1PYLA

Crystal structure of ribonuclease sa2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
b'DPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease
publication title Crystal structure reveals two alternative conformations in the active site of ribonuclease Sa2.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1pylA00
3HOHA 3A5EA 1LNIA 1GMPA 1JBSA 1C54A 1AQZA 1B20A 1MGRA 1LOYA 5HOHA 1UCIA 1LOWA 1RGHA 1BUJA 1BU4A 1UCLA 2RNTA 1BRHA 1DE3A 4J5KA 1BRNL 1RCKA 1X1WA 1AY7A 3URPA 5BIRA 1T2IA 8RNTA 1I3IA 1LOVA 5RNTA 1GMRA 2F56A 4RNTA 1I2GA 1RGLA 1RN4A 3AHWA 1BNIA 1CH0A 1BSAA 1I8VA 1BNRA 1TRPA 3AHSA 1MGWA 1RGAA 1RGFA 1RGKA 1I3FA 2KF3A 1RGCA 1B3SA 1RDSA 3Q3FA 1T2HA 1Q9EA 1GOYA 2BU4A 1YVSA 4GHOA 1DETA 1GOVA 2KF4A 1SARA 3D5IA 1FYSA 1R4YA 1JBRA 1B2MA 3BU4A 1BNJA 1BNGA 1I2FA 5BU4A 3GSPA 5GSPA 2SARA 2F5MA 1FZUA 1UCKA 3D4AA 1LRAA 4BIRA 2AADA 1X1UA 1FW7A 1I0VA 1G02A 1RN1A 2C4BA 2F5WA 1BSDA 1TTOA 1A2PA 2HOHA 1BNSA 3DGYA 3KCHA 1HZ1A 4J5GA 1RSNA 1YNVX 4BU4A 1BRSA 1RTUA 1BRJA 1RLSA 2KF5A 1RNBA 2KF6A 2AAEA 1BSBA 1TRQA 6GSPA 1X1YA 3BIRA 1B2SA 1BSEA 1BANA 1BRIA 3AGNA 1BNEA 3WHOA 7RNTA 1BVIA 3DH2A 1B27A 2RBIA 1B2ZA 3RNTA 1RNTA 1BOXA 1RGEA 1RHLA 1RGGA 1HYFA 4GSPA 1I2EA 1IYYA 1I70A 1ZGXA 3D5GA 1FUTA 1YGWA 6RNTA 1B2UA 1BRKA 1BRGA 1BAOA 1PY3A 2GSPA 1GMQA 2ZA4A 1B2XA 1BIRA 1UCJA 4HOHA 1GSPA 9RNTA 3SYUA 3WR2A 1JBTA 1RMSA 2KAAA 1BGSA 7GSPA 2F4YA 1BSCA 1X1XA 1GOUA 2BIRA 1FUSA 1B21A 1BNFA 1I0XA 1PYLA 1RCLA 3AGOA 4HAAA
chains in the Genus database with same CATH superfamily
4H61A 1US1A 2P0MA 5KP3A 1JB5A 3PCRA 3PZWA 2J8XB 1BUQA 1O7WB 4ZM8A 4KFDA 4AKYA 1C54A 1UI8A 3I0YA 3IMAB 1AQZA 1B20A 3CNXA 2OQEA 2IUJA 3WA2X 4EC6A 3SOYA 1MGRA 2IA7A 3LT9A 1LOWA 5ELUA 3IJEB 3X3YA 3U97A 3DGNA 2RNTA 3CCV3 3KKGA 1BRNL 4KT3B 1RCKA 4LMIA 1Q824 3T8NA 1RJOA 5TGNA 3CME3 1DMNA 3RGRA 2WOHA 1M9GA 3Q1CA 2FXTA 2WOFA 3ER7A 3EBYA 3VF1A 3K9MC 3CNMA 4N6OB 4EV5A 3NM7A 2CWUA 1K734 1IQ8A 2F56A 5IENA 2H0HA 3T8UA 1W7CA 2CFWA 1A2KA 1RN4A 1JV2B 4CPKA 2F86B 3DY5A 3KZTA 1YJW3 1I8VA 2C10A 3CCE3 2V1LA 4RNYA 1MGWA 5CLKA 5IERA 3CU3A 1YIT3 1I3FA 3BNDA 1WMOA 1IV7A 1RGCA 1ZO2A 1T2HA 1OGXA 1FUWA 3LTBA 2XFTA 1Q9EA 1GOYA 5BXQA 1AVLA 3AMOB 1ROAA 3ZFZA 2KF4A 5AEUB 1RKYA 1SARA 4FMBA 3CCR3 3WOEB 1FGQA 1BNGA 3OW22 3TDGA 1OUNA 2IUKA 2HMLB 5M1AA 1IV9A 4R4KA 4MMZB 1WMPA 1Y4KA 5AIGA 1W02A 3NM2A 1WMNA 5GSPA 3B8LA 2F5MA 3RDEA 4N6MA 3HK4A 5HGRA 3UNLA 4LSOA 1JKGB 4RNZA 1VQ93 4BIRA 4KZ1A 4MJDA 5AIFA 1IDPA 3JVCA 4XM4A 3F9SA 4L8OA 2HOHA 1BNSA 1NDOB 3DGYA 3KCHA 4HKVB 1BRSA 1QVF2 1BRJA 1JB4A 1ROVA 2KF6A 5IG4A 2IYJA 1N9EA 3WA3A 2JQ5A 2QA43 1YHQ3 1OCVA 1HU9A 2WGQA 1X1YA 3ECFA 1VZZA 3AGNA 1BNEA 3WHOA 1O7MB 3F8XA 4EYCA 2CG0A 1B2ZA 3MPHA 1CQSA 1R4CA 2XEPA 4NREA 1NB5I 2KXGA 1Q40B 2XR8B 2HMMB 3D3LA 4K90B 3S28A 1BOXA 4R9KA 1MOLA 1AV4A 3CCJ3 1ZGXA 2BHMA 4MMXB 1K28A 1YGWA 3ZG0A 4LZIA 3FG4A 1EKMA 1STDA 5IG0A 1T3BA 5JBSA 3MHEA 3WMDA 1PU4A 4IT7A 1PY3A 4K61A 4IIAA 3VGNA 4XBYA 1EQKA 1B2XA 1UCJA 4HOHA 4PEJA 4U13A 3WDGB 1LQGC 1N5PA 2CFLA 4LGQA 4EBGA 2R4IA 3F7SA 3NV0A 3SX1A 2F4YA 1BSCA 3AGOA 2BIRA 1OH0A 1UUWB 1EA2A 4HAAA 4HM7B 2BT3A 1OACA 4EXRA 2K54A 3A5EA 4N6TA 1NO3A 1OPYA 1G96A 2UGIA 2E2TA 1GYBA 1GMPA 2CHCA 3FH1A 4L7KA 3DZLA 3EE1A 5HOHA 1UCIA 3J7Yd 1BU4A 1VQ73 2MF7A 2YFJB 1UCLA 1DE3A 3G16A 4J5KA 1MWTA 1Q7Y4 5FW5A 3LTAA 1MWUA 5BIRA 4K1VA 4STDA 1J2BA 1T2IA 1N8QA 3EJVA 1VQQA 4N6V0 1CYVA 1W4NA 2OOVA 3DUKA 5EVHA 2CIUA 4FCMA 4OVMA 3N54B 3NBJA 2CX0A 1V57A 2W6JH 4RNTA 1GD3A 1RGLA 3AHWA 1BNIA 1Z1SA 2A15A 3FF0A 4R80A 1YVBI 1Q864 3FG1A 1M1K4 1VQM3 1IQXA 1EG9B 1RGFA 2IMJA 4EV2A 4FMCA 2W9PA 3K63A 1MWSA 3FCSB 3GAXA 2KCDA 1V58A 3S5CA 4AEQA 1C7HA 2BU4A 5A0OB 1YVSA 4O3VA 5CK6A 4EW5A 1GD4A 2HMJB 3QK9A 4GHOA 1VQN3 1DETA 3SLUA 3CCQ3 1LVNA 1JB2A 2M7OA 1FYSA 1R4YA 4HM8B 3CCL3 5AEWB 3BU4A 3OWUA 1NJI4 4X2OA 4XDWA 2WO0A 3EB8A 2RSXA 5D82A 3HI7A 5G1LA 1FGTA 1TU5A 4X2HA 2P0XA 4L8PA 3F8HA 1UI7A 1T5YA 1UUGB 1LRAA 3B4OA 2BMOB 1D6UA 1I0VA 5LC6A 2FNQA 1RN1A 2RFRA 4HM1B 5IG5A 3CD63 3N8BA 3X42A 1DVDA 1TTOA 4NHFA 1A2PA 4WFOA 3O8YA 3IPTA 1L5GB 5G1KA 4J5GA 1RRHA 4BU4A 1RTUA 2F99A 3LZAA 4LYLB 1RNBA 5IEPA 2O3OA 1LOXA 3G0KA 1M904 8CHOA 2OWPA 1YI23 3OV4A 1IVWA 3N9HA 2PZVA 1VQP3 1BSEA 1BANA 1BRIA 2GBWB 3I553 3CPW2 1BVIA 1O7NB 1U8CB 3X40A 3OXAA 1B27A 2FGTA 5M18A 2CG1A 5AYSC 1JRQA 1KD14 2ML6A 4J9AA 1RNTA 2ZL8A 2Y74A 4CJNA 4IPBA 5AI1A 4O2HA 3KN4A 3FKAA 1IYYA 3CC73 1YJ93 2CWVA 2Z7AA 5G2GA 1EEJA 1O7HB 1UW1A 3LMLA 2CK3H 1WNHA 3OWSA 1BRGA 4OUQA 5IW9A 1MWRA 2GSPA 4HM4B 1V74A 2R41A 1W00A 2CFGA 2ZA4A 4HM2B 3STDA 3SYUA 3PYJA 4QWTA 1A2VA 1JNQA 1NWWA 5CF1A 1QAFA 2D1WA 3EQQB 3NV0B 4BTYA 1X1XA 1BNFA 1D6ZA 2D42A 3HOHA 2W56A 3F14A 2WGOA 1S5AA 1JN5A 1GY5A 1JZOA 1LNIA 3FLJA 5KP1A 1JJ22 4J8TA 2YX9A 4OK0A 2XF3A 3G6E3 1SPUA 1SIIA 4DKIA 2K3DA 1LOYA 3M8CA 1W01A 3MKIA 3NX0A 1E3RA 2Q07A 4BTXA 3LTCA 4WYKA 3WODG 1DVCA 1A90A 1QAKA 1QMAA 1X1WA 3UB1A 5KP4A 2L1SA 3MSOA 4MEIA 4GB5A 1OF5A 3JUOA 1Q814 1RRLA 3NQZA 4HM5B 3SEDA 1N8R4 3F7XA 5M19A 3MYTA 5EQLA 2GXFA 1VQL3 1W6GA 5IG3A 2CFKA 1LOVA 2W04A 5RNTA 2OOVC 1GMRA 4NPBA 4BTWA 3CCU3 2CC3A 2KRTA 1OHOA 1W5ZA 3DM8A 1JKGA 3LTDA 1BNRA 1CH0A 5IF6A 1A67A 4HM3B 1TRPA 1ULJB 3S67A 1KQS2 3AHSA 5CF2A 5ELJA 1K8A4 2Z6BA 1RGAA 4O8SA 2Z77A 1RGKA 3X41A 2XGLA 1W2B2 2Z76A 3Q3FA 4O02B 2OQEC 2ML5A 3JUMA 2GU3A 2XGNA 2Y73A 3K7CA 3MWZA 1VQ53 3QRDA 1GOVA 4XBXA 5IEOA 3FSDA 3LH4A 3D5IA 1W6YA 1S723 1UGIA 1E3VA 4FMAA 3EBTA 4N6UA 4K1UA 1D6YA 1OHPA 4N3VA 4RBNA 1I2FA 4TX4A 1Q40A 1IVUA 3KIIA 4H3UA 2SARA 1YJN3 1FZUA 3MG2A 1TIJA 4MMYB 3ZG5A 2PNCA 3GZBA 3D79A 4HM6B 2AADA 4LEHA 5BVBA 3UJMA 2H0IA 4BL3A 1G02A 2C4BA 2GBXB 1BSDA 1STFI 1TFOA 2K0MA 1FGOA 3PGBA 2QIYA 3Q90A 1HZ1A 3DGLA 1RSNA 2P05A 3EHCA 2E2UA 3B7CA 3S29A 1N5HA 3BNBA 1MNLA 1BSBA 5D83A 2LYXA 2ZDJA 3GZYB 1W6CA 3OX9A 4RZMA 2CH9A 2OCTA 1B2SA 1DMQA 2XSHB 3K5TA 1LXEA 1O7GB 2E2VA 3FG3A 4I5QA 1VQO3 3DH2A 3HZPA 3X3XA 1ULIB 3NBRA 1W2ZA 1GS3A 3BNEA 3E99A 2YFLB 1Q7HA 3MG3A 4KVHA 3RNTA 1WQLB 4ILFA 4AKZA 1VQ43 1RGGA 1RHLA 3MG1A 2OTJ3 1I2EA 3DXOA 5LC7A 1I70A 3NXJA 1G0TA 1SJWA 6STDA 1IK3A 3FF2A 3D5GA 4R9LA 2UX0A 4G1MB 3VSYA 1B2UA 1BRKA 3NBBA 3LYGA 4HZ9B 3GRDA 1U5OA 3PS8A 4I4KA 1GMQA 7STDA 5DRVA 1BIRA 1IQYA 3JUPA 1GSPA 1RN7A 9RNTA 2MC8A 1OGZA 1F8NA 4HZBB 3WR2A 1RMSA 1O7PB 3EN8A 2KAAA 3OWYA 3GWRA 1BGSA 1SIHA 4WHAA 7GSPA 3UL6A 3EN1B 1K9M4 1SQWA 2CWTA 1FUSA 1B21A 1I0XA 1UDII 1PYLA 3F40A 2HMNB 3GZRA 4FCZA 1NU3A 1KSIA 1EUIC 2UUGC 2W56B 1DMMA 2RGQA 2C11A 2QGUA 1JN5B 1UUVB 4FR9A 3V98A 3SVAA 1JBSA 1FGMA 1WTHA 3L0RA 4CCVA 3DMCA 3JUNA 3WOFB 1RGHA 1BUJA 3HX8A 4HJLB 1YGEA 2CX1A 2B24B 1BRHA 1IT8A 1ZX2A 1UGHI 2W2CA 1HKXA 2XSOB 5CXOA 4WYKB 1AY7A 3URPA 1KC84 1QJGA 1N9JA 3ALAA 4FCJA 4GL6A 2XH9A 4KFFA 1OF5B 1CEWI 1IVXA 4KFEA 8RNTA 1I3IA 2W03A 3BNCA 2BMQB 4HYZA 2GU1A 3S27A 1JZDA 1OHSA 3HIIA 3I563 1IVVA 1KWIA 2XFSA 3KE7A 4R1KA 1VQ63 4XBTA 1GY7A 2GEYA 3LOYA 1M1XB 1I2GA 3FGYA 2SBLA 2HMOB 3G8ZA 1BSAA 2GEXA 1TFKA 5JPPA 4WP5A 5I97A 2JDIH 1VQ83 2KF3A 5AIIA 1B3SA 3EC9A 1RDSA 2P09A 3H51A 3NHXA 1CYUA 3EX9A 2ZHXB 2OTL3 1FGRA 2W0QA 3LT8A 3AMOA 1TJDA 1YIJ3 2BNGA 1VQK3 2HMKB 3Q2PA 3V92A 2IY2A 4XB5A 2YFIB 1JBRA 1B2MA 1AVKA 1BNJA 3DGOA 4HM0B 4BL2A 1IU7A 5DREA 5FGOA 4CDLA 5BU4A 3X3ZA 1GY6A 2CFDA 4JRFA 2BO9B 3CC23 3GSPA 1ZS7A 4WWUC 3V99A 3CCM3 1IT7A 1UCKA 3UL5A 3DGMA 3PCSA 3D4AA 5D81A 3CPOA 3G4S3 1TUHA 2I9WA 1X1UA 1NB3I 3K0ZA 1FW7A 3T0UA 2F5WA 3JUQA 1LNHA 1DYUA 5AYRB 3CMA3 4HBRA 3D9RA 1YNVX 3LXUX 3BB9A 3PXMA 4ORLA 2KF5A 5STDA 1RLSA 3B4PA 3KFQC 3A76A 4FMDA 2AAEA 4HVNA 1TRQA 5JPUA 2INXA 2CKFB 1AR0A 3G713 2LQVA 2O9UX 6GSPA 1K41A 3BIRA 3FZWA 4Q53A 3NUVA 3CCS3 7RNTA 1FA3A 1ASKA 1PFPA 2RBIA 5EEOA 3KSED 1E97A 3BLZA 2QEX3 2H0GA 3CC43 1RGEA 3CXC2 1HYFA 4GSPA 3RGAA 2W9QA 1QVG2 1Q42A 2B1XB 2F98A 2STDA 3NQYA 3ROBA 2P38A 3GZXB 1FUTA 3HIGA 6RNTA 1NNVA 1LQMB 3SOAA 4JF8A 1BAOA 4N6NB 1QALA 4XDVA 3EF8A 3KSPA 2BMRB 3SXXA 2CW9A 1JBTA 3H3HA 2RCDA 2L4VA 1GOUA 2XRXB 1RCLA 5AIHA 3U1WA 1TP6A 4N6LA 1ISKA
chains in the Genus database with same CATH topology
3HOHA 3A5EA 1LNIA 1GMPA 1JBSA 1C54A 1AQZA 1B20A 1MGRA 1LOYA 5HOHA 1UCIA 1LOWA 1RGHA 1BUJA 1BU4A 1UCLA 2RNTA 1BRHA 1DE3A 4J5KA 1BRNL 1RCKA 1X1WA 1AY7A 3URPA 5BIRA 1T2IA 8RNTA 1I3IA 1LOVA 5RNTA 1GMRA 2F56A 4RNTA 1I2GA 1RGLA 1RN4A 3AHWA 1BNIA 1CH0A 1BSAA 1I8VA 1BNRA 1TRPA 3AHSA 1MGWA 1RGAA 1RGFA 1RGKA 1I3FA 2KF3A 1RGCA 1B3SA 1RDSA 3Q3FA 1T2HA 1Q9EA 1GOYA 2BU4A 1YVSA 4GHOA 1DETA 1GOVA 2KF4A 1SARA 3D5IA 1FYSA 1R4YA 1JBRA 1B2MA 3BU4A 1BNJA 1BNGA 1I2FA 5BU4A 3GSPA 5GSPA 2SARA 2F5MA 1FZUA 1UCKA 3D4AA 1LRAA 4BIRA 2AADA 1X1UA 1FW7A 1I0VA 1G02A 1RN1A 2C4BA 2F5WA 1BSDA 1TTOA 1A2PA 2HOHA 1BNSA 3DGYA 3KCHA 1HZ1A 4J5GA 1RSNA 1YNVX 4BU4A 1BRSA 1RTUA 1BRJA 1RLSA 2KF5A 1RNBA 2KF6A 2AAEA 1BSBA 1TRQA 6GSPA 1X1YA 3BIRA 1B2SA 1BSEA 1BANA 1BRIA 3AGNA 1BNEA 3WHOA 7RNTA 1BVIA 3DH2A 1B27A 2RBIA 1B2ZA 3RNTA 1RNTA 1BOXA 1RGEA 1RHLA 1RGGA 1HYFA 4GSPA 1I2EA 1IYYA 1I70A 1ZGXA 3D5GA 1FUTA 1YGWA 6RNTA 1B2UA 1BRKA 1BRGA 1BAOA 1PY3A 2GSPA 1GMQA 2ZA4A 1B2XA 1BIRA 1UCJA 4HOHA 1GSPA 9RNTA 3SYUA 3WR2A 1JBTA 1RMSA 2KAAA 1BGSA 7GSPA 2F4YA 1BSCA 1X1XA 1GOUA 2BIRA 1FUSA 1B21A 1BNFA 1I0XA 1PYLA 1RCLA 3AGOA 4HAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOH A;  3A5E A;  1LNI A;  1GMP A;  1JBS A;  1C54 A;  1AQZ A;  1B20 A;  1MGR A;  1LOY A;  5HOH A;  1UCI A;  1LOW A;  1RGH A;  1BUJ A;  1BU4 A;  1UCL A;  2RNT A;  1BRH A;  1DE3 A;  4J5K A;  1BRN L;  1RCK A;  1X1W A;  1AY7 A;  3URP A;  5BIR A;  1T2I A;  8RNT A;  1I3I A;  1LOV A;  5RNT A;  1GMR A;  2F56 A;  4RNT A;  1I2G A;  1RGL A;  1RN4 A;  3AHW A;  1BNI A;  1CH0 A;  1BSA A;  1I8V A;  1BNR A;  1TRP A;  3AHS A;  1MGW A;  1RGA A;  1RGF A;  1RGK A;  1I3F A;  2KF3 A;  1RGC A;  1B3S A;  1RDS A;  3Q3F A;  1T2H A;  1Q9E A;  1GOY A;  2BU4 A;  1YVS A;  4GHO A;  1DET A;  1GOV A;  2KF4 A;  1SAR A;  3D5I A;  1FYS A;  1R4Y A;  1JBR A;  1B2M A;  3BU4 A;  1BNJ A;  1BNG A;  1I2F A;  5BU4 A;  3GSP A;  5GSP A;  2SAR A;  2F5M A;  1FZU A;  1UCK A;  3D4A A;  1LRA A;  4BIR A;  2AAD A;  1X1U A;  1FW7 A;  1I0V A;  1G02 A;  1RN1 A;  2C4B A;  2F5W A;  1BSD A;  1TTO A;  1A2P A;  2HOH A;  1BNS A;  3DGY A;  3KCH A;  1HZ1 A;  4J5G A;  1RSN A;  1YNV X;  4BU4 A;  1BRS A;  1RTU A;  1BRJ A;  1RLS A;  2KF5 A;  1RNB A;  2KF6 A;  2AAE A;  1BSB A;  1TRQ A;  6GSP A;  1X1Y A;  3BIR A;  1B2S A;  1BSE A;  1BAN A;  1BRI A;  3AGN A;  1BNE A;  3WHO A;  7RNT A;  1BVI A;  3DH2 A;  1B27 A;  2RBI A;  1B2Z A;  3RNT A;  1RNT A;  1BOX A;  1RGE A;  1RHL A;  1RGG A;  1HYF A;  4GSP A;  1I2E A;  1IYY A;  1I70 A;  1ZGX A;  3D5G A;  1FUT A;  1YGW A;  6RNT A;  1B2U A;  1BRK A;  1BRG A;  1BAO A;  1PY3 A;  2GSP A;  1GMQ A;  2ZA4 A;  1B2X A;  1BIR A;  1UCJ A;  4HOH A;  1GSP A;  9RNT A;  3SYU A;  3WR2 A;  1JBT A;  1RMS A;  2KAA A;  1BGS A;  7GSP A;  2F4Y A;  1BSC A;  1X1X A;  1GOU A;  2BIR A;  1FUS A;  1B21 A;  1BNF A;  1I0X A;  1PYL A;  1RCL A;  3AGO A;  4HAA A; 
#chains in the Genus database with same CATH topology
 4H61 A;  1US1 A;  2P0M A;  5KP3 A;  1JB5 A;  3PCR A;  3PZW A;  2J8X B;  1BUQ A;  1O7W B;  4ZM8 A;  4KFD A;  4AKY A;  1C54 A;  1UI8 A;  3I0Y A;  3IMA B;  1AQZ A;  1B20 A;  3CNX A;  2OQE A;  2IUJ A;  3WA2 X;  4EC6 A;  3SOY A;  1MGR A;  2IA7 A;  3LT9 A;  1LOW A;  5ELU A;  3IJE B;  3X3Y A;  3U97 A;  3DGN A;  2RNT A;  3CCV 3;  3KKG A;  1BRN L;  4KT3 B;  1RCK A;  4LMI A;  1Q82 4;  3T8N A;  1RJO A;  5TGN A;  3CME 3;  1DMN A;  3RGR A;  2WOH A;  1M9G A;  3Q1C A;  2FXT A;  2WOF A;  3ER7 A;  3EBY A;  3VF1 A;  3K9M C;  3CNM A;  4N6O B;  4EV5 A;  3NM7 A;  2CWU A;  1K73 4;  1IQ8 A;  2F56 A;  5IEN A;  2H0H A;  3T8U A;  1W7C A;  2CFW A;  1A2K A;  1RN4 A;  1JV2 B;  4CPK A;  2F86 B;  3DY5 A;  3KZT A;  1YJW 3;  1I8V A;  2C10 A;  3CCE 3;  2V1L A;  4RNY A;  1MGW A;  5CLK A;  5IER A;  3CU3 A;  1YIT 3;  1I3F A;  3BND A;  1WMO A;  1IV7 A;  1RGC A;  1ZO2 A;  1T2H A;  1OGX A;  1FUW A;  3LTB A;  2XFT A;  1Q9E A;  1GOY A;  5BXQ A;  1AVL A;  3AMO B;  1ROA A;  3ZFZ A;  2KF4 A;  5AEU B;  1RKY A;  1SAR A;  4FMB A;  3CCR 3;  3WOE B;  1FGQ A;  1BNG A;  3OW2 2;  3TDG A;  1OUN A;  2IUK A;  2HML B;  5M1A A;  1IV9 A;  4R4K A;  4MMZ B;  1WMP A;  1Y4K A;  5AIG A;  1W02 A;  3NM2 A;  1WMN A;  5GSP A;  3B8L A;  2F5M A;  3RDE A;  4N6M A;  3HK4 A;  5HGR A;  3UNL A;  4LSO A;  1JKG B;  4RNZ A;  1VQ9 3;  4BIR A;  4KZ1 A;  4MJD A;  5AIF A;  1IDP A;  3JVC A;  4XM4 A;  3F9S A;  4L8O A;  2HOH A;  1BNS A;  1NDO B;  3DGY A;  3KCH A;  4HKV B;  1BRS A;  1QVF 2;  1BRJ A;  1JB4 A;  1ROV A;  2KF6 A;  5IG4 A;  2IYJ A;  1N9E A;  3WA3 A;  2JQ5 A;  2QA4 3;  1YHQ 3;  1OCV A;  1HU9 A;  2WGQ A;  1X1Y A;  3ECF A;  1VZZ A;  3AGN A;  1BNE A;  3WHO A;  1O7M B;  3F8X A;  4EYC A;  2CG0 A;  1B2Z A;  3MPH A;  1CQS A;  1R4C A;  2XEP A;  4NRE A;  1NB5 I;  2KXG A;  1Q40 B;  2XR8 B;  2HMM B;  3D3L A;  4K90 B;  3S28 A;  1BOX A;  4R9K A;  1MOL A;  1AV4 A;  3CCJ 3;  1ZGX A;  2BHM A;  4MMX B;  1K28 A;  1YGW A;  3ZG0 A;  4LZI A;  3FG4 A;  1EKM A;  1STD A;  5IG0 A;  1T3B A;  5JBS A;  3MHE A;  3WMD A;  1PU4 A;  4IT7 A;  1PY3 A;  4K61 A;  4IIA A;  3VGN A;  4XBY A;  1EQK A;  1B2X A;  1UCJ A;  4HOH A;  4PEJ A;  4U13 A;  3WDG B;  1LQG C;  1N5P A;  2CFL A;  4LGQ A;  4EBG A;  2R4I A;  3F7S A;  3NV0 A;  3SX1 A;  2F4Y A;  1BSC A;  3AGO A;  2BIR A;  1OH0 A;  1UUW B;  1EA2 A;  4HAA A;  4HM7 B;  2BT3 A;  1OAC A;  4EXR A;  2K54 A;  3A5E A;  4N6T A;  1NO3 A;  1OPY A;  1G96 A;  2UGI A;  2E2T A;  1GYB A;  1GMP A;  2CHC A;  3FH1 A;  4L7K A;  3DZL A;  3EE1 A;  5HOH A;  1UCI A;  3J7Y d;  1BU4 A;  1VQ7 3;  2MF7 A;  2YFJ B;  1UCL A;  1DE3 A;  3G16 A;  4J5K A;  1MWT A;  1Q7Y 4;  5FW5 A;  3LTA A;  1MWU A;  5BIR A;  4K1V A;  4STD A;  1J2B A;  1T2I A;  1N8Q A;  3EJV A;  1VQQ A;  4N6V 0;  1CYV A;  1W4N A;  2OOV A;  3DUK A;  5EVH A;  2CIU A;  4FCM A;  4OVM A;  3N54 B;  3NBJ A;  2CX0 A;  1V57 A;  2W6J H;  4RNT A;  1GD3 A;  1RGL A;  3AHW A;  1BNI A;  1Z1S A;  2A15 A;  3FF0 A;  4R80 A;  1YVB I;  1Q86 4;  3FG1 A;  1M1K 4;  1VQM 3;  1IQX A;  1EG9 B;  1RGF A;  2IMJ A;  4EV2 A;  4FMC A;  2W9P A;  3K63 A;  1MWS A;  3FCS B;  3GAX A;  2KCD A;  1V58 A;  3S5C A;  4AEQ A;  1C7H A;  2BU4 A;  5A0O B;  1YVS A;  4O3V A;  5CK6 A;  4EW5 A;  1GD4 A;  2HMJ B;  3QK9 A;  4GHO A;  1VQN 3;  1DET A;  3SLU A;  3CCQ 3;  1LVN A;  1JB2 A;  2M7O A;  1FYS A;  1R4Y A;  4HM8 B;  3CCL 3;  5AEW B;  3BU4 A;  3OWU A;  1NJI 4;  4X2O A;  4XDW A;  2WO0 A;  3EB8 A;  2RSX A;  5D82 A;  3HI7 A;  5G1L A;  1FGT A;  1TU5 A;  4X2H A;  2P0X A;  4L8P A;  3F8H A;  1UI7 A;  1T5Y A;  1UUG B;  1LRA A;  3B4O A;  2BMO B;  1D6U A;  1I0V A;  5LC6 A;  2FNQ A;  1RN1 A;  2RFR A;  4HM1 B;  5IG5 A;  3CD6 3;  3N8B A;  3X42 A;  1DVD A;  1TTO A;  4NHF A;  1A2P A;  4WFO A;  3O8Y A;  3IPT A;  1L5G B;  5G1K A;  4J5G A;  1RRH A;  4BU4 A;  1RTU A;  2F99 A;  3LZA A;  4LYL B;  1RNB A;  5IEP A;  2O3O A;  1LOX A;  3G0K A;  1M90 4;  8CHO A;  2OWP A;  1YI2 3;  3OV4 A;  1IVW A;  3N9H A;  2PZV A;  1VQP 3;  1BSE A;  1BAN A;  1BRI A;  2GBW B;  3I55 3;  3CPW 2;  1BVI A;  1O7N B;  1U8C B;  3X40 A;  3OXA A;  1B27 A;  2FGT A;  5M18 A;  2CG1 A;  5AYS C;  1JRQ A;  1KD1 4;  2ML6 A;  4J9A A;  1RNT A;  2ZL8 A;  2Y74 A;  4CJN A;  4IPB A;  5AI1 A;  4O2H A;  3KN4 A;  3FKA A;  1IYY A;  3CC7 3;  1YJ9 3;  2CWV A;  2Z7A A;  5G2G A;  1EEJ A;  1O7H B;  1UW1 A;  3LML A;  2CK3 H;  1WNH A;  3OWS A;  1BRG A;  4OUQ A;  5IW9 A;  1MWR A;  2GSP A;  4HM4 B;  1V74 A;  2R41 A;  1W00 A;  2CFG A;  2ZA4 A;  4HM2 B;  3STD A;  3SYU A;  3PYJ A;  4QWT A;  1A2V A;  1JNQ A;  1NWW A;  5CF1 A;  1QAF A;  2D1W A;  3EQQ B;  3NV0 B;  4BTY A;  1X1X A;  1BNF A;  1D6Z A;  2D42 A;  3HOH A;  2W56 A;  3F14 A;  2WGO A;  1S5A A;  1JN5 A;  1GY5 A;  1JZO A;  1LNI A;  3FLJ A;  5KP1 A;  1JJ2 2;  4J8T A;  2YX9 A;  4OK0 A;  2XF3 A;  3G6E 3;  1SPU A;  1SII A;  4DKI A;  2K3D A;  1LOY A;  3M8C A;  1W01 A;  3MKI A;  3NX0 A;  1E3R A;  2Q07 A;  4BTX A;  3LTC A;  4WYK A;  3WOD G;  1DVC A;  1A90 A;  1QAK A;  1QMA A;  1X1W A;  3UB1 A;  5KP4 A;  2L1S A;  3MSO A;  4MEI A;  4GB5 A;  1OF5 A;  3JUO A;  1Q81 4;  1RRL A;  3NQZ A;  4HM5 B;  3SED A;  1N8R 4;  3F7X A;  5M19 A;  3MYT A;  5EQL A;  2GXF A;  1VQL 3;  1W6G A;  5IG3 A;  2CFK A;  1LOV A;  2W04 A;  5RNT A;  2OOV C;  1GMR A;  4NPB A;  4BTW A;  3CCU 3;  2CC3 A;  2KRT A;  1OHO A;  1W5Z A;  3DM8 A;  1JKG A;  3LTD A;  1BNR A;  1CH0 A;  5IF6 A;  1A67 A;  4HM3 B;  1TRP A;  1ULJ B;  3S67 A;  1KQS 2;  3AHS A;  5CF2 A;  5ELJ A;  1K8A 4;  2Z6B A;  1RGA A;  4O8S A;  2Z77 A;  1RGK A;  3X41 A;  2XGL A;  1W2B 2;  2Z76 A;  3Q3F A;  4O02 B;  2OQE C;  2ML5 A;  3JUM A;  2GU3 A;  2XGN A;  2Y73 A;  3K7C A;  3MWZ A;  1VQ5 3;  3QRD A;  1GOV A;  4XBX A;  5IEO A;  3FSD A;  3LH4 A;  3D5I A;  1W6Y A;  1S72 3;  1UGI A;  1E3V A;  4FMA A;  3EBT A;  4N6U A;  4K1U A;  1D6Y A;  1OHP A;  4N3V A;  4RBN A;  1I2F A;  4TX4 A;  1Q40 A;  1IVU A;  3KII A;  4H3U A;  2SAR A;  1YJN 3;  1FZU A;  3MG2 A;  1TIJ A;  4MMY B;  3ZG5 A;  2PNC A;  3GZB A;  3D79 A;  4HM6 B;  2AAD A;  4LEH A;  5BVB A;  3UJM A;  2H0I A;  4BL3 A;  1G02 A;  2C4B A;  2GBX B;  1BSD A;  1STF I;  1TFO A;  2K0M A;  1FGO A;  3PGB A;  2QIY A;  3Q90 A;  1HZ1 A;  3DGL A;  1RSN A;  2P05 A;  3EHC A;  2E2U A;  3B7C A;  3S29 A;  1N5H A;  3BNB A;  1MNL A;  1BSB A;  5D83 A;  2LYX A;  2ZDJ A;  3GZY B;  1W6C A;  3OX9 A;  4RZM A;  2CH9 A;  2OCT A;  1B2S A;  1DMQ A;  2XSH B;  3K5T A;  1LXE A;  1O7G B;  2E2V A;  3FG3 A;  4I5Q A;  1VQO 3;  3DH2 A;  3HZP A;  3X3X A;  1ULI B;  3NBR A;  1W2Z A;  1GS3 A;  3BNE A;  3E99 A;  2YFL B;  1Q7H A;  3MG3 A;  4KVH A;  3RNT A;  1WQL B;  4ILF A;  4AKZ A;  1VQ4 3;  1RGG A;  1RHL A;  3MG1 A;  2OTJ 3;  1I2E A;  3DXO A;  5LC7 A;  1I70 A;  3NXJ A;  1G0T A;  1SJW A;  6STD A;  1IK3 A;  3FF2 A;  3D5G A;  4R9L A;  2UX0 A;  4G1M B;  3VSY A;  1B2U A;  1BRK A;  3NBB A;  3LYG A;  4HZ9 B;  3GRD A;  1U5O A;  3PS8 A;  4I4K A;  1GMQ A;  7STD A;  5DRV A;  1BIR A;  1IQY A;  3JUP A;  1GSP A;  1RN7 A;  9RNT A;  2MC8 A;  1OGZ A;  1F8N A;  4HZB B;  3WR2 A;  1RMS A;  1O7P B;  3EN8 A;  2KAA A;  3OWY A;  3GWR A;  1BGS A;  1SIH A;  4WHA A;  7GSP A;  3UL6 A;  3EN1 B;  1K9M 4;  1SQW A;  2CWT A;  1FUS A;  1B21 A;  1I0X A;  1UDI I;  1PYL A;  3F40 A;  2HMN B;  3GZR A;  4FCZ A;  1NU3 A;  1KSI A;  1EUI C;  2UUG C;  2W56 B;  1DMM A;  2RGQ A;  2C11 A;  2QGU A;  1JN5 B;  1UUV B;  4FR9 A;  3V98 A;  3SVA A;  1JBS A;  1FGM A;  1WTH A;  3L0R A;  4CCV A;  3DMC A;  3JUN A;  3WOF B;  1RGH A;  1BUJ A;  3HX8 A;  4HJL B;  1YGE A;  2CX1 A;  2B24 B;  1BRH A;  1IT8 A;  1ZX2 A;  1UGH I;  2W2C A;  1HKX A;  2XSO B;  5CXO A;  4WYK B;  1AY7 A;  3URP A;  1KC8 4;  1QJG A;  1N9J A;  3ALA A;  4FCJ A;  4GL6 A;  2XH9 A;  4KFF A;  1OF5 B;  1CEW I;  1IVX A;  4KFE A;  8RNT A;  1I3I A;  2W03 A;  3BNC A;  2BMQ B;  4HYZ A;  2GU1 A;  3S27 A;  1JZD A;  1OHS A;  3HII A;  3I56 3;  1IVV A;  1KWI A;  2XFS A;  3KE7 A;  4R1K A;  1VQ6 3;  4XBT A;  1GY7 A;  2GEY A;  3LOY A;  1M1X B;  1I2G A;  3FGY A;  2SBL A;  2HMO B;  3G8Z A;  1BSA A;  2GEX A;  1TFK A;  5JPP A;  4WP5 A;  5I97 A;  2JDI H;  1VQ8 3;  2KF3 A;  5AII A;  1B3S A;  3EC9 A;  1RDS A;  2P09 A;  3H51 A;  3NHX A;  1CYU A;  3EX9 A;  2ZHX B;  2OTL 3;  1FGR A;  2W0Q A;  3LT8 A;  3AMO A;  1TJD A;  1YIJ 3;  2BNG A;  1VQK 3;  2HMK B;  3Q2P A;  3V92 A;  2IY2 A;  4XB5 A;  2YFI B;  1JBR A;  1B2M A;  1AVK A;  1BNJ A;  3DGO A;  4HM0 B;  4BL2 A;  1IU7 A;  5DRE A;  5FGO A;  4CDL A;  5BU4 A;  3X3Z A;  1GY6 A;  2CFD A;  4JRF A;  2BO9 B;  3CC2 3;  3GSP A;  1ZS7 A;  4WWU C;  3V99 A;  3CCM 3;  1IT7 A;  1UCK A;  3UL5 A;  3DGM A;  3PCS A;  3D4A A;  5D81 A;  3CPO A;  3G4S 3;  1TUH A;  2I9W A;  1X1U A;  1NB3 I;  3K0Z A;  1FW7 A;  3T0U A;  2F5W A;  3JUQ A;  1LNH A;  1DYU A;  5AYR B;  3CMA 3;  4HBR A;  3D9R A;  1YNV X;  3LXU X;  3BB9 A;  3PXM A;  4ORL A;  2KF5 A;  5STD A;  1RLS A;  3B4P A;  3KFQ C;  3A76 A;  4FMD A;  2AAE A;  4HVN A;  1TRQ A;  5JPU A;  2INX A;  2CKF B;  1AR0 A;  3G71 3;  2LQV A;  2O9U X;  6GSP A;  1K41 A;  3BIR A;  3FZW A;  4Q53 A;  3NUV A;  3CCS 3;  7RNT A;  1FA3 A;  1ASK A;  1PFP A;  2RBI A;  5EEO A;  3KSE D;  1E97 A;  3BLZ A;  2QEX 3;  2H0G A;  3CC4 3;  1RGE A;  3CXC 2;  1HYF A;  4GSP A;  3RGA A;  2W9Q A;  1QVG 2;  1Q42 A;  2B1X B;  2F98 A;  2STD A;  3NQY A;  3ROB A;  2P38 A;  3GZX B;  1FUT A;  3HIG A;  6RNT A;  1NNV A;  1LQM B;  3SOA A;  4JF8 A;  1BAO A;  4N6N B;  1QAL A;  4XDV A;  3EF8 A;  3KSP A;  2BMR B;  3SXX A;  2CW9 A;  1JBT A;  3H3H A;  2RCD A;  2L4V A;  1GOU A;  2XRX B;  1RCL A;  5AIH A;  3U1W A;  1TP6 A;  4N6L A;  1ISK A; 
#chains in the Genus database with same CATH homology
 3HOH A;  3A5E A;  1LNI A;  1GMP A;  1JBS A;  1C54 A;  1AQZ A;  1B20 A;  1MGR A;  1LOY A;  5HOH A;  1UCI A;  1LOW A;  1RGH A;  1BUJ A;  1BU4 A;  1UCL A;  2RNT A;  1BRH A;  1DE3 A;  4J5K A;  1BRN L;  1RCK A;  1X1W A;  1AY7 A;  3URP A;  5BIR A;  1T2I A;  8RNT A;  1I3I A;  1LOV A;  5RNT A;  1GMR A;  2F56 A;  4RNT A;  1I2G A;  1RGL A;  1RN4 A;  3AHW A;  1BNI A;  1CH0 A;  1BSA A;  1I8V A;  1BNR A;  1TRP A;  3AHS A;  1MGW A;  1RGA A;  1RGF A;  1RGK A;  1I3F A;  2KF3 A;  1RGC A;  1B3S A;  1RDS A;  3Q3F A;  1T2H A;  1Q9E A;  1GOY A;  2BU4 A;  1YVS A;  4GHO A;  1DET A;  1GOV A;  2KF4 A;  1SAR A;  3D5I A;  1FYS A;  1R4Y A;  1JBR A;  1B2M A;  3BU4 A;  1BNJ A;  1BNG A;  1I2F A;  5BU4 A;  3GSP A;  5GSP A;  2SAR A;  2F5M A;  1FZU A;  1UCK A;  3D4A A;  1LRA A;  4BIR A;  2AAD A;  1X1U A;  1FW7 A;  1I0V A;  1G02 A;  1RN1 A;  2C4B A;  2F5W A;  1BSD A;  1TTO A;  1A2P A;  2HOH A;  1BNS A;  3DGY A;  3KCH A;  1HZ1 A;  4J5G A;  1RSN A;  1YNV X;  4BU4 A;  1BRS A;  1RTU A;  1BRJ A;  1RLS A;  2KF5 A;  1RNB A;  2KF6 A;  2AAE A;  1BSB A;  1TRQ A;  6GSP A;  1X1Y A;  3BIR A;  1B2S A;  1BSE A;  1BAN A;  1BRI A;  3AGN A;  1BNE A;  3WHO A;  7RNT A;  1BVI A;  3DH2 A;  1B27 A;  2RBI A;  1B2Z A;  3RNT A;  1RNT A;  1BOX A;  1RGE A;  1RHL A;  1RGG A;  1HYF A;  4GSP A;  1I2E A;  1IYY A;  1I70 A;  1ZGX A;  3D5G A;  1FUT A;  1YGW A;  6RNT A;  1B2U A;  1BRK A;  1BRG A;  1BAO A;  1PY3 A;  2GSP A;  1GMQ A;  2ZA4 A;  1B2X A;  1BIR A;  1UCJ A;  4HOH A;  1GSP A;  9RNT A;  3SYU A;  3WR2 A;  1JBT A;  1RMS A;  2KAA A;  1BGS A;  7GSP A;  2F4Y A;  1BSC A;  1X1X A;  1GOU A;  2BIR A;  1FUS A;  1B21 A;  1BNF A;  1I0X A;  1PYL A;  1RCL A;  3AGO A;  4HAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...