  3WHO A;  1D6Z A;  1GMP A;  1MWS A;  1TP6 A;  3URP A;  3S5C A;  2F5M A;  3JUN A;  3K63 A;  3D5G A;  4O02 B;  2RBI A;  1A2P A;  3V99 A;  1IDP A;  1GY5 A;  2IMJ A;  1MNL A;  3GZX B;  2Y73 A;  4N6L A;  5AYS C;  1I3I A;  4HM8 B;  4NPB A;  3OV4 A;  1I3F A;  3LT9 A;  2WOF A;  4HM0 B;  5RNT A;  1C54 A;  1YVB I;  3CPW 2;  2CG1 A;  5IF6 A;  8CHO A;  2PNC A;  2WGQ A;  3EBY A;  3T8N A;  3J7Y d;  2BIR A;  1VZZ A;  3FZW A;  1STD A;  4IIA A;  4ILF A;  3I56 3;  3SXX A;  4WWU C;  2OCT A;  4X2H A;  1VQM 3;  2F56 A;  4HM3 B;  2D42 A;  3HK4 A;  1AVL A;  4L8P A;  3S27 A;  9RNT A;  4KT3 B;  1BSB A;  1MWR A;  4R80 A;  1JBS A;  1BRS A;  2XGN A;  2K0M A;  1NDO B;  4LSO A;  2UX0 A;  2Y74 A;  4HBR A;  1YI2 3;  1VQP 3;  1GD4 A;  2CIU A;  1LVN A;  2AAE A;  2CFD A;  1VQ6 3;  2CC3 A;  2HMO B;  5CK6 A;  3T0U A;  3AHW A;  2P38 A;  2W04 A;  2XSO B;  4U13 A;  2C10 A;  1OH0 A;  4HOH A;  3ZFZ A;  1J2B A;  1O7G B;  5IG0 A;  2OQE A;  1O7P B;  3F9S A;  3NV0 A;  4EW5 A;  4WYK B;  2GXF A;  2CW9 A;  4XBX A;  1TRQ A;  3X41 A;  4XBT A;  3QK9 A;  2CFG A;  5D81 A;  1U8C B;  1DE3 A;  2OQE C;  1JN5 B;  1OCV A;  2C11 A;  2KAA A;  1SAR A;  1IK3 A;  1JB4 A;  1N9J A;  2F86 B;  1BAO A;  1W7C A;  3ALA A;  3LH4 A;  1ROV A;  2W56 A;  1BIR A;  4RNZ A;  2CH9 A;  4AEQ A;  3AHS A;  1LRA A;  2SAR A;  1EG9 B;  2O3O A;  1GMR A;  2JDI H;  5EVH A;  2QA4 3;  1FZU A;  3G16 A;  3KII A;  4R4K A;  1ROA A;  3DGY A;  2WO0 A;  3HIG A;  3ZG5 A;  1JB2 A;  1BNG A;  4XDW A;  1PYL A;  5FGO A;  4EV5 A;  1VQQ A;  1DMM A;  3OX9 A;  4HM1 B;  1Q9E A;  1W01 A;  4K1U A;  2YFJ B;  1Q40 A;  2CWU A;  3NM2 A;  4EV2 A;  3NBB A;  3Q90 A;  1RGE A;  1NU3 A;  3FKA A;  3LML A;  3IJE B;  1N5P A;  1EQK A;  5FW5 A;  4K61 A;  1WMN A;  3N9H A;  4R1K A;  3KN4 A;  1IV7 A;  2KF4 A;  3HZP A;  1ZS7 A;  4DKI A;  1RKY A;  1N8Q A;  7GSP A;  1GOY A;  1FUW A;  4OK0 A;  3EN1 B;  1S5A A;  4XB5 A;  3UNL A;  2XRX B;  1RN1 A;  3DH2 A;  3GRD A;  1O7H B;  3K9M C;  4BL3 A;  1B20 A;  1T2H A;  5M19 A;  2E2U A;  2BMR B;  3CCL 3;  3PXM A;  2IUK A;  2FGT A;  3JVC A;  4J9A A;  2Z77 A;  3AGO A;  4XDV A;  1G02 A;  3NUV A;  1RN7 A;  1I2F A;  4HAA A;  3DZL A;  4STD A;  1BRG A;  3LZA A;  5G2G A;  1BNF A;  3D79 A;  3ZG0 A;  3G4S 3;  1C7H A;  1SJW A;  4AKZ A;  1Q86 4;  1DVD A;  5KP3 A;  2XFS A;  1UCI A;  1N8R 4;  1LQM B; 
#chains in the Genus database with same CATH homology
 3SOA A;  4HM6 B;  4EBG A;  3KSP A;  4TX4 A;  2STD A;  1TFO A;  3LTD A;  4HZB B;  1UUW B;  1WTH A;  1V74 A;  3VF1 A;  1CYV A;  1FGO A;  2BMQ B;  3FF2 A;  3GZY B;  1VQ7 3;  2GU1 A;  3DY5 A;  3WA3 A;  2OWP A;  3ROB A;  1GYB A;  1FGT A;  2BO9 B;  4HM4 B;  3X3X A;  1CEW I;  5JBS A;  1TU5 A;  3X40 A;  1CYU A;  1Q7Y 4;  1VQO 3;  2GEY A;  1A2K A;  3CNM A;  2B1X B;  1NWW A;  3OW2 2;  1A67 A;  3DM8 A;  3V92 A;  3KSE D;  1UI7 A;  3FG3 A;  3B8L A;  3NXJ A;  3X3Y A;  3LOY A;  1IQX A;  2W6J H;  3MWZ A;  4HM7 B;  5D82 A;  1WMP A;  2Z6B A;  1DMQ A;  1Q82 4;  3S29 A;  1US1 A;  2RSX A;  3DUK A;  1F8N A;  5IEP A;  1JKG A;  3DMC A;  1OHP A;  1N9E A;  3FGY A;  1MOL A;  3H3H A;  3WA2 X;  4HZ9 B;  1SQW A;  3DGN A;  4EYC A;  3DGO A;  1YJ9 3;  1ISK A;  3DGM A;  4O2H A;  3TDG A;  1WQL B;  2XSH B;  1QVG 2;  4XBY A;  1VQ8 3;  3AMO B;  4ORL A;  3L0R A;  4R9K A;  1KWI A;  4LZI A;  1FGM A;  1JV2 B;  2ZL8 A;  3FCS B;  3T8U A;  2INX A;  5BVB A;  2B24 B;  4HKV B;  1W2B 2;  1QAL A;  2P0X A;  3X3Z A;  1PU4 A;  3RDE A;  2XF3 A;  2P05 A;  1Q81 4;  1WMO A;  3GZB A;  4GL6 A;  3A76 A;  2XR8 B;  4L8O A;  2FXT A;  3CC2 3;  1IQY A;  3IMA B;  4ZM8 A;  3ER7 A;  1K41 A;  3K5T A;  1M90 4;  3G8Z A;  1GD3 A;  3EB8 A;  5KP4 A;  2I9W A;  1D6U A;  1S72 3;  3CPO A;  1GY6 A;  4NHF A;  3MSO A;  1IV9 A;  2XFT A;  5LC7 A;  1OGZ A;  5D83 A;  3ECF A;  1OHS A;  5AYR B;  1NJI 4;  2CFK A;  2MC8 A;  2FNQ A;  1PFP A;  1KQS 2;  3U97 A;  3CCV 3;  1W02 A;  2BT3 A;  1O7N B;  3MG3 A;  1RRL A;  1NB5 I;  2RGQ A;  4O8S A;  1YIJ 3;  4FCM A;  3EQQ B;  1HU9 A;  4WYK A;  3EN8 A;  2HMN B;  4KFF A;  3OWU A;  5ELJ A;  3MG1 A;  1K8A 4;  3NM7 A;  4N6V 0;  4Q53 A;  4JRF A;  1RJO A;  2F98 A;  2Q07 A;  1YIT 3;  1OF5 A;  4LGQ A;  3FG4 A;  1K73 4;  4MMY B;  2HMJ B;  5AIH A;  3MKI A;  1GS3 A;  3F40 A;  1DMN A;  3G0K A;  1VQL 3;  1ASK A;  4WP5 A;  4H61 A;  2CK3 H;  4MMX B;  1LOX A;  3H51 A;  4K90 B;  1K9M 4;  5IER A;  3UJM A;  1AVK A;  2YX9 A;  3PS8 A;  3S67 A;  4N6N B;  5AEW B;  3CC4 3;  2W9P A;  3DXO A;  2P09 A;  4LEH A;  2QGU A;  1AV4 A;  1IVW A;  3JUP A;  1RRH A;  1EA2 A;  3MG2 A;  5BXQ A;  2CG0 A;  3SOY A;  3CCR 3;  3I0Y A;  1ZO2 A;  1O7W B;  4JF8 A;  1W6G A;  5EEO A;  2W2C A;  1G96 A;  4IPB A;  1NO3 A;  3G6E 3;  2HML B;  1UUV B;  2R4I A;  2V1L A;  3M8C A;  3PCR A;  3CCJ 3;  4HYZ A;  1IVU A;  3RGR A;  1A90 A;  1Q42 A;  4WHA A;  3I55 3;  3HI7 A;  3STD A;  3KZT A;  1FGR A;  1E3R A;  3O8Y A;  2IUJ A;  1TIJ A;  4PEJ A;  1VQN 3;  3F7S A;  5LC6 A;  2M7O A;  4RBN A;  1YHQ 3;  1QJG A;  2Z7A A;  2W0Q A;  3X42 A;  3OWS A;  1W6Y A;  2WOH A;  3NX0 A;  3VSY A;  3KKG A;  4N3V A;  3EX9 A;  3CCU 3;  4KFD A;  4KVH A;  2A15 A;  2ZDJ A;  1KSI A;  1FA3 A;  3D3L A;  3JUM A;  3MHE A;  1TFK A;  2HMM B;  1JKG B;  4OVM A;  1ULI B;  2LYX A;  2W9Q A;  4HM2 B;  4HM5 B;  4EXR A;  2D1W A;  3KFQ C;  2F99 A;  3PCS A;  3S28 A;  1LXE A;  4FMA A;  1M1X B;  2GBW B;  2KCD A;  3GWR A;  1VQ4 3;  5IG5 A;  3CMA 3;  3UL5 A;  2HMK B;  2IA7 A;  3NQY A;  3QRD A;  3VGN A;  5CF2 A;  3CXC 2;  1OAC A;  2XEP A;  4MMZ B;  1IVX A;  4BTW A;  1IU7 A;  2JQ5 A;  4FMD A;  4WFO A;  5AIF A;  4HJL B;  3F14 A;  4H3U A;  1JNQ A;  3UL6 A;  2CWT A;  3CNX A;  3Q2P A;  4FMB A;  1ZX2 A;  2PZV A;  1R4C A;  5A0O B;  3FG1 A;  1N5H A;  2CFL A;  3CCM 3;  3CD6 3;  5DRV A;  1GY7 A;  3NHX A;  3NV0 B;  3BB9 A;  1UW1 A;  2KRT A;  3NQZ A;  1E97 A;  3IPT A;  1OGX A;  1U5O A;  2GU3 A;  1IT8 A;  2OTJ 3;  5CXO A;  3NBR A;  3F8H A;  2QIY A;  4RZM A;  4BTX A;  1YJN 3;  1IT7 A;  3EC9 A;  3GZR A;  3PGB A;  3CCE 3;  2ML5 A;  3AMO A;  3EBT A;  3N54 B;  7STD A;  3FSD A;  1W4N A;  2W56 B;  1SIH A;  1SII A;  3DGL A;  3LXU X;  3K0Z A;  5TGN A;  4FCZ A;  4J8T A;  3EJV A;  3Q1C A;  1VQ5 3;  1Z1S A;  2K54 A;  2P0M A;  3KE7 A;  3OXA A;  3BNB A;  4N6M A;  2O9U X;  1VQK 3;  2CWV A;  1DVC A;  3EHC A;  3BND A;  4FR9 A;  3UB1 A;  5IEN A;  3OWY A;  1Q40 B;  3N8B A;  2E2T A;  4IT7 A;  2YFL B;  6STD A;  4N6O B;  5DRE A;  3F7X A;  1ULJ B;  1OPY A;  5IG3 A;  2CHC A;  3MPH A;  1OF5 B;  2ML6 A;  1M9G A;  1QAF A;  1CQS A;  2BMO B;  3E99 A;  1W00 A;  3CME 3;  2RFR A;  1JN5 A;  4G1M B;  3NBJ A;  4K1V A;  2GBX B;  3BNC A;  4L7K A;  3SLU A;  2QEX 3;  2W03 A;  1KD1 4;  4HVN A;  2SBL A;  1QAK A;  4MJD A;  5IW9 A;  1O7M B;  2BNG A;  1KC8 4;  2OTL 3;  1D6Y A;  1T5Y A;  2BHM A;  1IVV A;  1AR0 A;  3FLJ A;  1BUQ A;  3LTA A;  3PZW A;  4I4K A;  3MYT A;  5CF1 A;  3D9R A;  5AI1 A;  4EC6 A;  3B4O A;  5STD A;  5HGR A;  1YJW 3;  1STF I;  2CFW A;  3WDG B;  4FCJ A;  4N6U A;  4KFE A;  3FF0 A;  3G71 3;  1OUN A;  1JRQ A;  1NB3 I;  5KP1 A;  4X2O A;  1YGE A;  3U1W A;  3HII A;  3CCQ 3;  1W2Z A;  1EKM A;  5CLK A;  3CCS 3;  1DYU A;  3WOF B;  4KZ1 A;  1FGQ A;  4RNY A;  2OOV A;  4N6T A;  1M1K 4;  4NRE A;  5EQL A;  4AKY A;  2E2V A;  4XM4 A;  1TUH A;  3BLZ A;  4GB5 A;  4CDL A;  3LYG A;  3WOE B;  2GEX A;  3F8X A;  3WMD A;  3CU3 A;  4CCV A;  5JPU A;  3WOD G;  2XH9 A;  4FMC A;  4R9L A;  3K7C A;  2OOV C;  3GAX A;  3EE1 A;  5IG4 A;  3HX8 A;  3B7C A;  2KXG A;  3CC7 3;  2XGL A;  3SED A;  1W6C A;  2CKF B;  1A2V A;  3PYJ A;  4OUQ A;  1IQ8 A;  3LTB A;  1K28 A;  3RGA A;  4BTY A;  1JB5 A;  1HKX A;  4QWT A;  3SVA A;  5JPP A;  5ELU A;  4LMI A;  1WNH A;  2LQV A;  2YFI B;  3JUQ A;  1UI8 A;  1JJ2 2;  2Z76 A;  1QVF 2;  3BNE A;  3LTC A;  2RCD A;  2L4V A;  3EF8 A;  1SPU A;  5AII A;  1E3V A;  5AEU B;  2MF7 A;  1W5Z A;  5IEO A;  1L5G B;  3V98 A;  1Y4K A;  5I97 A;  1DVD A;  5AIG A;  4MEI A;  3FH1 A;  3SX1 A;  1OHO A;  1VQ9 3;  1QMA A;  1LNH A;  3LT8 A;  2WGO A;  4O3V A;  3B4P A;  3JUO A;  1D6Z A;  1TP6 A;  3S5C A;  3JUN A;  3K63 A;  4O02 B;  3V99 A;  1IDP A;  1GY5 A;  2IMJ A;  1MNL A;  3GZX B;  2Y73 A;  4N6L A;  5AYS C;  4HM8 B;  3OV4 A;  3LT9 A;  2WOF A;  4HM0 B;  1YVB I;  3CPW 2;  2CG1 A;  5IF6 A;  8CHO A;  2PNC A;  2WGQ A;  3EBY A;  3T8N A;  3J7Y d;  1VZZ A;  3FZW A;  1STD A;  4IIA A;  3I56 3;  3SXX A;  4WWU C;  2OCT A;  4X2H A;  1VQM 3;  4HM3 B;  2D42 A;  3HK4 A;  1AVL A;  4L8P A;  3S27 A;  4R80 A;  2XGN A;  2K0M A;  1NDO B;  4LSO A;  2UX0 A;  2Y74 A;  4HBR A;  1YI2 3;  1VQP 3;  1GD4 A;  2CIU A;  1LVN A;  2CFD A;  1VQ6 3;  2CC3 A;  2HMO B;  5CK6 A;  3T0U A;  2P38 A;  2W04 A;  2XSO B;  4U13 A;  2C10 A;  1OH0 A;  1J2B A;  1O7G B;  5IG0 A;  2OQE A;  1O7P B;  3F9S A;  3NV0 A;  4WYK B;  2GXF A;  2CW9 A;  4XBX A;  3X41 A;  4XBT A;  3QK9 A;  2CFG A;  5D81 A;  1U8C B;  2OQE C;  1JN5 B;  1OCV A;  2C11 A;  1IK3 A;  1JB4 A;  1N9J A;  2F86 B;  1W7C A;  3ALA A;  3LH4 A;  1ROV A;  2W56 A;  4RNZ A;  2CH9 A;  4AEQ A;  1EG9 B;  2O3O A;  2JDI H;  5EVH A;  2QA4 3;  3G16 A;  3KII A;  4R4K A;  1ROA A;  1N8R 4;  2WO0 A;  3HIG A;  4EV5 A;  1JB2 A;  4XDW A;  5FGO A;  1DMM A;  3OX9 A;  4HM1 B;  4K1U A;  1W01 A;  2YFJ B;  1Q40 A;  2CWU A;  3NM2 A;  4EV2 A;  3NBB A;  3Q90 A;  3FKA A;  1NU3 A;  3LML A;  3IJE B;  1N5P A;  1EQK A;  5FW5 A;  4K61 A;  1WMN A;  3N9H A;  4R1K A;  3KN4 A;  1IV7 A;  3HZP A;  1RKY A;  1N8Q A;  1FUW A;  4OK0 A;  3EN1 B;  1S5A A;  4XB5 A;  3UNL A;  2XRX B;  3GRD A;  1O7H B;  3K9M C;  2E2U A;  2BMR B;  3CCL 3;  3PXM A;  2IUK A;  2FGT A;  3JVC A;  4J9A A;  2Z77 A;  4XDV A;  3NUV A;  1RN7 A;  4STD A;  3DZL A;  3LZA A;  5G2G A;  3G4S 3;  1C7H A;  1SJW A;  4AKZ A;  1Q86 4;  5KP3 A;  2XFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...