1PYLA

Crystal structure of ribonuclease sa2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
DPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ribonuclease
publication title Crystal structure reveals two alternative conformations in the active site of ribonuclease Sa2.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1pylA00
1A2PA 2GSPA 1DETA 1RGAA 1BSAA 3D5GA 3GSPA 3SYUA 7RNTA 1BNEA 1RN1A 1X1YA 1HYFA 1RGCA 4HAAA 1B20A 2BIRA 1B2UA 1RMSA 2KF6A 1GMRA 2F5WA 1X1UA 1IYYA 1BRGA 1C54A 1BOXA 1TRPA 1CH0A 1I70A 2HOHA 1BNIA 1BSCA 1I3FA 3Q3FA 2AAEA 1RTUA 3AGOA 1I2EA 8RNTA 1B27A 1GOYA 4BU4A 1I0XA 4RNTA 1LRAA 1RGKA 1RSNA 1ZGXA 1BNRA 1PYLA 2BU4A 1AQZA 4BIRA 5GSPA 1Q9EA 3A5EA 2KF5A 7GSPA 1MGWA 4J5KA 1BNSA 1BRKA 2C4BA 2RNTA 1I3IA 1DE3A 1B21A 4J5GA 2RBIA 1BRHA 1FW7A 1GMQA 1FYSA 9RNTA 1RDSA 1PY3A 2SARA 5HOHA 1B2XA 1RLSA 1UCIA 4GSPA 5BU4A 3BIRA 3HOHA 1T2HA 1T2IA 3WHOA 1LNIA 1JBTA 1LOVA 1X1XA 3WR2A 1BNJA 1YNVX 2ZA4A 1JBRA 5BIRA 1JBSA 1FUTA 3AHSA 1TRQA 1I2GA 1BRJA 3BU4A 1BSBA 1RN4A 4HOHA 2F56A 3RNTA 1AY7A 1BNGA 1TTOA 2AADA 3AGNA 3DGYA 1I0VA 2KF3A 1UCKA 1RGEA 1G02A 1GOUA 1MGRA 1BRNL 1GSPA 3AHWA 1BU4A 1FUSA 3KCHA 1RGHA 1SARA 1BRIA 2KAAA 1BSEA 3DH2A 4GHOA 1BAOA 5RNTA 1X1WA 1RNTA 1UCLA 1B2ZA 3D5IA 1RNBA 1BIRA 1BUJA 1UCJA 3URPA 2KF4A 1GMPA 1FZUA 1RCKA 1RGGA 1B2SA 3D4AA 1R4YA 1YGWA 2F4YA 1RGLA 1LOWA 1BGSA 1I8VA 1B2MA 1BANA 1YVSA 1RCLA 6GSPA 1BVIA 1HZ1A 1RGFA 2F5MA 1BSDA 1BRSA 1I2FA 6RNTA 1LOYA 1B3SA 1GOVA 1BNFA 1RHLA
chains in the Genus database with same CATH superfamily
1C7HA 1N5HA 4FCMA 3BB9A 1Q40B 1GY7A 1RRHA 2BNGA 2OWPA 2QEX3 1ZO2A 2XF3A 1HYFA 1QAFA 1UI8A 3NV0B 4HAAA 3RGRA 3DGLA 4CJNA 3JVCA 3X3ZA 4NHFA 1VQL3 2MF7A 1A67A 1STDA 3F7XA 5EEOA 1CEWI 3LXUX 4AEQA 1OPYA 3RDEA 1VZZA 1VQ53 1I70A 3JUPA 3G713 2V1LA 3PCSA 3EN1B 1RTUA 1DMQA 5G1LA 1K734 3SXXA 1GOYA 3LTAA 4RNTA 5A0OB 1BUQA 5I97A 2RFRA 1IU7A 4OVMA 3LT9A 4L8OA 5D82A 4BIRA 1BNRA 2LYXA 1KWIA 4TX4A 3MSOA 1O7HB 4X2HA 4WHAA 2KF5A 1WMNA 2Z6BA 1MNLA 1LXEA 4HZBB 2L4VA 2C10A 1BNSA 2FGTA 5AIFA 3M8CA 1E97A 2W6JH 2RNTA 3CPOA 1J2BA 2M7OA 1I3IA 2RGQA 1OH0A 2RBIA 1N9JA 5FW5A 3LTBA 3FG1A 3HK4A 3CCV3 5AEWB 9RNTA 2INXA 3B7CA 2CG1A 3CC23 2HMOB 1OGZA 3LH4A 3LMLA 3ZFZA 4GSPA 3VF1A 2YFLB 2F86B 1U5OA 4IIAA 2YX9A 2F99A 2R41A 2SBLA 5EQLA 3BIRA 1MWSA 3HOHA 3WHOA 5JBSA 3IMAB 1QAKA 3UB1A 1NB3I 1LOVA 4I4KA 4LMIA 1M1K4 1EA2A 1YNVX 5D83A 2O3OA 4MJDA 4XDWA 1VQM3 1JBRA 3NQYA 3BNCA 3CNMA 3EQQB 1D6UA 1FUTA 1TRQA 3RNTA 4HOHA 2F56A 5STDA 4EBGA 3LT8A 1S5AA 3PCRA 2HMNB 3DGYA 3CMA3 1JZDA 3HI7A 3J7Yd 4HBRA 2K54A 3EE1A 3Q1CA 1MWTA 4H3UA 3CCQ3 3SOAA 1HKXA 1SARA 7STDA 3WOFB 3UJMA 1SPUA 1EUIC 3DH2A 2KRTA 3F7SA 4G1MB 1X1WA 3F8XA 2CWTA 3ECFA 1FUWA 1BIRA 2D1WA 3V99A 5FGOA 1GMPA 3CCE3 1YGWA 1B2MA 2F4YA 3PS8A 1HU9A 1BGSA 1LOWA 3FCSB 1MOLA 3KFQC 4MMYB 1KD14 5CF1A 1HZ1A 2BMRB 1RGFA 4R9LA 3FG3A 1JJ22 2BMOB 3GAXA 5AIGA 1YHQ3 1W01A 3U1WA 1W00A 5DRVA 3OWSA 4N6TA 2F98A 5ELJA 5IERA 1I2FA 1JKGA 6RNTA 1TUHA 3FF2A 1A90A 2CFWA 2GSPA 1DETA 4FMAA 1BSAA 1Q42A 4WP5A 1E3VA 1JN5A 2W03A 1BNEA 1TFKA 1RGCA 3SVAA 1N8QA 1VQO3 2CX0A 1LQMB 4BL3A 2FXTA 1UW1A 3FLJA 4CPKA 3NBJA 3GZXB 5M19A 1BRGA 2XEPA 2YFIB 1K8A4 1N9EA 2CFGA 4XM4A 1UGIA 1FA3A 1V57A 2HOHA 5AEUB 1BNIA 1BSCA 1I3FA 5LC7A 4PEJA 1VQ63 2BHMA 1IT8A 1JKGB 3SX1A 2CIUA 1YI23 1LQGC 3AGOA 4NREA 4BU4A 3MG2A 4MMZB 1LRAA 4U13A 2OOVC 1JN5B 1WMPA 1ZGXA 3OWYA 3K5TA 3FKAA 1DMMA 3G0KA 5KP4A 1QJGA 1VQ93 4L8PA 5CLKA 3NM2A 1QALA 3CCS3 3F14A 1G96A 3B8LA 1UUVB 4JRFA 3N9HA 3HIIA 1EQKA 1IVVA 1VQ83 2IUJA 4OK0A 3CCL3 5G1KA 2JQ5A 3DGOA 4ZM8A 2QGUA 2W04A 2Y73A 1YIT3 2P09A 2QIYA 1B21A 4J5GA 4KT3B 1FW7A 1GMQA 3MYTA 3CC43 2SARA 1B2XA 4WFOA 1NU3A 3EX9A 5JPPA 1M904 2UGIA 3DY5A 5CK6A 2E2VA 1DMNA 3CCR3 1T2HA 1T2IA 3ZG5A 3BNBA 3H51A 3V98A 2XRXB 3WDGB 1LNIA 3CME3 1SIIA 3WR2A 4HVNA 4HM8B 3JUMA 1JV2B 1GYBA 1JNQA 1NJI4 1KSIA 1OCVA 2CG0A 3TDGA 1Z1SA 1YJW3 4FMDA 1I2GA 1BRJA 1BSBA 1IV7A 2WOHA 3CPW2 1Q814 1RN7A 2K0MA 4RZMA 1VQQA 4XBYA 1S723 3MG3A 1GD3A 2HMJB 1SJWA 1EG9B 2Y74A 2WGOA 1MWRA 4XBTA 4OUQA 3VSYA 1W2ZA 4BTYA 2KF3A 1IDPA 3CC73 1UCKA 1QMAA 1MWUA 1G02A 1IV9A 2FNQA 2GU1A 1GSPA 3STDA 3QRDA 3BNDA 3D9RA 4EW5A 4ORLA 3KCHA 1F8NA 2RCDA 2XH9A 2KXGA 3KE7A 1SIHA 2KAAA 1ULJB 3WODG 5KP1A 3G4S3 3EF8A 2UUGC 1RNTA 1UCLA 1B2ZA 2IYJA 2Z7AA 3NUVA 4HM2B 8CHOA 3X3YA 1RNBA 5LC6A 1BUJA 1NO3A 3JUQA 1UCJA 3KIIA 1K41A 1SQWA 3EB8A 1RGGA 3DMCA 3HX8A 1B2SA 3IPTA 1ULIB 4ILFA 4K1UA 1RGLA 2JDIH 2XFTA 5IG0A 3A76A 3GZBA 3PZWA 3DXOA 2HMLB 1KC84 1JB4A 4N6MA 2ZL8A 2WGQA 1BSDA 3ZG0A 1WTHA 1OGXA 1DYUA 1PFPA 1BRSA 3UNLA 3DGMA 2KCDA 3G16A 3ALAA 3MPHA 3Q2PA 4N6NB 5D81A 4R80A 4R1KA 3MG1A 5IEPA 1JZOA 1RGAA 2OTL3 4MEIA 2OTJ3 1FGRA 2PNCA 3FSDA 4HM5B 3ROBA 2GEXA 3I553 3SLUA 1UUGB 3G6E3 4HYZA 1IQXA 4O02B 1D6YA 1RMSA 1U8CB 5M1AA 1CYUA 2CFKA 3PXMA 4LEHA 2IMJA 1O7NB 3F40A 1GMRA 2F5WA 1X1UA 5TGNA 5AYSC 3CXC2 1VQ43 3EJVA 3OXAA 5AIIA 4AKYA 2H0HA 4BTXA 1CH0A 1ASKA 2XR8B 4I5QA 2LQVA 4N6UA 4N6V0 3CCM3 2WO0A 3GWRA 1Q7Y4 1CQSA 1OUNA 5JPUA 1OACA 3X3XA 2A15A 1AVKA 1W6YA 5IEOA 3NBBA 1I2EA 2Z76A 8RNTA 1B27A 1I0XA 1RSNA 2ML5A 3NM7A 4HKVB 5AYRB 1GY6A 3L0RA 1T5YA 4HZ9B 4K1VA 1YIJ3 5IW9A 1Q864 1AQZA 2XFSA 1LOXA 1KQS2 3NX0A 2P38A 2Z77A 1NB5I 1Q9EA 3NBRA 4FR9A 1RJOA 2HMKB 3KSPA 5KP3A 4JF8A 1JB2A 1EEJA 1V74A 5AI1A 7GSPA 2OQEC 1A2VA 1MGWA 4XB5A 1YJ93 2CKFB 4DKIA 1NDOB 4HM6B 3K9MC 2CWVA 4O2HA 1BRKA 1O7GB 2CC3A 2OCTA 3U97A 2BT3A 3HZPA 3ER7A 4FMCA 4EC6A 3FG4A 3FF0A 1YJN3 4XDVA 1BRHA 1RRLA 5CXOA 3LTDA 1T3BA 1RKYA 1K28A 1O7MB 1UUWB 5HOHA 4X2OA 1D6ZA 4EYCA 2XSHB 5DREA 5BU4A 3JUOA 1W2B2 1GD4A 1W02A 1Y4KA 2CX1A 1BRNL 2GBWB 3K63A 4LSOA 3AMOA 5BVBA 4HM1B 1Q824 1IVWA 1ROVA 4KFEA 3X40A 1M9GA 2BMQB 3RGAA 4K90B 3S29A 3CCU3 3I0YA 3OX9A 4RNZA 1JRQA 4EV5A 1OHOA 5BIRA 5M18A 2GBXB 3AHSA 4KZ1A 2ML6A 3CD63 1A2KA 3OV4A 1AY7A 2IY2A 1BNGA 3X41A 3BLZA 1UI7A 2CFDA 4Q53A 3T8NA 3LTCA 1TTOA 2AADA 3LYGA 1N8R4 1E3RA 3AGNA 4HM4B 3UL5A 5CF2A 4J8TA 2RSXA 5EVHA 3O8YA 1MGRA 3S67A 1Q7HA 2YFJB 2GXFA 3AMOB 2IUKA 4RNYA 1FGOA 1NNVA 3IJEB 1FUSA 4HJLB 1OHSA 1RGHA 5IG4A 2OOVA 1BRIA 1G0TA 1O7WB 1STFI 3B4OA 1BSEA 1GS3A 4GHOA 3WA2X 2J8XB 3NXJA 1UDII 4HM3B 2W9QA 2XGNA 4FCZA 1US1A 4KFDA 2KF4A 1FGQA 1FZUA 2WOFA 4N6OB 2Q07A 1FGMA 2P05A 1I8VA 1OHPA 1QVF2 2UX0A 6GSPA 1RCLA 2XGLA 1BVIA 2BO9B 3CU3A 2MC8A 3N54B 2F5MA 2W56A 3VGNA 1YGEA 2C11A 3H3HA 3F9SA 3K7CA 2CFLA 4N3VA 4CCVA 1GY5A 2O9UX 1LOYA 3S27A 1B3SA 1GOVA 3E99A 1ZS7A 1A2PA 1DVCA 3D5GA 3GSPA 1ZX2A 3SEDA 3SYUA 7RNTA 2GU3A 1TU5A 1RN1A 1X1YA 5G2GA 3DZLA 3FZWA 1B20A 2BIRA 1B2UA 1IQ8A 2KF6A 3SOYA 1W6CA 4J9AA 5ELUA 1IYYA 1C54A 3KZTA 1BOXA 1WMOA 1TRPA 2I9WA 3WA3A 1EKMA 2W56B 6STDA 3DM8A 3Q3FA 2AAEA 3B4PA 4RBNA 1ROAA 3Q90A 3BNEA 3X42A 1BNFA 1AV4A 3FGYA 3WOEB 4K61A 3MWZA 4IT7A 1LVNA 1RGKA 1N5PA 3HIGA 1UGHI 4CDLA 1TFOA 2W2CA 3T0UA 1PYLA 2BU4A 2IA7A 1V58A 4XBXA 3EC9A 2W9PA 3NQZA 2STDA 5GSPA 3UL6A 4EV2A 2B24B 1DVDA 2CH9A 2CW9A 3EBTA 2PZVA 3QK9A 4BL2A 3A5EA 4R9KA 1L5GB 1CYVA 2K3DA 4J5KA 4O3VA 2E2UA 3V92A 5IF6A 2ZHXB 3JUNA 2C4BA 3K0ZA 3PYJA 1VQN3 3T8UA 3N8BA 2P0XA 3KSED 1DE3A 2GEYA 1K9M4 1IT7A 3CNXA 1O7PB 3MKIA 3CCJ3 1VQK3 1FYSA 1RDSA 3DUKA 1PY3A 1RLSA 2L1SA 1UCIA 3S28A 2CK3H 2R4IA 1TP6A 2QA43 2XSOB 3PGBA 1JB5A 3FH1A 4MMXB 1JBTA 2D42A 2CHCA 1X1XA 3OWUA 4FCJA 1BNJA 2ZA4A 4LGQA 3OW22 1IK3A 1ISKA 1FGTA 1LNHA 4NPBA 4QWTA 1TJDA 4WYKA 2HMMB 1JBSA 2E2TA 3BU4A 3LZAA 4BTWA 1RN4A 1NWWA 1WNHA 4STDA 1VQP3 3EN8A 5HGRA 3EBYA 4HM0B 4AKZA 3LOYA 5IG5A 2CWUA 2P0MA 1IVUA 1W5ZA 4FMBA 4H61A 1I0VA 4IPBA 4N6LA 3I563 1IVXA 1RGEA 1YVBI 1GOUA 1W6GA 3KN4A 3MHEA 2ZDJA 2W0QA 4HM7B 1PU4A 1W7CA 3D3LA 3AHWA 4LZIA 1M1XB 3GZYB 1BU4A 1OF5A 4L7KA 2H0IA 1TIJA 1Q40A 4GB5A 1R4CA 2H0GA 3WMDA 4EXRA 5RNTA 3GZRA 1BAOA 4WYKB 3EHCA 3NV0A 5BXQA 3KKGA 3D5IA 5IENA 4KVHA 2B1XB 4O8SA 1IQYA 3URPA 5IG3A 1AVLA 1RCKA 3D4AA 1R4YA 2OQEA 3NHXA 1BANA 1YVSA 4LYLB 1WQLB 3G8ZA 3GRDA 3D79A 5AIHA 3DGNA 1QVG2 1VQ73 3F8HA 4KFFA 1W4NA 4GL6A 1AR0A 3S5CA 4R4KA 4WWUC 1OF5B 1RHLA
chains in the Genus database with same CATH topology
1A2PA 2GSPA 1DETA 1RGAA 1BSAA 3D5GA 3GSPA 3SYUA 7RNTA 1BNEA 1RN1A 1X1YA 1HYFA 1RGCA 4HAAA 1B20A 2BIRA 1B2UA 1RMSA 2KF6A 1GMRA 2F5WA 1X1UA 1IYYA 1BRGA 1C54A 1BOXA 1TRPA 1CH0A 1I70A 2HOHA 1BNIA 1BSCA 1I3FA 3Q3FA 2AAEA 1RTUA 3AGOA 1I2EA 8RNTA 1B27A 1GOYA 4BU4A 1I0XA 4RNTA 1LRAA 1RGKA 1RSNA 1ZGXA 1BNRA 1PYLA 2BU4A 1AQZA 4BIRA 5GSPA 1Q9EA 3A5EA 2KF5A 7GSPA 1MGWA 4J5KA 1BNSA 1BRKA 2C4BA 2RNTA 1I3IA 1DE3A 1B21A 4J5GA 2RBIA 1BRHA 1FW7A 1GMQA 1FYSA 9RNTA 1RDSA 1PY3A 2SARA 5HOHA 1B2XA 1RLSA 1UCIA 4GSPA 5BU4A 3BIRA 3HOHA 1T2HA 1T2IA 3WHOA 1LNIA 1JBTA 1LOVA 1X1XA 3WR2A 1BNJA 1YNVX 2ZA4A 1JBRA 5BIRA 1JBSA 1FUTA 3AHSA 1TRQA 1I2GA 1BRJA 3BU4A 1BSBA 1RN4A 4HOHA 2F56A 3RNTA 1AY7A 1BNGA 1TTOA 2AADA 3AGNA 3DGYA 1I0VA 2KF3A 1UCKA 1RGEA 1G02A 1GOUA 1MGRA 1BRNL 1GSPA 3AHWA 1BU4A 1FUSA 3KCHA 1RGHA 1SARA 1BRIA 2KAAA 1BSEA 3DH2A 4GHOA 1BAOA 5RNTA 1X1WA 1RNTA 1UCLA 1B2ZA 3D5IA 1RNBA 1BIRA 1BUJA 1UCJA 3URPA 2KF4A 1GMPA 1FZUA 1RCKA 1RGGA 1B2SA 3D4AA 1R4YA 1YGWA 2F4YA 1RGLA 1LOWA 1BGSA 1I8VA 1B2MA 1BANA 1YVSA 1RCLA 6GSPA 1BVIA 1HZ1A 1RGFA 2F5MA 1BSDA 1BRSA 1I2FA 6RNTA 1LOYA 1B3SA 1GOVA 1BNFA 1RHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2P A;  2GSP A;  1DET A;  1RGA A;  1BSA A;  3D5G A;  3GSP A;  3SYU A;  7RNT A;  1BNE A;  1RN1 A;  1X1Y A;  1HYF A;  1RGC A;  4HAA A;  1B20 A;  2BIR A;  1B2U A;  1RMS A;  2KF6 A;  1GMR A;  2F5W A;  1X1U A;  1IYY A;  1BRG A;  1C54 A;  1BOX A;  1TRP A;  1CH0 A;  1I70 A;  2HOH A;  1BNI A;  1BSC A;  1I3F A;  3Q3F A;  2AAE A;  1RTU A;  3AGO A;  1I2E A;  8RNT A;  1B27 A;  1GOY A;  4BU4 A;  1I0X A;  4RNT A;  1LRA A;  1RGK A;  1RSN A;  1ZGX A;  1BNR A;  1PYL A;  2BU4 A;  1AQZ A;  4BIR A;  5GSP A;  1Q9E A;  3A5E A;  2KF5 A;  7GSP A;  1MGW A;  4J5K A;  1BNS A;  1BRK A;  2C4B A;  2RNT A;  1I3I A;  1DE3 A;  1B21 A;  4J5G A;  2RBI A;  1BRH A;  1FW7 A;  1GMQ A;  1FYS A;  9RNT A;  1RDS A;  1PY3 A;  2SAR A;  5HOH A;  1B2X A;  1RLS A;  1UCI A;  4GSP A;  5BU4 A;  3BIR A;  3HOH A;  1T2H A;  1T2I A;  3WHO A;  1LNI A;  1JBT A;  1LOV A;  1X1X A;  3WR2 A;  1BNJ A;  1YNV X;  2ZA4 A;  1JBR A;  5BIR A;  1JBS A;  1FUT A;  3AHS A;  1TRQ A;  1I2G A;  1BRJ A;  3BU4 A;  1BSB A;  1RN4 A;  4HOH A;  2F56 A;  3RNT A;  1AY7 A;  1BNG A;  1TTO A;  2AAD A;  3AGN A;  3DGY A;  1I0V A;  2KF3 A;  1UCK A;  1RGE A;  1G02 A;  1GOU A;  1MGR A;  1BRN L;  1GSP A;  3AHW A;  1BU4 A;  1FUS A;  3KCH A;  1RGH A;  1SAR A;  1BRI A;  2KAA A;  1BSE A;  3DH2 A;  4GHO A;  1BAO A;  5RNT A;  1X1W A;  1RNT A;  1UCL A;  1B2Z A;  3D5I A;  1RNB A;  1BIR A;  1BUJ A;  1UCJ A;  3URP A;  2KF4 A;  1GMP A;  1FZU A;  1RCK A;  1RGG A;  1B2S A;  3D4A A;  1R4Y A;  1YGW A;  2F4Y A;  1RGL A;  1LOW A;  1BGS A;  1I8V A;  1B2M A;  1BAN A;  1YVS A;  1RCL A;  6GSP A;  1BVI A;  1HZ1 A;  1RGF A;  2F5M A;  1BSD A;  1BRS A;  1I2F A;  6RNT A;  1LOY A;  1B3S A;  1GOV A;  1BNF A;  1RHL A; 
#chains in the Genus database with same CATH topology
 1C7H A;  1N5H A;  4FCM A;  3BB9 A;  1Q40 B;  1GY7 A;  1RRH A;  2BNG A;  2OWP A;  2QEX 3;  1ZO2 A;  2XF3 A;  1HYF A;  1QAF A;  1UI8 A;  3NV0 B;  4HAA A;  3RGR A;  3DGL A;  4CJN A;  3JVC A;  3X3Z A;  4NHF A;  1VQL 3;  2MF7 A;  1A67 A;  1STD A;  3F7X A;  5EEO A;  1CEW I;  3LXU X;  4AEQ A;  1OPY A;  3RDE A;  1VZZ A;  1VQ5 3;  1I70 A;  3JUP A;  3G71 3;  2V1L A;  3PCS A;  3EN1 B;  1RTU A;  1DMQ A;  5G1L A;  1K73 4;  3SXX A;  1GOY A;  3LTA A;  4RNT A;  5A0O B;  1BUQ A;  5I97 A;  2RFR A;  1IU7 A;  4OVM A;  3LT9 A;  4L8O A;  5D82 A;  4BIR A;  1BNR A;  2LYX A;  1KWI A;  4TX4 A;  3MSO A;  1O7H B;  4X2H A;  4WHA A;  2KF5 A;  1WMN A;  2Z6B A;  1MNL A;  1LXE A;  4HZB B;  2L4V A;  2C10 A;  1BNS A;  2FGT A;  5AIF A;  3M8C A;  1E97 A;  2W6J H;  2RNT A;  3CPO A;  1J2B A;  2M7O A;  1I3I A;  2RGQ A;  1OH0 A;  2RBI A;  1N9J A;  5FW5 A;  3LTB A;  3FG1 A;  3HK4 A;  3CCV 3;  5AEW B;  9RNT A;  2INX A;  3B7C A;  2CG1 A;  3CC2 3;  2HMO B;  1OGZ A;  3LH4 A;  3LML A;  3ZFZ A;  4GSP A;  3VF1 A;  2YFL B;  2F86 B;  1U5O A;  4IIA A;  2YX9 A;  2F99 A;  2R41 A;  2SBL A;  5EQL A;  3BIR A;  1MWS A;  3HOH A;  3WHO A;  5JBS A;  3IMA B;  1QAK A;  3UB1 A;  1NB3 I;  1LOV A;  4I4K A;  4LMI A;  1M1K 4;  1EA2 A;  1YNV X;  5D83 A;  2O3O A;  4MJD A;  4XDW A;  1VQM 3;  1JBR A;  3NQY A;  3BNC A;  3CNM A;  3EQQ B;  1D6U A;  1FUT A;  1TRQ A;  3RNT A;  4HOH A;  2F56 A;  5STD A;  4EBG A;  3LT8 A;  1S5A A;  3PCR A;  2HMN B;  3DGY A;  3CMA 3;  1JZD A;  3HI7 A;  3J7Y d;  4HBR A;  2K54 A;  3EE1 A;  3Q1C A;  1MWT A;  4H3U A;  3CCQ 3;  3SOA A;  1HKX A;  1SAR A;  7STD A;  3WOF B;  3UJM A;  1SPU A;  1EUI C;  3DH2 A;  2KRT A;  3F7S A;  4G1M B;  1X1W A;  3F8X A;  2CWT A;  3ECF A;  1FUW A;  1BIR A;  2D1W A;  3V99 A;  5FGO A;  1GMP A;  3CCE 3;  1YGW A;  1B2M A;  2F4Y A;  3PS8 A;  1HU9 A;  1BGS A;  1LOW A;  3FCS B;  1MOL A;  3KFQ C;  4MMY B;  1KD1 4;  5CF1 A;  1HZ1 A;  2BMR B;  1RGF A;  4R9L A;  3FG3 A;  1JJ2 2;  2BMO B;  3GAX A;  5AIG A;  1YHQ 3;  1W01 A;  3U1W A;  1W00 A;  5DRV A;  3OWS A;  4N6T A;  2F98 A;  5ELJ A;  5IER A;  1I2F A;  1JKG A;  6RNT A;  1TUH A;  3FF2 A;  1A90 A;  2CFW A;  2GSP A;  1DET A;  4FMA A;  1BSA A;  1Q42 A;  4WP5 A;  1E3V A;  1JN5 A;  2W03 A;  1BNE A;  1TFK A;  1RGC A;  3SVA A;  1N8Q A;  1VQO 3;  2CX0 A;  1LQM B;  4BL3 A;  2FXT A;  1UW1 A;  3FLJ A;  4CPK A;  3NBJ A;  3GZX B;  5M19 A;  1BRG A;  2XEP A;  2YFI B;  1K8A 4;  1N9E A;  2CFG A;  4XM4 A;  1UGI A;  1FA3 A;  1V57 A;  2HOH A;  5AEU B;  1BNI A;  1BSC A;  1I3F A;  5LC7 A;  4PEJ A;  1VQ6 3;  2BHM A;  1IT8 A;  1JKG B;  3SX1 A;  2CIU A;  1YI2 3;  1LQG C;  3AGO A;  4NRE A;  4BU4 A;  3MG2 A;  4MMZ B;  1LRA A;  4U13 A;  2OOV C;  1JN5 B;  1WMP A;  1ZGX A;  3OWY A;  3K5T A;  3FKA A;  1DMM A;  3G0K A;  5KP4 A;  1QJG A;  1VQ9 3;  4L8P A;  5CLK A;  3NM2 A;  1QAL A;  3CCS 3;  3F14 A;  1G96 A;  3B8L A;  1UUV B;  4JRF A;  3N9H A;  3HII A;  1EQK A;  1IVV A;  1VQ8 3;  2IUJ A;  4OK0 A;  3CCL 3;  5G1K A;  2JQ5 A;  3DGO A;  4ZM8 A;  2QGU A;  2W04 A;  2Y73 A;  1YIT 3;  2P09 A;  2QIY A;  1B21 A;  4J5G A;  4KT3 B;  1FW7 A;  1GMQ A;  3MYT A;  3CC4 3;  2SAR A;  1B2X A;  4WFO A;  1NU3 A;  3EX9 A;  5JPP A;  1M90 4;  2UGI A;  3DY5 A;  5CK6 A;  2E2V A;  1DMN A;  3CCR 3;  1T2H A;  1T2I A;  3ZG5 A;  3BNB A;  3H51 A;  3V98 A;  2XRX B;  3WDG B;  1LNI A;  3CME 3;  1SII A;  3WR2 A;  4HVN A;  4HM8 B;  3JUM A;  1JV2 B;  1GYB A;  1JNQ A;  1NJI 4;  1KSI A;  1OCV A;  2CG0 A;  3TDG A;  1Z1S A;  1YJW 3;  4FMD A;  1I2G A;  1BRJ A;  1BSB A;  1IV7 A;  2WOH A;  3CPW 2;  1Q81 4;  1RN7 A;  2K0M A;  4RZM A;  1VQQ A;  4XBY A;  1S72 3;  3MG3 A;  1GD3 A;  2HMJ B;  1SJW A;  1EG9 B;  2Y74 A;  2WGO A;  1MWR A;  4XBT A;  4OUQ A;  3VSY A;  1W2Z A;  4BTY A;  2KF3 A;  1IDP A;  3CC7 3;  1UCK A;  1QMA A;  1MWU A;  1G02 A;  1IV9 A;  2FNQ A;  2GU1 A;  1GSP A;  3STD A;  3QRD A;  3BND A;  3D9R A;  4EW5 A;  4ORL A;  3KCH A;  1F8N A;  2RCD A;  2XH9 A;  2KXG A;  3KE7 A;  1SIH A;  2KAA A;  1ULJ B;  3WOD G;  5KP1 A;  3G4S 3;  3EF8 A;  2UUG C;  1RNT A;  1UCL A;  1B2Z A;  2IYJ A;  2Z7A A;  3NUV A;  4HM2 B;  8CHO A;  3X3Y A;  1RNB A;  5LC6 A;  1BUJ A;  1NO3 A;  3JUQ A;  1UCJ A;  3KII A;  1K41 A;  1SQW A;  3EB8 A;  1RGG A;  3DMC A;  3HX8 A;  1B2S A;  3IPT A;  1ULI B;  4ILF A;  4K1U A;  1RGL A;  2JDI H;  2XFT A;  5IG0 A;  3A76 A;  3GZB A;  3PZW A;  3DXO A;  2HML B;  1KC8 4;  1JB4 A;  4N6M A;  2ZL8 A;  2WGQ A;  1BSD A;  3ZG0 A;  1WTH A;  1OGX A;  1DYU A;  1PFP A;  1BRS A;  3UNL A;  3DGM A;  2KCD A;  3G16 A;  3ALA A;  3MPH A;  3Q2P A;  4N6N B;  5D81 A;  4R80 A;  4R1K A;  3MG1 A;  5IEP A;  1JZO A;  1RGA A;  2OTL 3;  4MEI A;  2OTJ 3;  1FGR A;  2PNC A;  3FSD A;  4HM5 B;  3ROB A;  2GEX A;  3I55 3;  3SLU A;  1UUG B;  3G6E 3;  4HYZ A;  1IQX A;  4O02 B;  1D6Y A;  1RMS A;  1U8C B;  5M1A A;  1CYU A;  2CFK A;  3PXM A;  4LEH A;  2IMJ A;  1O7N B;  3F40 A;  1GMR A;  2F5W A;  1X1U A;  5TGN A;  5AYS C;  3CXC 2;  1VQ4 3;  3EJV A;  3OXA A;  5AII A;  4AKY A;  2H0H A;  4BTX A;  1CH0 A;  1ASK A;  2XR8 B;  4I5Q A;  2LQV A;  4N6U A;  4N6V 0;  3CCM 3;  2WO0 A;  3GWR A;  1Q7Y 4;  1CQS A;  1OUN A;  5JPU A;  1OAC A;  3X3X A;  2A15 A;  1AVK A;  1W6Y A;  5IEO A;  3NBB A;  1I2E A;  2Z76 A;  8RNT A;  1B27 A;  1I0X A;  1RSN A;  2ML5 A;  3NM7 A;  4HKV B;  5AYR B;  1GY6 A;  3L0R A;  1T5Y A;  4HZ9 B;  4K1V A;  1YIJ 3;  5IW9 A;  1Q86 4;  1AQZ A;  2XFS A;  1LOX A;  1KQS 2;  3NX0 A;  2P38 A;  2Z77 A;  1NB5 I;  1Q9E A;  3NBR A;  4FR9 A;  1RJO A;  2HMK B;  3KSP A;  5KP3 A;  4JF8 A;  1JB2 A;  1EEJ A;  1V74 A;  5AI1 A;  7GSP A;  2OQE C;  1A2V A;  1MGW A;  4XB5 A;  1YJ9 3;  2CKF B;  4DKI A;  1NDO B;  4HM6 B;  3K9M C;  2CWV A;  4O2H A;  1BRK A;  1O7G B;  2CC3 A;  2OCT A;  3U97 A;  2BT3 A;  3HZP A;  3ER7 A;  4FMC A;  4EC6 A;  3FG4 A;  3FF0 A;  1YJN 3;  4XDV A;  1BRH A;  1RRL A;  5CXO A;  3LTD A;  1T3B A;  1RKY A;  1K28 A;  1O7M B;  1UUW B;  5HOH A;  4X2O A;  1D6Z A;  4EYC A;  2XSH B;  5DRE A;  5BU4 A;  3JUO A;  1W2B 2;  1GD4 A;  1W02 A;  1Y4K A;  2CX1 A;  1BRN L;  2GBW B;  3K63 A;  4LSO A;  3AMO A;  5BVB A;  4HM1 B;  1Q82 4;  1IVW A;  1ROV A;  4KFE A;  3X40 A;  1M9G A;  2BMQ B;  3RGA A;  4K90 B;  3S29 A;  3CCU 3;  3I0Y A;  3OX9 A;  4RNZ A;  1JRQ A;  4EV5 A;  1OHO A;  5BIR A;  5M18 A;  2GBX B;  3AHS A;  4KZ1 A;  2ML6 A;  3CD6 3;  1A2K A;  3OV4 A;  1AY7 A;  2IY2 A;  1BNG A;  3X41 A;  3BLZ A;  1UI7 A;  2CFD A;  4Q53 A;  3T8N A;  3LTC A;  1TTO A;  2AAD A;  3LYG A;  1N8R 4;  1E3R A;  3AGN A;  4HM4 B;  3UL5 A;  5CF2 A;  4J8T A;  2RSX A;  5EVH A;  3O8Y A;  1MGR A;  3S67 A;  1Q7H A;  2YFJ B;  2GXF A;  3AMO B;  2IUK A;  4RNY A;  1FGO A;  1NNV A;  3IJE B;  1FUS A;  4HJL B;  1OHS A;  1RGH A;  5IG4 A;  2OOV A;  1BRI A;  1G0T A;  1O7W B;  1STF I;  3B4O A;  1BSE A;  1GS3 A;  4GHO A;  3WA2 X;  2J8X B;  3NXJ A;  1UDI I;  4HM3 B;  2W9Q A;  2XGN A;  4FCZ A;  1US1 A;  4KFD A;  2KF4 A;  1FGQ A;  1FZU A;  2WOF A;  4N6O B;  2Q07 A;  1FGM A;  2P05 A;  1I8V A;  1OHP A;  1QVF 2;  2UX0 A;  6GSP A;  1RCL A;  2XGL A;  1BVI A;  2BO9 B;  3CU3 A;  2MC8 A;  3N54 B;  2F5M A;  2W56 A;  3VGN A;  1YGE A;  2C11 A;  3H3H A;  3F9S A;  3K7C A;  2CFL A;  4N3V A;  4CCV A;  1GY5 A;  2O9U X;  1LOY A;  3S27 A;  1B3S A;  1GOV A;  3E99 A;  1ZS7 A;  1A2P A;  1DVC A;  3D5G A;  3GSP A;  1ZX2 A;  3SED A;  3SYU A;  7RNT A;  2GU3 A;  1TU5 A;  1RN1 A;  1X1Y A;  5G2G A;  3DZL A;  3FZW A;  1B20 A;  2BIR A;  1B2U A;  1IQ8 A;  2KF6 A;  3SOY A;  1W6C A;  4J9A A;  5ELU A;  1IYY A;  1C54 A;  3KZT A;  1BOX A;  1WMO A;  1TRP A;  2I9W A;  3WA3 A;  1EKM A;  2W56 B;  6STD A;  3DM8 A;  3Q3F A;  2AAE A;  3B4P A;  4RBN A;  1ROA A;  3Q90 A;  3BNE A;  3X42 A;  1BNF A;  1AV4 A;  3FGY A;  3WOE B;  4K61 A;  3MWZ A;  4IT7 A;  1LVN A;  1RGK A;  1N5P A;  3HIG A;  1UGH I;  4CDL A;  1TFO A;  2W2C A;  3T0U A;  1PYL A;  2BU4 A;  2IA7 A;  1V58 A;  4XBX A;  3EC9 A;  2W9P A;  3NQZ A;  2STD A;  5GSP A;  3UL6 A;  4EV2 A;  2B24 B;  1DVD A;  2CH9 A;  2CW9 A;  3EBT A;  2PZV A;  3QK9 A;  4BL2 A;  3A5E A;  4R9K A;  1L5G B;  1CYV A;  2K3D A;  4J5K A;  4O3V A;  2E2U A;  3V92 A;  5IF6 A;  2ZHX B;  3JUN A;  2C4B A;  3K0Z A;  3PYJ A;  1VQN 3;  3T8U A;  3N8B A;  2P0X A;  3KSE D;  1DE3 A;  2GEY A;  1K9M 4;  1IT7 A;  3CNX A;  1O7P B;  3MKI A;  3CCJ 3;  1VQK 3;  1FYS A;  1RDS A;  3DUK A;  1PY3 A;  1RLS A;  2L1S A;  1UCI A;  3S28 A;  2CK3 H;  2R4I A;  1TP6 A;  2QA4 3;  2XSO B;  3PGB A;  1JB5 A;  3FH1 A;  4MMX B;  1JBT A;  2D42 A;  2CHC A;  1X1X A;  3OWU A;  4FCJ A;  1BNJ A;  2ZA4 A;  4LGQ A;  3OW2 2;  1IK3 A;  1ISK A;  1FGT A;  1LNH A;  4NPB A;  4QWT A;  1TJD A;  4WYK A;  2HMM B;  1JBS A;  2E2T A;  3BU4 A;  3LZA A;  4BTW A;  1RN4 A;  1NWW A;  1WNH A;  4STD A;  1VQP 3;  3EN8 A;  5HGR A;  3EBY A;  4HM0 B;  4AKZ A;  3LOY A;  5IG5 A;  2CWU A;  2P0M A;  1IVU A;  1W5Z A;  4FMB A;  4H61 A;  1I0V A;  4IPB A;  4N6L A;  3I56 3;  1IVX A;  1RGE A;  1YVB I;  1GOU A;  1W6G A;  3KN4 A;  3MHE A;  2ZDJ A;  2W0Q A;  4HM7 B;  1PU4 A;  1W7C A;  3D3L A;  3AHW A;  4LZI A;  1M1X B;  3GZY B;  1BU4 A;  1OF5 A;  4L7K A;  2H0I A;  1TIJ A;  1Q40 A;  4GB5 A;  1R4C A;  2H0G A;  3WMD A;  4EXR A;  5RNT A;  3GZR A;  1BAO A;  4WYK B;  3EHC A;  3NV0 A;  5BXQ A;  3KKG A;  3D5I A;  5IEN A;  4KVH A;  2B1X B;  4O8S A;  1IQY A;  3URP A;  5IG3 A;  1AVL A;  1RCK A;  3D4A A;  1R4Y A;  2OQE A;  3NHX A;  1BAN A;  1YVS A;  4LYL B;  1WQL B;  3G8Z A;  3GRD A;  3D79 A;  5AIH A;  3DGN A;  1QVG 2;  1VQ7 3;  3F8H A;  4KFF A;  1W4N A;  4GL6 A;  1AR0 A;  3S5C A;  4R4K A;  4WWU C;  1OF5 B;  1RHL A; 
#chains in the Genus database with same CATH homology
 1A2P A;  2GSP A;  1DET A;  1RGA A;  1BSA A;  3D5G A;  3GSP A;  3SYU A;  7RNT A;  1BNE A;  1RN1 A;  1X1Y A;  1HYF A;  1RGC A;  4HAA A;  1B20 A;  2BIR A;  1B2U A;  1RMS A;  2KF6 A;  1GMR A;  2F5W A;  1X1U A;  1IYY A;  1BRG A;  1C54 A;  1BOX A;  1TRP A;  1CH0 A;  1I70 A;  2HOH A;  1BNI A;  1BSC A;  1I3F A;  3Q3F A;  2AAE A;  1RTU A;  3AGO A;  1I2E A;  8RNT A;  1B27 A;  1GOY A;  4BU4 A;  1I0X A;  4RNT A;  1LRA A;  1RGK A;  1RSN A;  1ZGX A;  1BNR A;  1PYL A;  2BU4 A;  1AQZ A;  4BIR A;  5GSP A;  1Q9E A;  3A5E A;  2KF5 A;  7GSP A;  1MGW A;  4J5K A;  1BNS A;  1BRK A;  2C4B A;  2RNT A;  1I3I A;  1DE3 A;  1B21 A;  4J5G A;  2RBI A;  1BRH A;  1FW7 A;  1GMQ A;  1FYS A;  9RNT A;  1RDS A;  1PY3 A;  2SAR A;  5HOH A;  1B2X A;  1RLS A;  1UCI A;  4GSP A;  5BU4 A;  3BIR A;  3HOH A;  1T2H A;  1T2I A;  3WHO A;  1LNI A;  1JBT A;  1LOV A;  1X1X A;  3WR2 A;  1BNJ A;  1YNV X;  2ZA4 A;  1JBR A;  5BIR A;  1JBS A;  1FUT A;  3AHS A;  1TRQ A;  1I2G A;  1BRJ A;  3BU4 A;  1BSB A;  1RN4 A;  4HOH A;  2F56 A;  3RNT A;  1AY7 A;  1BNG A;  1TTO A;  2AAD A;  3AGN A;  3DGY A;  1I0V A;  2KF3 A;  1UCK A;  1RGE A;  1G02 A;  1GOU A;  1MGR A;  1BRN L;  1GSP A;  3AHW A;  1BU4 A;  1FUS A;  3KCH A;  1RGH A;  1SAR A;  1BRI A;  2KAA A;  1BSE A;  3DH2 A;  4GHO A;  1BAO A;  5RNT A;  1X1W A;  1RNT A;  1UCL A;  1B2Z A;  3D5I A;  1RNB A;  1BIR A;  1BUJ A;  1UCJ A;  3URP A;  2KF4 A;  1GMP A;  1FZU A;  1RCK A;  1RGG A;  1B2S A;  3D4A A;  1R4Y A;  1YGW A;  2F4Y A;  1RGL A;  1LOW A;  1BGS A;  1I8V A;  1B2M A;  1BAN A;  1YVS A;  1RCL A;  6GSP A;  1BVI A;  1HZ1 A;  1RGF A;  2F5M A;  1BSD A;  1BRS A;  1I2F A;  6RNT A;  1LOY A;  1B3S A;  1GOV A;  1BNF A;  1RHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...