1PYLA

Crystal structure of ribonuclease sa2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
DPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease
publication title Crystal structure reveals two alternative conformations in the active site of ribonuclease Sa2.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1pylA00
1LRAA 1I0VA 2AADA 1PYLA 1ZGXA 2F5MA 5BIRA 2F4YA 1A2PA 1BNGA 6GSPA 3DGYA 1FW7A 1I70A 2C4BA 1RSNA 2F5WA 1RGEA 1BSCA 1X1YA 5HOHA 1BSBA 1TRPA 1BAOA 1RGCA 2BIRA 4BU4A 4HOHA 1RNTA 1GSPA 1YVSA 1IYYA 1B2ZA 3AHWA 1UCJA 1BNIA 1UCLA 1DE3A 1UCKA 1X1XA 1B27A 4HAAA 1DETA 8RNTA 1GOUA 1I8VA 1RGGA 4RNTA 1PY3A 1FZUA 1RN1A 1X1UA 1I3IA 3D5GA 1BNFA 3D5IA 7RNTA 1B3SA 1BUJA 1I3FA 1GMRA 1B2SA 3DH2A 1LOVA 2GSPA 4GHOA 2KF4A 1BSAA 3A5EA 1BRNL 1GMPA 1BRJA 1FYSA 1R4YA 1BNSA 1B21A 1I0XA 1I2EA 1BRHA 1JBSA 1HYFA 1B2XA 1RDSA 3AHSA 2RBIA 1I2FA 1RGFA 1X1WA 4BIRA 1LOWA 7GSPA 2RNTA 3URPA 1RGAA 1RCLA 2AAEA 4J5KA 1BGSA 2HOHA 2KF6A 1RTUA 3RNTA 1B2MA 1BRSA 1FUTA 1MGWA 1BRKA 1TTOA 2KF5A 6RNTA 1LNIA 1RMSA 3BU4A 1BIRA 1SARA 1YNVX 1BRGA 1RNBA 1BNEA 1RLSA 4GSPA 1BVIA 4J5GA 1T2HA 1BANA 1CH0A 1HZ1A 1YGWA 5GSPA 3D4AA 1BU4A 1FUSA 5RNTA 1RCKA 1GOVA 1T2IA 1LOYA 1AY7A 2KF3A 1RGLA 1JBRA 2ZA4A 1BNJA 1RN4A 1BRIA 1RHLA 2KAAA 1JBTA 3WHOA 2BU4A 3GSPA 1I2GA 1RGKA 2F56A 1BSEA 3AGNA 1GMQA 1GOYA 1AQZA 3Q3FA 1UCIA 5BU4A 1BOXA 3SYUA 9RNTA 3KCHA 3AGOA 1B2UA 1B20A 3HOHA 1RGHA 3WR2A 1TRQA 1G02A 1Q9EA 1BNRA 1BSDA 3BIRA 1MGRA 2SARA 1C54A
chains in the Genus database with same CATH superfamily
4JRFA 3DUKA 1Y4KA 2AADA 1O7NB 3OX9A 5CF1A 2XF3A 3MSOA 1TP6A 1E3VA 2F5MA 1A2PA 2Z6BA 4LEHA 1VQQA 1UGIA 6GSPA 1FW7A 1I70A 1E3RA 1LVNA 1YJN3 1K9M4 1ROVA 5G1KA 3DY5A 2GU3A 1BSCA 3EE1A 5FGOA 1X1YA 5HOHA 1EA2A 1YJW3 4HM0B 3FG3A 3ROBA 5IENA 4XDVA 5EQLA 1JZDA 3NXJA 1OACA 1RNTA 2L1SA 3DGMA 1ROAA 1B2ZA 1FGTA 1UCJA 1BNIA 3EF8A 3J7Yd 1SJWA 1DETA 4LSOA 8RNTA 1GOUA 1I8VA 1RGGA 1IQYA 3AMOA 5KP4A 2FNQA 5EEOA 1PY3A 3CCR3 1Q814 3D5GA 3HIGA 4X2HA 2F86B 2STDA 4LZIA 1LXEA 1O7PB 5JBSA 4IT7A 1YJ93 1IV9A 4GL6A 2IYJA 4PEJA 3NBBA 5IERA 4BL3A 1B2SA 2INXA 2MF7A 1BSAA 3CD63 1ASKA 3CMA3 3FGYA 4FR9A 1UUWB 1N5HA 1O7MB 4MMYB 1IVUA 1T3BA 5AI1A 1A67A 1B21A 4CCVA 1RN7A 3F9SA 3LH4A 1VQL3 1NB3I 1BRHA 1IV7A 1N8QA 4N6TA 1W7CA 4L8OA 1RDSA 2JQ5A 2CIUA 3K0ZA 1X1WA 3GZRA 3S29A 1N9EA 1V57A 4HM5B 1W02A 1ULIB 1UUVB 5IEPA 2AAEA 3M8CA 2Y73A 2ZHXB 3PS8A 1NO3A 4LGQA 3S28A 3MKIA 1N9JA 2QIYA 2HOHA 4R9LA 2GBXB 3ER7A 5AIHA 1MOLA 5I97A 1BRSA 1JV2B 4L8PA 3CXC2 1WMPA 4HM6B 5ELUA 2GEYA 1BIRA 1SARA 3KZTA 3FCSB 1D6YA 1U8CB 1J2BA 3D9RA 5AIIA 3EBYA 1VQO3 1QVG2 1JB5A 3NBRA 4FMDA 1T2HA 2F98A 4HYZA 2IUJA 2XFSA 1PFPA 5GSPA 2P0XA 1IVWA 1EUIC 1W2ZA 4TX4A 3SX1A 1AR0A 1RCKA 5D81A 2UGIA 1T2IA 3G16A 2OOVC 1OHSA 3STDA 1A90A 1JBRA 5AYSC 2ZA4A 4U13A 1RN4A 1EEJA 3MPHA 5AEWB 1GYBA 2BU4A 2PZVA 2UX0A 2Y74A 4X2OA 3O8YA 3SVAA 1RGKA 3HX8A 1OGXA 4R1KA 1BSEA 3QRDA 3TDGA 1NJI4 3G0KA 1UCIA 5BU4A 2CHCA 2LYXA 1B2UA 1B20A 2GBWB 3RGRA 2OTJ3 2BNGA 1Q824 1D6UA 4GB5A 3X40A 1DVDA 4HZ9B 2Z77A 3EX9A 5BVBA 1BSDA 1K28A 1MGRA 2E2VA 1RRLA 4R4KA 4AKYA 3G6E3 4DKIA 3DM8A 3JUPA 1MNLA 2UUGC 2IUKA 2XSOB 3E99A 1PU4A 2WO0A 1ZGXA 3IJEB 3OWSA 5HGRA 1CYUA 2W2CA 1QAFA 4ILFA 1W6YA 5IG0A 5KP3A 5DRVA 1O7HB 1W5ZA 4XBXA 1ISKA 2C4BA 4HM7B 3EBTA 3UJMA 4KFFA 4XM4A 1K41A 3NQYA 3CPW2 4MMZB 5CXOA 1CQSA 1SIIA 4BTXA 3ALAA 1WMOA 5AIGA 5CK6A 3S5CA 1BAOA 4N6LA 2OOVA 1BUQA 2SBLA 4XBTA 3SLUA 1GSPA 1IYYA 2CWVA 1GS3A 1S5AA 2CFGA 4FMBA 3SOYA 1KSIA 1YIJ3 4KVHA 4FCJA 2A15A 4HM1B 1OF5B 1OPYA 2RFRA 3F7SA 2XEPA 3HK4A 1A2KA 3BLZA 3NHXA 1GY7A 1AVLA 2HMJB 3FG4A 3T0UA 1AVKA 2CFKA 1BUJA 1YGEA 5JPUA 1I3FA 1M9GA 2C10A 1IVVA 1LQMB 2HMLB 2RCDA 3CNMA 3FG1A 3IPTA 1W6CA 4FCZA 4EYCA 4GHOA 2KF4A 1GY6A 3A5EA 4OUQA 5CF2A 1BRJA 3HIIA 4BTWA 3LYGA 2YFIB 1I0XA 3SXXA 2K0MA 4ZM8A 1I2EA 1JBSA 1B2XA 1HYFA 4I5QA 4XDWA 4EV5A 3T8NA 1DMNA 3WOFB 3CC73 3I553 4RBNA 7GSPA 3URPA 1NU3A 2MC8A 3B7CA 1KD14 2M7OA 2ML6A 4HBRA 5IG4A 5FW5A 3Q1CA 1V74A 3BB9A 3KSPA 1L5GB 3GAXA 1FUTA 3PGBA 3K9MC 2KF5A 1TTOA 2BMQB 6RNTA 4N6V0 1NWWA 4HJLB 1BRGA 1RNBA 1BNEA 1JKGB 5IEOA 5M19A 1ZX2A 4OK0A 4GSPA 4O02B 2W9PA 1BANA 1CH0A 3DMCA 1HZ1A 3EN8A 4NREA 2CFDA 7STDA 4EBGA 3VF1A 3CC43 1BU4A 2FGTA 3LOYA 3JUMA 1Q42A 4N6MA 1GOVA 4O2HA 2IA7A 1UI8A 5RNTA 1TU5A 1UUGB 1AY7A 3G4S3 1DYUA 3CCS3 3BNBA 3OXAA 3CU3A 2R4IA 3NV0B 1YHQ3 1BNJA 1STDA 1O7WB 1VQ73 1RHLA 1M1XB 2RGQA 2YFLB 3WHOA 3CCE3 2OTL3 1IU7A 3GSPA 5M18A 1FGQA 4EV2A 2CFLA 3PCSA 1IT8A 1QMAA 2F56A 3PCRA 4XB5A 3X41A 5AEUB 1QALA 1RRHA 1JN5B 1F8NA 2D42A 4O3VA 3SEDA 5IW9A 5IG3A 1V58A 1BOXA 3HI7A 3SYUA 3KCHA 9RNTA 2B24B 2C11A 4IPBA 3I563 3NBJA 3HOHA 4HM8B 1TRQA 3NM2A 3K63A 3UL5A 2Z7AA 4CDLA 2BO9B 1FUWA 3KN4A 1LNIA 3KFQC 1C54A 1GY5A 3VGNA 2I9WA 3CPOA 1LRAA 2B1XB 1VQ53 3CNXA 3F7XA 1I0VA 4K90B 3WOEB 3CME3 2O3OA 1W4NA 3L0RA 4KT3B 3JUQA 5BIRA 1BNGA 1JRQA 1O7GB 3DGYA 3JUOA 1N5PA 1M904 1VQ63 3BNDA 1Q7HA 1NNVA 2KXGA 1GD3A 3K5TA 1EQKA 1IQXA 1RSNA 3GZBA 3LZAA 1WTHA 1OF5A 2F5WA 2CG1A 1RGEA 2CK3H 4IIAA 3FLJA 1W00A 2R41A 2P05A 1BSBA 2RSXA 3G8ZA 1OUNA 1RGCA 4BU4A 1N8R4 4WWUC 5A0OB 1ZO2A 3ECFA 2HMOB 4ORLA 3AHWA 3VSYA 2CWUA 2K54A 1UDII 4AEQA 1X1XA 4HAAA 4N6UA 1VQ83 1W01A 3JVCA 3D3LA 1KC84 4CPKA 1QAKA 1IVXA 4R9KA 3G713 3F8HA 2FXTA 2W03A 1OGZA 4KFEA 3D5IA 3HZPA 2QGUA 2QEX3 1B3SA 1E97A 2HMNB 2O9UX 2OQEC 2KRTA 3F40A 1GMRA 3DH2A 3DXOA 1LOVA 5STDA 1JNQA 2W56A 3WA2X 1W6GA 4H61A 1BRNL 4N6NB 1JZOA 2XFTA 1BNSA 4STDA 1UGHI 3ZG0A 3JUNA 3V98A 3F14A 1SQWA 3GWRA 1TJDA 2W0QA 4WHAA 3U1WA 1JKGA 1RGFA 2OWPA 3KE7A 2JDIH 3MG2A 2OCTA 4O8SA 1UI7A 1IT7A 1CYVA 1RCLA 3MHEA 2ZDJA 1VQK3 1OCVA 4RNZA 3RNTA 2KF6A 1RTUA 3GZXB 5G1LA 1B2MA 1G96A 3FH1A 4WYKB 3EHCA 1BRKA 1WQLB 4BL2A 3I0YA 3NV0A 1JJ22 1Z1SA 1Q864 3BU4A 1YNVX 2XGLA 2W6JH 3KSED 1YIT3 3DZLA 1S723 3CCV3 1TUHA 1OH0A 2V1LA 3X42A 6STDA 1VQ43 3U97A 3FSDA 4FMCA 1YGWA 1SPUA 2W9QA 1JN5A 1TFOA 1KQS2 3CCJ3 1FA3A 1MWRA 1WMNA 1YVBI 2XH9A 1HKXA 1LOYA 4NHFA 2E2UA 3S67A 3UNLA 1QJGA 2KF3A 2PNCA 3PZWA 4RZMA 3CCQ3 3MG3A 1RGLA 2OQEA 1QVF2 1BRIA 2W56B 3ZFZA 2F99A 4L7KA 3MG1A 3B4PA 5IG5A 3FF0A 2ML5A 3X3XA 4EXRA 4MEIA 3LT8A 3AGNA 4FMAA 1GD4A 1GMQA 3DGOA 1EG9B 4J8TA 3AGOA 1Q40B 3NUVA 4K61A 2CWTA 3EN1B 3NQZA 4HM3B 4MMXB 1VQN3 1RGHA 1C7HA 2CG0A 3OWUA 3GRDA 2BMOB 3F8XA 1STFI 1OHOA 3LXUX 1NDOB 4NPBA 3RDEA 2SARA 1IK3A 3H3HA 4XBYA 5KP1A 1FGMA 3K7CA 1D6ZA 1ULJB 2P09A 3QK9A 5DREA 5ELJA 3DGLA 1W2B2 4HVNA 1PYLA 3EB8A 3LTBA 2F4YA 4K1UA 2E2TA 3NX0A 3FF2A 4HM2B 1EKMA 3MWZA 2K3DA 4KFDA 2CX1A 1CEWI 1U5OA 1JB2A 1HU9A 3LT9A 1G0TA 3T8UA 3LTAA 1R4CA 4LMIA 3WDGB 1LQGC 4N3VA 5LC6A 1VQP3 3LTDA 1SIHA 2P0MA 3EC9A 3H51A 1TRPA 3LMLA 2D1WA 3WMDA 4WFOA 2WGQA 2BIRA 3PXMA 3UB1A 4HOHA 1DVCA 5JPPA 1YVSA 2BMRB 1AV4A 2CFWA 3V92A 1UCLA 1K734 1DE3A 1UCKA 1B27A 2YX9A 2XRXB 3D79A 1KWIA 3FZWA 3Q2PA 2QA43 4RNTA 2HMKB 2XSHB 3S27A 1FZUA 1RN1A 1X1UA 2IY2A 1I3IA 2HMMB 5CLKA 1LOXA 1TFKA 1BNFA 4WP5A 3SOAA 3NM7A 2BT3A 4HKVB 4BTYA 7RNTA 1YI23 3WA3A 2H0GA 1MWTA 2CW9A 3OV4A 2GXFA 2GSPA 5BXQA 3CCU3 5M1AA 3EQQB 4HM4B 3GZYB 1GMPA 1FYSA 3AMOB 1R4YA 1Q7Y4 5D82A 4Q53A 3CCL3 1LNHA 3B4OA 4WYKA 5AIFA 1FGOA 3N9HA 4QWTA 4MJDA 3DGNA 4I4KA 1MWSA 2YFJB 3AHSA 2RBIA 1I2FA 1TIJA 4FCMA 4OVMA 3IMAB 3PYJA 5LC7A 1LOWA 2CH9A 3ZG5A 2RNTA 4BIRA 1RGAA 3X3ZA 3WODG 4J5KA 4EC6A 8CHOA 1BGSA 3LTCA 2WOFA 2XGNA 5TGNA 2J8XB 2WGOA 1A2VA 3V99A 2WOHA 4R80A 4RNYA 1MGWA 2L4VA 1IQ8A 4J9AA 5D83A 1RMSA 3BNEA 2GU1A 1MWUA 5IF6A 1US1A 2XR8B 2Z76A 1RLSA 1DMQA 1BVIA 4J5GA 3KKGA 4G1MB 4KZ1A 4N6OB 2CKFB 2Q07A 2KCDA 1OHPA 3BNCA 5EVHA 3D4AA 1K8A4 4JF8A 1UW1A 1FUSA 3MYTA 4HZBB 2CX0A 3CC23 2BHMA 1WNHA 2H0IA 4K1VA 1Q40A 3Q90A 5AYRB 2W04A 4EW5A 2KAAA 1DMMA 3X3YA 3CCM3 1JBTA 4AKZA 3N54B 4CJNA 1I2GA 2GEXA 2H0HA 3KIIA 1VZZA 3OWYA 3OW22 2IMJA 4H3UA 2LQVA 1M1K4 4LYLB 1VQ93 3A76A 1NB5I 1GOYA 1AQZA 3Q3FA 3FKAA 1T5YA 1ZS7A 3UL6A 1JB4A 3N8BA 5G2GA 2ZL8A 2CC3A 1RJOA 1FGRA 3WR2A 3B8LA 1G02A 1Q9EA 1BNRA 3EJVA 3RGAA 3BIRA 1VQM3 1IDPA 1RKYA 2P38A
chains in the Genus database with same CATH topology
1LRAA 1I0VA 2AADA 1PYLA 1ZGXA 2F5MA 5BIRA 2F4YA 1A2PA 1BNGA 6GSPA 3DGYA 1FW7A 1I70A 2C4BA 1RSNA 2F5WA 1RGEA 1BSCA 1X1YA 5HOHA 1BSBA 1TRPA 1BAOA 1RGCA 2BIRA 4BU4A 4HOHA 1RNTA 1GSPA 1YVSA 1IYYA 1B2ZA 3AHWA 1UCJA 1BNIA 1UCLA 1DE3A 1UCKA 1X1XA 1B27A 4HAAA 1DETA 8RNTA 1GOUA 1I8VA 1RGGA 4RNTA 1PY3A 1FZUA 1RN1A 1X1UA 1I3IA 3D5GA 1BNFA 3D5IA 7RNTA 1B3SA 1BUJA 1I3FA 1GMRA 1B2SA 3DH2A 1LOVA 2GSPA 4GHOA 2KF4A 1BSAA 3A5EA 1BRNL 1GMPA 1BRJA 1FYSA 1R4YA 1BNSA 1B21A 1I0XA 1I2EA 1BRHA 1JBSA 1HYFA 1B2XA 1RDSA 3AHSA 2RBIA 1I2FA 1RGFA 1X1WA 4BIRA 1LOWA 7GSPA 2RNTA 3URPA 1RGAA 1RCLA 2AAEA 4J5KA 1BGSA 2HOHA 2KF6A 1RTUA 3RNTA 1B2MA 1BRSA 1FUTA 1MGWA 1BRKA 1TTOA 2KF5A 6RNTA 1LNIA 1RMSA 3BU4A 1BIRA 1SARA 1YNVX 1BRGA 1RNBA 1BNEA 1RLSA 4GSPA 1BVIA 4J5GA 1T2HA 1BANA 1CH0A 1HZ1A 1YGWA 5GSPA 3D4AA 1BU4A 1FUSA 5RNTA 1RCKA 1GOVA 1T2IA 1LOYA 1AY7A 2KF3A 1RGLA 1JBRA 2ZA4A 1BNJA 1RN4A 1BRIA 1RHLA 2KAAA 1JBTA 3WHOA 2BU4A 3GSPA 1I2GA 1RGKA 2F56A 1BSEA 3AGNA 1GMQA 1GOYA 1AQZA 3Q3FA 1UCIA 5BU4A 1BOXA 3SYUA 9RNTA 3KCHA 3AGOA 1B2UA 1B20A 3HOHA 1RGHA 3WR2A 1TRQA 1G02A 1Q9EA 1BNRA 1BSDA 3BIRA 1MGRA 2SARA 1C54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRA A;  1I0V A;  2AAD A;  1PYL A;  1ZGX A;  2F5M A;  5BIR A;  2F4Y A;  1A2P A;  1BNG A;  6GSP A;  3DGY A;  1FW7 A;  1I70 A;  2C4B A;  1RSN A;  2F5W A;  1RGE A;  1BSC A;  1X1Y A;  5HOH A;  1BSB A;  1TRP A;  1BAO A;  1RGC A;  2BIR A;  4BU4 A;  4HOH A;  1RNT A;  1GSP A;  1YVS A;  1IYY A;  1B2Z A;  3AHW A;  1UCJ A;  1BNI A;  1UCL A;  1DE3 A;  1UCK A;  1X1X A;  1B27 A;  4HAA A;  1DET A;  8RNT A;  1GOU A;  1I8V A;  1RGG A;  4RNT A;  1PY3 A;  1FZU A;  1RN1 A;  1X1U A;  1I3I A;  3D5G A;  1BNF A;  3D5I A;  7RNT A;  1B3S A;  1BUJ A;  1I3F A;  1GMR A;  1B2S A;  3DH2 A;  1LOV A;  2GSP A;  4GHO A;  2KF4 A;  1BSA A;  3A5E A;  1BRN L;  1GMP A;  1BRJ A;  1FYS A;  1R4Y A;  1BNS A;  1B21 A;  1I0X A;  1I2E A;  1BRH A;  1JBS A;  1HYF A;  1B2X A;  1RDS A;  3AHS A;  2RBI A;  1I2F A;  1RGF A;  1X1W A;  4BIR A;  1LOW A;  7GSP A;  2RNT A;  3URP A;  1RGA A;  1RCL A;  2AAE A;  4J5K A;  1BGS A;  2HOH A;  2KF6 A;  1RTU A;  3RNT A;  1B2M A;  1BRS A;  1FUT A;  1MGW A;  1BRK A;  1TTO A;  2KF5 A;  6RNT A;  1LNI A;  1RMS A;  3BU4 A;  1BIR A;  1SAR A;  1YNV X;  1BRG A;  1RNB A;  1BNE A;  1RLS A;  4GSP A;  1BVI A;  4J5G A;  1T2H A;  1BAN A;  1CH0 A;  1HZ1 A;  1YGW A;  5GSP A;  3D4A A;  1BU4 A;  1FUS A;  5RNT A;  1RCK A;  1GOV A;  1T2I A;  1LOY A;  1AY7 A;  2KF3 A;  1RGL A;  1JBR A;  2ZA4 A;  1BNJ A;  1RN4 A;  1BRI A;  1RHL A;  2KAA A;  1JBT A;  3WHO A;  2BU4 A;  3GSP A;  1I2G A;  1RGK A;  2F56 A;  1BSE A;  3AGN A;  1GMQ A;  1GOY A;  1AQZ A;  3Q3F A;  1UCI A;  5BU4 A;  1BOX A;  3SYU A;  9RNT A;  3KCH A;  3AGO A;  1B2U A;  1B20 A;  3HOH A;  1RGH A;  3WR2 A;  1TRQ A;  1G02 A;  1Q9E A;  1BNR A;  1BSD A;  3BIR A;  1MGR A;  2SAR A;  1C54 A; 
#chains in the Genus database with same CATH topology
 4JRF A;  3DUK A;  1Y4K A;  2AAD A;  1O7N B;  3OX9 A;  5CF1 A;  2XF3 A;  3MSO A;  1TP6 A;  1E3V A;  2F5M A;  1A2P A;  2Z6B A;  4LEH A;  1VQQ A;  1UGI A;  6GSP A;  1FW7 A;  1I70 A;  1E3R A;  1LVN A;  1YJN 3;  1K9M 4;  1ROV A;  5G1K A;  3DY5 A;  2GU3 A;  1BSC A;  3EE1 A;  5FGO A;  1X1Y A;  5HOH A;  1EA2 A;  1YJW 3;  4HM0 B;  3FG3 A;  3ROB A;  5IEN A;  4XDV A;  5EQL A;  1JZD A;  3NXJ A;  1OAC A;  1RNT A;  2L1S A;  3DGM A;  1ROA A;  1B2Z A;  1FGT A;  1UCJ A;  1BNI A;  3EF8 A;  3J7Y d;  1SJW A;  1DET A;  4LSO A;  8RNT A;  1GOU A;  1I8V A;  1RGG A;  1IQY A;  3AMO A;  5KP4 A;  2FNQ A;  5EEO A;  1PY3 A;  3CCR 3;  1Q81 4;  3D5G A;  3HIG A;  4X2H A;  2F86 B;  2STD A;  4LZI A;  1LXE A;  1O7P B;  5JBS A;  4IT7 A;  1YJ9 3;  1IV9 A;  4GL6 A;  2IYJ A;  4PEJ A;  3NBB A;  5IER A;  4BL3 A;  1B2S A;  2INX A;  2MF7 A;  1BSA A;  3CD6 3;  1ASK A;  3CMA 3;  3FGY A;  4FR9 A;  1UUW B;  1N5H A;  1O7M B;  4MMY B;  1IVU A;  1T3B A;  5AI1 A;  1A67 A;  1B21 A;  4CCV A;  1RN7 A;  3F9S A;  3LH4 A;  1VQL 3;  1NB3 I;  1BRH A;  1IV7 A;  1N8Q A;  4N6T A;  1W7C A;  4L8O A;  1RDS A;  2JQ5 A;  2CIU A;  3K0Z A;  1X1W A;  3GZR A;  3S29 A;  1N9E A;  1V57 A;  4HM5 B;  1W02 A;  1ULI B;  1UUV B;  5IEP A;  2AAE A;  3M8C A;  2Y73 A;  2ZHX B;  3PS8 A;  1NO3 A;  4LGQ A;  3S28 A;  3MKI A;  1N9J A;  2QIY A;  2HOH A;  4R9L A;  2GBX B;  3ER7 A;  5AIH A;  1MOL A;  5I97 A;  1BRS A;  1JV2 B;  4L8P A;  3CXC 2;  1WMP A;  4HM6 B;  5ELU A;  2GEY A;  1BIR A;  1SAR A;  3KZT A;  3FCS B;  1D6Y A;  1U8C B;  1J2B A;  3D9R A;  5AII A;  3EBY A;  1VQO 3;  1QVG 2;  1JB5 A;  3NBR A;  4FMD A;  1T2H A;  2F98 A;  4HYZ A;  2IUJ A;  2XFS A;  1PFP A;  5GSP A;  2P0X A;  1IVW A;  1EUI C;  1W2Z A;  4TX4 A;  3SX1 A;  1AR0 A;  1RCK A;  5D81 A;  2UGI A;  1T2I A;  3G16 A;  2OOV C;  1OHS A;  3STD A;  1A90 A;  1JBR A;  5AYS C;  2ZA4 A;  4U13 A;  1RN4 A;  1EEJ A;  3MPH A;  5AEW B;  1GYB A;  2BU4 A;  2PZV A;  2UX0 A;  2Y74 A;  4X2O A;  3O8Y A;  3SVA A;  1RGK A;  3HX8 A;  1OGX A;  4R1K A;  1BSE A;  3QRD A;  3TDG A;  1NJI 4;  3G0K A;  1UCI A;  5BU4 A;  2CHC A;  2LYX A;  1B2U A;  1B20 A;  2GBW B;  3RGR A;  2OTJ 3;  2BNG A;  1Q82 4;  1D6U A;  4GB5 A;  3X40 A;  1DVD A;  4HZ9 B;  2Z77 A;  3EX9 A;  5BVB A;  1BSD A;  1K28 A;  1MGR A;  2E2V A;  1RRL A;  4R4K A;  4AKY A;  3G6E 3;  4DKI A;  3DM8 A;  3JUP A;  1MNL A;  2UUG C;  2IUK A;  2XSO B;  3E99 A;  1PU4 A;  2WO0 A;  1ZGX A;  3IJE B;  3OWS A;  5HGR A;  1CYU A;  2W2C A;  1QAF A;  4ILF A;  1W6Y A;  5IG0 A;  5KP3 A;  5DRV A;  1O7H B;  1W5Z A;  4XBX A;  1ISK A;  2C4B A;  4HM7 B;  3EBT A;  3UJM A;  4KFF A;  4XM4 A;  1K41 A;  3NQY A;  3CPW 2;  4MMZ B;  5CXO A;  1CQS A;  1SII A;  4BTX A;  3ALA A;  1WMO A;  5AIG A;  5CK6 A;  3S5C A;  1BAO A;  4N6L A;  2OOV A;  1BUQ A;  2SBL A;  4XBT A;  3SLU A;  1GSP A;  1IYY A;  2CWV A;  1GS3 A;  1S5A A;  2CFG A;  4FMB A;  3SOY A;  1KSI A;  1YIJ 3;  4KVH A;  4FCJ A;  2A15 A;  4HM1 B;  1OF5 B;  1OPY A;  2RFR A;  3F7S A;  2XEP A;  3HK4 A;  1A2K A;  3BLZ A;  3NHX A;  1GY7 A;  1AVL A;  2HMJ B;  3FG4 A;  3T0U A;  1AVK A;  2CFK A;  1BUJ A;  1YGE A;  5JPU A;  1I3F A;  1M9G A;  2C10 A;  1IVV A;  1LQM B;  2HML B;  2RCD A;  3CNM A;  3FG1 A;  3IPT A;  1W6C A;  4FCZ A;  4EYC A;  4GHO A;  2KF4 A;  1GY6 A;  3A5E A;  4OUQ A;  5CF2 A;  1BRJ A;  3HII A;  4BTW A;  3LYG A;  2YFI B;  1I0X A;  3SXX A;  2K0M A;  4ZM8 A;  1I2E A;  1JBS A;  1B2X A;  1HYF A;  4I5Q A;  4XDW A;  4EV5 A;  3T8N A;  1DMN A;  3WOF B;  3CC7 3;  3I55 3;  4RBN A;  7GSP A;  3URP A;  1NU3 A;  2MC8 A;  3B7C A;  1KD1 4;  2M7O A;  2ML6 A;  4HBR A;  5IG4 A;  5FW5 A;  3Q1C A;  1V74 A;  3BB9 A;  3KSP A;  1L5G B;  3GAX A;  1FUT A;  3PGB A;  3K9M C;  2KF5 A;  1TTO A;  2BMQ B;  6RNT A;  4N6V 0;  1NWW A;  4HJL B;  1BRG A;  1RNB A;  1BNE A;  1JKG B;  5IEO A;  5M19 A;  1ZX2 A;  4OK0 A;  4GSP A;  4O02 B;  2W9P A;  1BAN A;  1CH0 A;  3DMC A;  1HZ1 A;  3EN8 A;  4NRE A;  2CFD A;  7STD A;  4EBG A;  3VF1 A;  3CC4 3;  1BU4 A;  2FGT A;  3LOY A;  3JUM A;  1Q42 A;  4N6M A;  1GOV A;  4O2H A;  2IA7 A;  1UI8 A;  5RNT A;  1TU5 A;  1UUG B;  1AY7 A;  3G4S 3;  1DYU A;  3CCS 3;  3BNB A;  3OXA A;  3CU3 A;  2R4I A;  3NV0 B;  1YHQ 3;  1BNJ A;  1STD A;  1O7W B;  1VQ7 3;  1RHL A;  1M1X B;  2RGQ A;  2YFL B;  3WHO A;  3CCE 3;  2OTL 3;  1IU7 A;  3GSP A;  5M18 A;  1FGQ A;  4EV2 A;  2CFL A;  3PCS A;  1IT8 A;  1QMA A;  2F56 A;  3PCR A;  4XB5 A;  3X41 A;  5AEU B;  1QAL A;  1RRH A;  1JN5 B;  1F8N A;  2D42 A;  4O3V A;  3SED A;  5IW9 A;  5IG3 A;  1V58 A;  1BOX A;  3HI7 A;  3SYU A;  3KCH A;  9RNT A;  2B24 B;  2C11 A;  4IPB A;  3I56 3;  3NBJ A;  3HOH A;  4HM8 B;  1TRQ A;  3NM2 A;  3K63 A;  3UL5 A;  2Z7A A;  4CDL A;  2BO9 B;  1FUW A;  3KN4 A;  1LNI A;  3KFQ C;  1C54 A;  1GY5 A;  3VGN A;  2I9W A;  3CPO A;  1LRA A;  2B1X B;  1VQ5 3;  3CNX A;  3F7X A;  1I0V A;  4K90 B;  3WOE B;  3CME 3;  2O3O A;  1W4N A;  3L0R A;  4KT3 B;  3JUQ A;  5BIR A;  1BNG A;  1JRQ A;  1O7G B;  3DGY A;  3JUO A;  1N5P A;  1M90 4;  1VQ6 3;  3BND A;  1Q7H A;  1NNV A;  2KXG A;  1GD3 A;  3K5T A;  1EQK A;  1IQX A;  1RSN A;  3GZB A;  3LZA A;  1WTH A;  1OF5 A;  2F5W A;  2CG1 A;  1RGE A;  2CK3 H;  4IIA A;  3FLJ A;  1W00 A;  2R41 A;  2P05 A;  1BSB A;  2RSX A;  3G8Z A;  1OUN A;  1RGC A;  4BU4 A;  1N8R 4;  4WWU C;  5A0O B;  1ZO2 A;  3ECF A;  2HMO B;  4ORL A;  3AHW A;  3VSY A;  2CWU A;  2K54 A;  1UDI I;  4AEQ A;  1X1X A;  4HAA A;  4N6U A;  1VQ8 3;  1W01 A;  3JVC A;  3D3L A;  1KC8 4;  4CPK A;  1QAK A;  1IVX A;  4R9K A;  3G71 3;  3F8H A;  2FXT A;  2W03 A;  1OGZ A;  4KFE A;  3D5I A;  3HZP A;  2QGU A;  2QEX 3;  1B3S A;  1E97 A;  2HMN B;  2O9U X;  2OQE C;  2KRT A;  3F40 A;  1GMR A;  3DH2 A;  3DXO A;  1LOV A;  5STD A;  1JNQ A;  2W56 A;  3WA2 X;  1W6G A;  4H61 A;  1BRN L;  4N6N B;  1JZO A;  2XFT A;  1BNS A;  4STD A;  1UGH I;  3ZG0 A;  3JUN A;  3V98 A;  3F14 A;  1SQW A;  3GWR A;  1TJD A;  2W0Q A;  4WHA A;  3U1W A;  1JKG A;  1RGF A;  2OWP A;  3KE7 A;  2JDI H;  3MG2 A;  2OCT A;  4O8S A;  1UI7 A;  1IT7 A;  1CYV A;  1RCL A;  3MHE A;  2ZDJ A;  1VQK 3;  1OCV A;  4RNZ A;  3RNT A;  2KF6 A;  1RTU A;  3GZX B;  5G1L A;  1B2M A;  1G96 A;  3FH1 A;  4WYK B;  3EHC A;  1BRK A;  1WQL B;  4BL2 A;  3I0Y A;  3NV0 A;  1JJ2 2;  1Z1S A;  1Q86 4;  3BU4 A;  1YNV X;  2XGL A;  2W6J H;  3KSE D;  1YIT 3;  3DZL A;  1S72 3;  3CCV 3;  1TUH A;  1OH0 A;  2V1L A;  3X42 A;  6STD A;  1VQ4 3;  3U97 A;  3FSD A;  4FMC A;  1YGW A;  1SPU A;  2W9Q A;  1JN5 A;  1TFO A;  1KQS 2;  3CCJ 3;  1FA3 A;  1MWR A;  1WMN A;  1YVB I;  2XH9 A;  1HKX A;  1LOY A;  4NHF A;  2E2U A;  3S67 A;  3UNL A;  1QJG A;  2KF3 A;  2PNC A;  3PZW A;  4RZM A;  3CCQ 3;  3MG3 A;  1RGL A;  2OQE A;  1QVF 2;  1BRI A;  2W56 B;  3ZFZ A;  2F99 A;  4L7K A;  3MG1 A;  3B4P A;  5IG5 A;  3FF0 A;  2ML5 A;  3X3X A;  4EXR A;  4MEI A;  3LT8 A;  3AGN A;  4FMA A;  1GD4 A;  1GMQ A;  3DGO A;  1EG9 B;  4J8T A;  3AGO A;  1Q40 B;  3NUV A;  4K61 A;  2CWT A;  3EN1 B;  3NQZ A;  4HM3 B;  4MMX B;  1VQN 3;  1RGH A;  1C7H A;  2CG0 A;  3OWU A;  3GRD A;  2BMO B;  3F8X A;  1STF I;  1OHO A;  3LXU X;  1NDO B;  4NPB A;  3RDE A;  2SAR A;  1IK3 A;  3H3H A;  4XBY A;  5KP1 A;  1FGM A;  3K7C A;  1D6Z A;  1ULJ B;  2P09 A;  3QK9 A;  5DRE A;  5ELJ A;  3DGL A;  1W2B 2;  4HVN A;  1PYL A;  3EB8 A;  3LTB A;  2F4Y A;  4K1U A;  2E2T A;  3NX0 A;  3FF2 A;  4HM2 B;  1EKM A;  3MWZ A;  2K3D A;  4KFD A;  2CX1 A;  1CEW I;  1U5O A;  1JB2 A;  1HU9 A;  3LT9 A;  1G0T A;  3T8U A;  3LTA A;  1R4C A;  4LMI A;  3WDG B;  1LQG C;  4N3V A;  5LC6 A;  1VQP 3;  3LTD A;  1SIH A;  2P0M A;  3EC9 A;  3H51 A;  1TRP A;  3LML A;  2D1W A;  3WMD A;  4WFO A;  2WGQ A;  2BIR A;  3PXM A;  3UB1 A;  4HOH A;  1DVC A;  5JPP A;  1YVS A;  2BMR B;  1AV4 A;  2CFW A;  3V92 A;  1UCL A;  1K73 4;  1DE3 A;  1UCK A;  1B27 A;  2YX9 A;  2XRX B;  3D79 A;  1KWI A;  3FZW A;  3Q2P A;  2QA4 3;  4RNT A;  2HMK B;  2XSH B;  3S27 A;  1FZU A;  1RN1 A;  1X1U A;  2IY2 A;  1I3I A;  2HMM B;  5CLK A;  1LOX A;  1TFK A;  1BNF A;  4WP5 A;  3SOA A;  3NM7 A;  2BT3 A;  4HKV B;  4BTY A;  7RNT A;  1YI2 3;  3WA3 A;  2H0G A;  1MWT A;  2CW9 A;  3OV4 A;  2GXF A;  2GSP A;  5BXQ A;  3CCU 3;  5M1A A;  3EQQ B;  4HM4 B;  3GZY B;  1GMP A;  1FYS A;  3AMO B;  1R4Y A;  1Q7Y 4;  5D82 A;  4Q53 A;  3CCL 3;  1LNH A;  3B4O A;  4WYK A;  5AIF A;  1FGO A;  3N9H A;  4QWT A;  4MJD A;  3DGN A;  4I4K A;  1MWS A;  2YFJ B;  3AHS A;  2RBI A;  1I2F A;  1TIJ A;  4FCM A;  4OVM A;  3IMA B;  3PYJ A;  5LC7 A;  1LOW A;  2CH9 A;  3ZG5 A;  2RNT A;  4BIR A;  1RGA A;  3X3Z A;  3WOD G;  4J5K A;  4EC6 A;  8CHO A;  1BGS A;  3LTC A;  2WOF A;  2XGN A;  5TGN A;  2J8X B;  2WGO A;  1A2V A;  3V99 A;  2WOH A;  4R80 A;  4RNY A;  1MGW A;  2L4V A;  1IQ8 A;  4J9A A;  5D83 A;  1RMS A;  3BNE A;  2GU1 A;  1MWU A;  5IF6 A;  1US1 A;  2XR8 B;  2Z76 A;  1RLS A;  1DMQ A;  1BVI A;  4J5G A;  3KKG A;  4G1M B;  4KZ1 A;  4N6O B;  2CKF B;  2Q07 A;  2KCD A;  1OHP A;  3BNC A;  5EVH A;  3D4A A;  1K8A 4;  4JF8 A;  1UW1 A;  1FUS A;  3MYT A;  4HZB B;  2CX0 A;  3CC2 3;  2BHM A;  1WNH A;  2H0I A;  4K1V A;  1Q40 A;  3Q90 A;  5AYR B;  2W04 A;  4EW5 A;  2KAA A;  1DMM A;  3X3Y A;  3CCM 3;  1JBT A;  4AKZ A;  3N54 B;  4CJN A;  1I2G A;  2GEX A;  2H0H A;  3KII A;  1VZZ A;  3OWY A;  3OW2 2;  2IMJ A;  4H3U A;  2LQV A;  1M1K 4;  4LYL B;  1VQ9 3;  3A76 A;  1NB5 I;  1GOY A;  1AQZ A;  3Q3F A;  3FKA A;  1T5Y A;  1ZS7 A;  3UL6 A;  1JB4 A;  3N8B A;  5G2G A;  2ZL8 A;  2CC3 A;  1RJO A;  1FGR A;  3WR2 A;  3B8L A;  1G02 A;  1Q9E A;  1BNR A;  3EJV A;  3RGA A;  3BIR A;  1VQM 3;  1IDP A;  1RKY A;  2P38 A; 
#chains in the Genus database with same CATH homology
 1LRA A;  1I0V A;  2AAD A;  1PYL A;  1ZGX A;  2F5M A;  5BIR A;  2F4Y A;  1A2P A;  1BNG A;  6GSP A;  3DGY A;  1FW7 A;  1I70 A;  2C4B A;  1RSN A;  2F5W A;  1RGE A;  1BSC A;  1X1Y A;  5HOH A;  1BSB A;  1TRP A;  1BAO A;  1RGC A;  2BIR A;  4BU4 A;  4HOH A;  1RNT A;  1GSP A;  1YVS A;  1IYY A;  1B2Z A;  3AHW A;  1UCJ A;  1BNI A;  1UCL A;  1DE3 A;  1UCK A;  1X1X A;  1B27 A;  4HAA A;  1DET A;  8RNT A;  1GOU A;  1I8V A;  1RGG A;  4RNT A;  1PY3 A;  1FZU A;  1RN1 A;  1X1U A;  1I3I A;  3D5G A;  1BNF A;  3D5I A;  7RNT A;  1B3S A;  1BUJ A;  1I3F A;  1GMR A;  1B2S A;  3DH2 A;  1LOV A;  2GSP A;  4GHO A;  2KF4 A;  1BSA A;  3A5E A;  1BRN L;  1GMP A;  1BRJ A;  1FYS A;  1R4Y A;  1BNS A;  1B21 A;  1I0X A;  1I2E A;  1BRH A;  1JBS A;  1HYF A;  1B2X A;  1RDS A;  3AHS A;  2RBI A;  1I2F A;  1RGF A;  1X1W A;  4BIR A;  1LOW A;  7GSP A;  2RNT A;  3URP A;  1RGA A;  1RCL A;  2AAE A;  4J5K A;  1BGS A;  2HOH A;  2KF6 A;  1RTU A;  3RNT A;  1B2M A;  1BRS A;  1FUT A;  1MGW A;  1BRK A;  1TTO A;  2KF5 A;  6RNT A;  1LNI A;  1RMS A;  3BU4 A;  1BIR A;  1SAR A;  1YNV X;  1BRG A;  1RNB A;  1BNE A;  1RLS A;  4GSP A;  1BVI A;  4J5G A;  1T2H A;  1BAN A;  1CH0 A;  1HZ1 A;  1YGW A;  5GSP A;  3D4A A;  1BU4 A;  1FUS A;  5RNT A;  1RCK A;  1GOV A;  1T2I A;  1LOY A;  1AY7 A;  2KF3 A;  1RGL A;  1JBR A;  2ZA4 A;  1BNJ A;  1RN4 A;  1BRI A;  1RHL A;  2KAA A;  1JBT A;  3WHO A;  2BU4 A;  3GSP A;  1I2G A;  1RGK A;  2F56 A;  1BSE A;  3AGN A;  1GMQ A;  1GOY A;  1AQZ A;  3Q3F A;  1UCI A;  5BU4 A;  1BOX A;  3SYU A;  9RNT A;  3KCH A;  3AGO A;  1B2U A;  1B20 A;  3HOH A;  1RGH A;  3WR2 A;  1TRQ A;  1G02 A;  1Q9E A;  1BNR A;  1BSD A;  3BIR A;  1MGR A;  2SAR A;  1C54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...