5JPPA

Structure of limonene epoxide hydrolase mutant - h-2-h5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
STPDEKIVLEFMDALTSNDAAKLIDYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFKVFSIDAVETFHIGSTKGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords limonene epoxide hydrolase
publication title Multi-Parameter Optimization in Directed Evolution: Engineering Thermostability, Enantioselectivity and Activity of an Epoxide Hydrolase
rcsb
source organism Rhodococcus erythropolis
total genus 31
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5jppA00
1ULJB 2F98A 5IF6A 1NDOB 3A76A 3EBTA 4RZMA 1QJGA 1ULIB 3CU3A 4LMIA 4LGQA 3RGRA 3KSPA 1W01A 3NV0A 3UJMA 3S5CA 3CNXA 3GWRA 2OWPA 5CF1A 3CNMA 2R4IA 3GZYB 3FH1A 3CPOA 4L8OA 2RCDA 1ISKA 2XSHB 5CLKA 2QGUA 5IEPA 1OGXA 3FGYA 4K1VA 5D82A 3OV4A 3FSDA 3OX9A 4HM2B 1JB2A 3GZBA 3Q90A 3G8ZA 4FCMA 4L7KA 4I4KA 3T8UA 2INXA 1JN5B 4HM3B 3OWUA 3NM2A 1HKXA 1OPYA 2PZVA 1JB5A 3NXJA 3B4PA 3T8NA 3OXAA 3ER7A 3E99A 5TGNA 3NV0B 1BUQA 3JUOA 1DMNA 1OUNA 3F8HA 5KP3A 5AIGA 2K54A 4GB5A 4HZBB 5DRVA 2HMKB 2CKFB 1OHOA 3EJVA 3FF2A 5STDA 4Q53A 1GY5A 2JQ5A 2YFIB 1O7MB 3WMDA 5IG4A 4OVMA 2UX0A 2HMNB 5IG0A 1O7HB 1IDPA 3G16A 3FKAA 4OUQA 1CQSA 4XB5A 2QIYA 1TP6A 3FF0A 4HM0B 1DMQA 1WQLB 2GXFA 3IPTA 4HM6B 3B8LA 3MG1A 3EC9A 1O7NB 4H3UA 5KP1A 3EX9A 3JUPA 4WP5A 3STDA 5KP4A 3K7CA 1OF5A 4STDA 1ZO2A 3NHXA 4R1KA 2BMQB 3GRDA 3MYTA 5AEWB 2HMOB 1OCVA 3JUNA 2HMJB 3B4OA 2GBXB 4R9LA 5AIHA 2YFLB 2GEXA 5IG3A 2BNGA 3FLJA 5CXOA 1K41A 4KVHA 5IEOA 1QMAA 3F7SA 3DXOA 3RGAA 4FCJA 3VSYA 2Z77A 3ECFA 2BMOB 1JKGA 3DMCA 3JUQA 3I0YA 1VZZA 1Q42A 5BVBA 5AEUB 4XDVA 1AR0A 4LEHA 3GZXB 4U13A 1OF5B 5G2GA 3D9RA 1EG9B 3MKIA 3SOAA 4J8TA 4J9AA 3VGNA 3MG2A 2STDA 4MJDA 2F86B 2A15A 5DREA 3B7CA 5IENA 3KZTA 3DZLA 1GY6A 3G0KA 2CHCA 3OWSA 2Z7AA 4XM4A 1E97A 2F99A 3EN1B 3H51A 4CDLA 1C7HA 2RFRA 2XR8B 4X2HA 5HGRA 3EN8A 1E3RA 1SJWA 1ZX2A 2I9WA 1OHSA 3ROBA 2Z76A 2W2CA 3OWYA 3DM8A 3HK4A 5CK6A 5D83A 3F7XA 5BXQA 4PEJA 5CF2A 4HM7B 7STDA 2GEYA 4HM8B 1O7PB 5IG5A 3BLZA 4HJLB 3DUKA 3EHCA 1W6YA 4X2OA 6STDA 3LYGA 3MHEA 1Z1SA 1JN5A 3KE7A 4WYKA 4HKVB 4N3VA 1NU3A 4XBYA 2YFJB 1W00A 2XSOB 3K0ZA 2XRXB 5IERA 5AIIA 3NUVA 1ASKA 1A2KA 3EBYA 3F14A 3SEDA 2BMRB 3F9SA 1UUVB 3HX8A 5EVHA 4HVNA 3EF8A 4XBTA 1Q40A 1O7GB 1STDA 4R9KA 1O7WB 8CHOA 1GYBA 1U5OA 1UUWB 2B1XB 3KKGA 3MG3A 4XBXA 1NWWA 3SOYA 3JUMA 4L8PA 4HZ9B 1OH0A 3M8CA 1GY7A 4WYKB 2RGQA 3LZAA 1DMMA 3BB9A 1JB4A 4XDWA 3MSOA 2HMMB 3NBRA 1E3VA 3H3HA 4HM4B 5JPPA 5AIFA 2HMLB 1GS3A 4K1UA 1Q40B 3F8XA 4WWUC 1JKGB 5D81A 1S5AA 1W02A 3F40A 3GZRA 1OGZA 4HM5B 5JPUA 1OHPA 1TUHA 5AI1A 3UNLA 4IIAA 5FW5A 3FZWA 4ORLA 2GBWB 3HZPA 3EQQB 2IMJA 4HM1B 1EA2A 2B24B
chains in the Genus database with same CATH superfamily
1ULJB 2F98A 2P0MA 1MGWA 2CFLA 5IF6A 1QAFA 1MWUA 4KFFA 4N6NB 1TRQA 1NDOB 3LXUX 3A76A 3EBTA 3LTDA 2C11A 4RZMA 2QEX3 1BAOA 1VQL3 1RGEA 3VF1A 4MMXB 4NHFA 1IT8A 1QJGA 3LOYA 1ULIB 2O9UX 3D5IA 3CU3A 1JJ22 2ML5A 1JNQA 3L0RA 3GAXA 4LMIA 4LGQA 2SBLA 2UUGC 1SIHA 2H0HA 1I0XA 3RGRA 3KSPA 2KF3A 2R41A 3AHSA 1W01A 2LYXA 2RSXA 3PS8A 1LOWA 1N9JA 2CFGA 1VQ43 4N6UA 3NV0A 1Q9EA 3UJMA 3S5CA 3CNXA 1YHQ3 1RNTA 2CFWA 3PYJA 1MNLA 1TRPA 3GWRA 4EBGA 1W7CA 2OWPA 3RDEA 3ZG5A 2KF5A 4EV2A 5CF1A 4N6V0 1RLSA 3CNMA 3CPW2 2R4IA 3GZYB 3FH1A 3CPOA 1PFPA 2IYJA 3EE1A 4CCVA 1FGRA 1FGMA 4L8OA 2RCDA 1ISKA 2XSHB 5CLKA 1RNBA 3IJEB 2QGUA 1WMOA 5JBSA 3AMOB 2CG0A 3S28A 3NM7A 5IEPA 4MEIA 2CWTA 2KXGA 1OGXA 3DGOA 3FGYA 4K1VA 3BIRA 5D82A 1TIJA 2ZA4A 3WODG 3OV4A 4AEQA 1B2XA 3FSDA 4DKIA 2AADA 3OX9A 4HM2B 1JB2A 3CME3 2W0QA 3UL6A 3GZBA 3Q90A 2XH9A 1B2MA 2E2VA 3BNDA 3G8ZA 2H0IA 1ROVA 1A2PA 5FGOA 1FUWA 2F5MA 1EKMA 4FCMA 1LOVA 4GL6A 3G6E3 1B2ZA 1YGWA 4L7KA 2F4YA 4I4KA 1D6YA 1I70A 4EV5A 1YJ93 3D5GA 2INXA 2BT3A 3T8UA 1I3IA 5G1LA 1JN5B 3AGOA 2CC3A 2XFSA 3HIGA 3OWUA 2BO9B 2CFKA 1HKXA 3NM2A 4HM3B 1K8A4 2MF7A 5AYSC 1OPYA 2OOVC 1CYUA 1YJN3 1BSEA 4AKYA 1G0TA 1EUIC 1RCKA 4MMYB 1Q814 2PZVA 1JB5A 1GOUA 3NXJA 2CH9A 1BOXA 7GSPA 3CC23 1BRKA 3B4PA 4LSOA 1RJOA 2CFDA 3T8NA 5GSPA 1B2UA 3OXAA 1LNIA 1IVUA 5AYRB 5M19A 3ER7A 4RBNA 3S67A 1QVF2 3E99A 3DY5A 4N6OB 1DE3A 3FG3A 5TGNA 2Y74A 3NV0B 3FG4A 1BUQA 2CX0A 3DGMA 3JUOA 1MOLA 1DMNA 3NQZA 1OUNA 3BNCA 3CCL3 1TTOA 1IYYA 3F8HA 5KP3A 5AIGA 1LRAA 1RN4A 2K54A 4IT7A 4TX4A 4BU4A 6RNTA 3CCU3 1RKYA 3A5EA 2WO0A 4GB5A 4HZBB 5DRVA 1UCKA 2CKFB 2HMKB 4WHAA 5LC6A 1VQK3 2RNTA 1BNRA 2W9QA 1Q7Y4 2C4BA 1OHOA 3EJVA 1RN7A 3DH2A 3FF2A 4BIRA 5LC7A 5STDA 1GY5A 4Q53A 3URPA 2E2TA 1JZOA 2JQ5A 2YFIB 1O7MB 1BIRA 1NB5I 1CH0A 3WMDA 2XF3A 5IG4A 4OVMA 2UX0A 3MWZA 2W03A 3QK9A 2HMNB 3HOHA 4J5GA 4KT3B 4FMDA 1VQ53 2CIUA 3DGYA 3CCV3 1VQO3 3CMA3 3RNTA 1BRIA 5IG0A 3G713 1O7HB 1IDPA 1W2ZA 2WGQA 2IUJA 3CCS3 2WGOA 1U8CB 3G16A 3FKAA 1G02A 4OUQA 1LQGC 1CQSA 1TU5A 1IV7A 4N6TA 2P05A 1RHLA 4XB5A 2QIYA 1TP6A 1BNJA 1IVWA 2CX1A 3FF0A 4HM0B 1DMQA 1NO3A 2L1SA 1WQLB 2GXFA 2XGNA 3IPTA 4LYLB 3WA3A 1UI8A 4HM6B 1IQXA 2KAAA 5M1AA 3MPHA 1LNHA 3B8LA 3MG1A 1WTHA 3EC9A 1O7NB 3QRDA 1D6UA 4RNZA 3X3ZA 5A0OB 3CD63 2GU3A 4HYZA 4H3UA 1L5GB 1FGTA 5KP1A 2LQVA 3EX9A 3JUPA 3N8BA 4WP5A 3STDA 1GMPA 5KP4A 3CCQ3 3FCSB 3K7CA 1B27A 1Q864 1BRSA 3KSED 1OF5A 1STFI 1ZO2A 2XFTA 3NHXA 3Q3FA 4STDA 4EYCA 1IK3A 3WR2A 2KF4A 1N9EA 4R1KA 1R4CA 2BMQB 1VQ83 3GRDA 4O2HA 1WNHA 1TJDA 1HU9A 3EB8A 3MYTA 2KRTA 2HOHA 2Y73A 5AEWB 3AGNA 1T2IA 2HMOB 1OCVA 4J5KA 1RN1A 1HZ1A 2J8XB 1WMPA 1TFOA 3JUNA 1OACA 2HMJB 1C54A 1CYVA 3LH4A 1T3BA 1BRJA 3LTBA 3B4OA 3SYUA 1T5YA 2GBXB 2OQEC 4R9LA 5AIHA 2YFLB 1CEWI 3LT9A 2FXTA 2GEXA 1N5HA 4GSPA 3DGLA 5IG3A 1FYSA 2BNGA 3IMAB 5G1KA 3CCM3 1UGIA 3FLJA 5CXOA 1V58A 2Q07A 3UL5A 1K41A 4G1MB 1N5PA 1MWRA 2UGIA 1BRHA 4KVHA 4H61A 5IEOA 1LOXA 1FUTA 1JRQA 3NQYA 4MMZB 1KC84 3N9HA 4BTYA 1VQM3 1M904 1MGRA 2K0MA 1QMAA 3O8YA 3F7SA 3FG1A 3HIIA 1DYUA 1SQWA 3DXOA 1GMQA 2QA43 1JBSA 4CPKA 3I563 1X1UA 4I5QA 3NBBA 3RGAA 2ZDJA 1I2FA 2WOFA 4FCJA 4HBRA 3VSYA 4BTWA 3ZG0A 1MWTA 1SPUA 2Z77A 3ECFA 1M1XB 2BMOB 1GSPA 2F56A 3PXMA 3WHOA 1JKGA 2OTJ3 3DMCA 1BSCA 1GD3A 5EQLA 3JUQA 3I0YA 3X41A 1GMRA 1VZZA 7RNTA 1Q42A 5BVBA 5AEUB 4XDVA 1AR0A 4LEHA 3GZXB 4U13A 3HI7A 1OF5B 3I553 5G2GA 3WOFB 1RGFA 3D9RA 4EC6A 1Q824 5HOHA 1EG9B 3CC73 3MKIA 3U97A 3SOAA 4J8TA 4J9AA 1B3SA 1BRNL 3Q1CA 2XEPA 3VGNA 1PY3A 3D3LA 3MG2A 2E2UA 3KIIA 4O02B 4FMBA 4NPBA 2STDA 4MJDA 1IQ8A 4K61A 2F86B 1X1YA 4AKZA 3BU4A 4JF8A 1M9GA 2A15A 1Y4KA 3PCSA 1KSIA 1T2HA 1SIIA 1JBTA 2IY2A 1W6CA 3B7CA 5DREA 5IENA 3S29A 4BTXA 1RGAA 3SXXA 2KCDA 2W04A 4R4KA 3KZTA 1M1K4 5M18A 1NB3I 1IQYA 1KD14 4QWTA 3DZLA 1BNEA 3WOEB 1HYFA 1BUJA 1GY6A 1W5ZA 2XGLA 3CC43 9RNTA 3G0KA 1BU4A 1YGEA 2CHCA 3OWSA 2ZL8A 2Z7AA 4FMCA 2C10A 1I0VA 3K9MC 3WA2X 2O3OA 2P38A 4XM4A 2OOVA 1BNGA 1E97A 2CW9A 2F99A 1K28A 3EN1B 1C7HA 3H51A 4CDLA 4ZM8A 1UDII 2RFRA 1B20A 2XR8B 4LZIA 4X2HA 2P0XA 2IA7A 1AV4A 3BNEA 5HGRA 1F8NA 1FW7A 3TDGA 1N8R4 3EN8A 4FMAA 1E3RA 1RGGA 1SJWA 1ZX2A 2I9WA 1OHSA 3K63A 2BHMA 3ROBA 2Z76A 3NBJA 4OK0A 1V57A 2W2CA 2JDIH 1MWSA 2ZHXB 3LMLA 3OWYA 4NREA 2FNQA 3SX1A 1YVSA 3DM8A 3HK4A 2IUKA 1PU4A 1A2VA 4K90B 5CK6A 1LQMB 5D83A 1W6GA 3CXC2 1YIT3 1RGCA 1UI7A 1NJI4 3F7XA 1BANA 1BRGA 3V99A 5BXQA 4PEJA 5BIRA 5CF2A 4HM7B 7STDA 2GEYA 4HM8B 1O7PB 5IG5A 3BLZA 4HJLB 4KFDA 2RBIA 3DUKA 3EHCA 1WMNA 3X3XA 5I97A 1IT7A 2BIRA 1W6YA 1GOVA 4X2OA 3LYGA 3MHEA 3X42A 6STDA 3CCJ3 5EEOA 3PCRA 2BU4A 1DVCA 1LXEA 1Z1SA 1JN5A 1QALA 3KE7A 3X3YA 4EXRA 1VQN3 2KF6A 4WYKA 1I8VA 3D4AA 3UB1A 4HKVB 4N3VA 1S723 1YJW3 1IV9A 4IPBA 1NU3A 4JRFA 1UCLA 2D1WA 1UGHI 4XBYA 2MC8A 1IVVA 2YFJB 1BSDA 1RRLA 4EW5A 1YIJ3 1W2B2 2H0GA 1YI23 1W00A 2XSOB 1UCJA 1RGHA 1NNVA 5BU4A 3K0ZA 2XRXB 1B21A 5IERA 5AIIA 1UUGB 1FUSA 2L4VA 4BL2A 3T0UA 3NUVA 1EQKA 1ASKA 4WFOA 1A2KA 3EBYA 3U1WA 2D42A 1DVDA 1IU7A 4RNTA 4FCZA 1QAKA 1KQS2 3F14A 4KZ1A 1DETA 1IVXA 3SEDA 1BNFA 3ALAA 2BMRB 2Z6BA 1UUVB 3F9SA 3HX8A 4R80A 5EVHA 1VQQA 4HVNA 4FR9A 3EF8A 1RGLA 2F5WA 3KN4A 4XBTA 1Q40A 1AQZA 1BVIA 1YNVX 1O7GB 1RTUA 1STDA 1A67A 1TFKA 3DGNA 1BGSA 4R9KA 3J7Yd 5RNTA 4O8SA 1PYLA 1RRHA 1VQ73 1Q7HA 3GSPA 4N6MA 1O7WB 1ZGXA 4HAAA 3BNBA 8CHOA 1GYBA 1GD4A 1U5OA 1RMSA 1UUWB 3ZFZA 2B1XB 3KKGA 2K3DA 3MG3A 1BSBA 2W6JH 1V74A 3N54B 1NWWA 4XBXA 3LTCA 1RSNA 3SOYA 1K9M4 1AVLA 2YX9A 3JUMA 3KCHA 1I3FA 4L8PA 3KFQC 3S27A 3G4S3 1J2BA 4HZ9B 1FGOA 2OQEA 1UW1A 2V1LA 3Q2PA 1OH0A 3M8CA 5ELUA 1GY7A 1RDSA 3OW22 2W56A 2OCTA 4WYKB 2RGQA 1K734 3SLUA 3LZAA 1DMMA 2W9PA 3AHWA 3BB9A 4N6LA 1JB4A 2M7OA 2WOHA 2GU1A 3LTAA 4XDWA 4CJNA 3MSOA 1LOYA 1US1A 2HMMB 3NBRA 3CCE3 1EEJA 1ZS7A 3V98A 1W4NA 4ILFA 1UCIA 1E3VA 1BNSA 1BSAA 3H3HA 8RNTA 4HM4B 1LVNA 5JPPA 2SARA 1N8QA 2ML6A 1VQ93 5AIFA 1X1XA 1JBRA 1FA3A 2CK3H 2HMLB 2GSPA 1GS3A 1KWIA 4KFEA 3V92A 1RGKA 4GHOA 2CG1A 5IW9A 2FGTA 3JVCA 4K1UA 1Q40B 1I2GA 3F8XA 1JZDA 1SARA 4WWUC 1JKGB 2AAEA 1BNIA 1FGQA 5D81A 1QVG2 1S5AA 2CWVA 3NX0A 4RNYA 1W02A 1YVBI 3F40A 2PNCA 4HOHA 1FZUA 1R4YA 1X1WA 1OGZA 3GZRA 4HM5B 3X40A 5JPUA 1GOYA 1OHPA 1VQ63 1A90A 1ROAA 3AMOA 3D79A 1I2EA 4BL3A 1TUHA 3PGBA 5AI1A 3UNLA 6GSPA 1G96A 4IIAA 1RCLA 5FW5A 3K5TA 5ELJA 3CCR3 3FZWA 1JV2B 4ORLA 1AY7A 2GBWB 1AVKA 3LT8A 3HZPA 3EQQB 2IMJA 4HM1B 1EA2A 1VQP3 1B2SA 2P09A 3WDGB 2OTL3 2W56B 2B24B 2CWUA 3PZWA 4O3VA 3SVAA 1D6ZA
chains in the Genus database with same CATH topology
1ULJB 2F98A 2P0MA 2CFLA 5IF6A 1QAFA 4KFFA 4N6NB 1NDOB 3LXUX 3A76A 3EBTA 3LTDA 2C11A 4RZMA 2QEX3 1VQL3 3VF1A 4MMXB 4NHFA 1IT8A 1QJGA 3LOYA 1ULIB 2O9UX 1JJ22 3CU3A 2ML5A 1JNQA 3L0RA 3GAXA 4LMIA 4LGQA 2SBLA 1SIHA 3RGRA 3KSPA 1W01A 2LYXA 2RSXA 3PS8A 1N9JA 2CFGA 1VQ43 4N6UA 3NV0A 3UJMA 3S5CA 3CNXA 1YHQ3 2CFWA 3PYJA 1MNLA 3GWRA 4EBGA 1W7CA 2OWPA 3RDEA 4EV2A 5CF1A 4N6V0 3CNMA 3CPW2 2R4IA 3GZYB 3FH1A 3CPOA 1PFPA 3EE1A 4CCVA 1FGRA 1FGMA 4L8OA 2RCDA 1ISKA 2XSHB 5CLKA 3IJEB 2QGUA 1WMOA 5JBSA 3AMOB 2CG0A 3S28A 3NM7A 5IEPA 4MEIA 2CWTA 2KXGA 1OGXA 3DGOA 3FGYA 4K1VA 5D82A 1TIJA 3WODG 3OV4A 4AEQA 3FSDA 3OX9A 4HM2B 1JB2A 3CME3 2W0QA 3UL6A 3GZBA 3Q90A 2XH9A 2E2VA 3BNDA 3G8ZA 1ROVA 5FGOA 1FUWA 1EKMA 4FCMA 4GL6A 3G6E3 4L7KA 4EV5A 1YJ93 4I4KA 1D6YA 3T8UA 2INXA 2BT3A 1JN5B 2CC3A 2XFSA 3HIGA 3OWUA 2BO9B 2CFKA 1HKXA 3NM2A 4HM3B 1K8A4 2MF7A 5AYSC 1OPYA 2OOVC 1CYUA 1YJN3 4AKYA 4MMYB 1Q814 2PZVA 1JB5A 3NXJA 2CH9A 3CC23 3B4PA 4LSOA 1RJOA 2CFDA 3T8NA 3OXAA 1IVUA 5AYRB 3ER7A 4RBNA 3S67A 1QVF2 3E99A 3DY5A 4N6OB 3FG3A 5TGNA 2Y74A 3NV0B 3FG4A 1BUQA 3DGMA 3JUOA 1MOLA 1DMNA 3NQZA 1OUNA 3BNCA 3CCL3 3F8HA 5KP3A 5AIGA 2K54A 4IT7A 4TX4A 3CCU3 1RKYA 4GB5A 2WO0A 4HZBB 1J2BA 5DRVA 2HMKB 2CKFB 4WHAA 5LC6A 1VQK3 2W9QA 1Q7Y4 1OHOA 3EJVA 1RN7A 3FF2A 5LC7A 5STDA 1GY5A 4Q53A 2E2TA 2JQ5A 2YFIB 1O7MB 1NB5I 3WMDA 2XF3A 5IG4A 4OVMA 2UX0A 3MWZA 2W03A 3QK9A 2HMNB 1VQ53 4FMDA 2CIUA 1VQO3 3CCV3 3CMA3 5IG0A 3G713 1O7HB 1IDPA 1W2ZA 2WGQA 2IUJA 3CCS3 2WGOA 1U8CB 3G16A 3FKAA 4OUQA 1CQSA 1TU5A 1IV7A 4N6TA 2P05A 4XB5A 2QIYA 1TP6A 1IVWA 3FF0A 4HM0B 1DMQA 1NO3A 1WQLB 2GXFA 2XGNA 3IPTA 3WA3A 1UI8A 4HM6B 1IQXA 3MPHA 1LNHA 3B8LA 3MG1A 1WTHA 3EC9A 1O7NB 3QRDA 1D6UA 4RNZA 3X3ZA 5A0OB 3CD63 2GU3A 4HYZA 4H3UA 1L5GB 1FGTA 5KP1A 2LQVA 3EX9A 3JUPA 3N8BA 4WP5A 3STDA 5KP4A 3CCQ3 3FCSB 3K7CA 1Q864 3KSED 1OF5A 1STFI 1ZO2A 2XFTA 3NHXA 4STDA 1IK3A 4EYCA 1N9EA 4R1KA 1R4CA 2BMQB 1VQ83 3GRDA 4O2HA 1WNHA 3MYTA 1HU9A 3EB8A 2KRTA 2Y73A 5AEWB 2HMOB 1OCVA 1WMPA 1TFOA 3JUNA 1OACA 2HMJB 1CYVA 3LH4A 3LTBA 3B4OA 1T5YA 2GBXB 2OQEC 4R9LA 5AIHA 2YFLB 1CEWI 3LT9A 2FXTA 2GEXA 1N5HA 3DGLA 5IG3A 2BNGA 3IMAB 3CCM3 3FLJA 5CXOA 2Q07A 3UL5A 1K41A 4G1MB 1N5PA 4KVHA 5IEOA 4H61A 1LOXA 1JRQA 3NQYA 4MMZB 1KC84 3N9HA 4BTYA 1VQM3 1M904 2K0MA 1QMAA 3O8YA 3F7SA 3FG1A 3HIIA 1DYUA 1SQWA 3DXOA 2QA43 3I563 3NBBA 3RGAA 2ZDJA 4FCJA 2WOFA 4HBRA 3VSYA 4BTWA 1SPUA 2Z77A 3ECFA 1M1XB 2BMOB 3PXMA 1JKGA 2OTJ3 3DMCA 1GD3A 5EQLA 3JUQA 3I0YA 3X41A 1VZZA 1Q42A 5BVBA 5AEUB 4XDVA 1AR0A 4LEHA 3GZXB 4U13A 3HI7A 1OF5B 3I553 5G2GA 3WOFB 3D9RA 4EC6A 1Q824 1EG9B 3CC73 3MKIA 3U97A 3SOAA 4J8TA 4J9AA 3Q1CA 2XEPA 3VGNA 3D3LA 3MG2A 2E2UA 3KIIA 4O02B 4FMBA 2STDA 4MJDA 1IQ8A 4K61A 2F86B 4AKZA 4JF8A 1M9GA 2A15A 1Y4KA 3PCSA 1KSIA 1SIIA 1W6CA 3B7CA 5DREA 5IENA 3S29A 4BTXA 3SXXA 2KCDA 2W04A 4R4KA 3KZTA 1M1K4 1NB3I 1IQYA 4QWTA 3DZLA 3WOEB 1GY6A 1W5ZA 2XGLA 3CC43 3G0KA 1YGEA 2CHCA 3OWSA 2ZL8A 2Z7AA 4FMCA 2C10A 3K9MC 3WA2X 2O3OA 2P38A 4XM4A 2OOVA 1E97A 2CW9A 2F99A 1K28A 3EN1B 1C7HA 3H51A 4CDLA 4ZM8A 2RFRA 2XR8B 4LZIA 4X2HA 2P0XA 2IA7A 1AV4A 3BNEA 5HGRA 1F8NA 3TDGA 1N8R4 3EN8A 4FMAA 1E3RA 1SJWA 1ZX2A 2I9WA 1OHSA 3K63A 2BHMA 3ROBA 2Z76A 3NBJA 4OK0A 2W2CA 2JDIH 3OWYA 3LMLA 4NREA 2FNQA 3SX1A 3DM8A 3HK4A 2IUKA 1PU4A 1A2VA 4K90B 5CK6A 5D83A 1W6GA 3CXC2 1YIT3 1UI7A 1NJI4 3F7XA 3V99A 5BXQA 4PEJA 5CF2A 4HM7B 7STDA 2GEYA 4HM8B 1O7PB 5IG5A 3BLZA 4HJLB 4KFDA 3DUKA 3EHCA 1WMNA 3X3XA 5I97A 1IT7A 1W6YA 4X2OA 3X42A 3LYGA 3MHEA 6STDA 3CCJ3 5EEOA 3PCRA 1KD14 1DVCA 1LXEA 1Z1SA 1JN5A 1QALA 3KE7A 3X3YA 4EXRA 1VQN3 4WYKA 3UB1A 4HKVB 4N3VA 1S723 1YJW3 1IV9A 4IPBA 1NU3A 4JRFA 2D1WA 2MC8A 4XBYA 1IVVA 2YFJB 1RRLA 1YIJ3 1W2B2 1YI23 1W00A 2XSOB 3K0ZA 2XRXB 5IERA 5AIIA 2L4VA 3T0UA 3NUVA 1EQKA 1ASKA 4WFOA 1A2KA 3EBYA 3U1WA 2D42A 1DVDA 1IU7A 4FCZA 1QAKA 1KQS2 3F14A 4KZ1A 1IVXA 3SEDA 3ALAA 2BMRB 2Z6BA 1UUVB 3F9SA 3HX8A 4R80A 5EVHA 4HVNA 4FR9A 3EF8A 3KN4A 4XBTA 1Q40A 1O7GB 1STDA 1A67A 1TFKA 3DGNA 4R9KA 3J7Yd 4O8SA 1RRHA 1VQ73 4N6MA 1O7WB 3BNBA 8CHOA 1GYBA 1GD4A 1U5OA 1UUWB 2B1XB 3KKGA 3MG3A 2W6JH 1V74A 3N54B 1NWWA 4XBXA 3LTCA 3SOYA 1K9M4 1AVLA 2YX9A 3JUMA 3S27A 4L8PA 3KFQC 3G4S3 4HZ9B 1FGOA 2OQEA 1UW1A 2V1LA 3Q2PA 1OH0A 3M8CA 5ELUA 1GY7A 3OW22 2W56A 2OCTA 4WYKB 2RGQA 1K734 3SLUA 3LZAA 1DMMA 2W9PA 3BB9A 4N6LA 1JB4A 2M7OA 2WOHA 2GU1A 3LTAA 4XDWA 3MSOA 1US1A 2HMMB 3NBRA 3CCE3 3V98A 1W4NA 1E3VA 3H3HA 4HM4B 1LVNA 5JPPA 1N8QA 2ML6A 1VQ93 5AIFA 1FA3A 2CK3H 2HMLB 1GS3A 1KWIA 4KFEA 3V92A 2CG1A 5IW9A 2FGTA 3JVCA 4K1UA 1Q40B 3F8XA 4WWUC 1JKGB 5D81A 1FGQA 1QVG2 1S5AA 2CWVA 3NX0A 4RNYA 1W02A 1YVBI 3F40A 2PNCA 3GZRA 1OGZA 4HM5B 3X40A 5JPUA 1VQ63 1OHPA 1A90A 1ROAA 3AMOA 1TUHA 3PGBA 5AI1A 3UNLA 1G96A 4IIAA 5FW5A 3K5TA 5ELJA 3CCR3 3FZWA 1JV2B 4ORLA 2GBWB 1AVKA 3LT8A 3HZPA 3EQQB 2IMJA 4HM1B 1EA2A 1VQP3 2P09A 3WDGB 2OTL3 2W56B 2B24B 2CWUA 3PZWA 4O3VA 3SVAA 1D6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULJ B;  2F98 A;  5IF6 A;  1NDO B;  3A76 A;  3EBT A;  4RZM A;  1QJG A;  1ULI B;  3CU3 A;  4LMI A;  4LGQ A;  3RGR A;  3KSP A;  1W01 A;  3NV0 A;  3UJM A;  3S5C A;  3CNX A;  3GWR A;  2OWP A;  5CF1 A;  3CNM A;  2R4I A;  3GZY B;  3FH1 A;  3CPO A;  4L8O A;  2RCD A;  1ISK A;  2XSH B;  5CLK A;  2QGU A;  5IEP A;  1OGX A;  3FGY A;  4K1V A;  5D82 A;  3OV4 A;  3FSD A;  3OX9 A;  4HM2 B;  1JB2 A;  3GZB A;  3Q90 A;  3G8Z A;  4FCM A;  4L7K A;  4I4K A;  3T8U A;  2INX A;  1JN5 B;  4HM3 B;  3OWU A;  3NM2 A;  1HKX A;  1OPY A;  2PZV A;  1JB5 A;  3NXJ A;  3B4P A;  3T8N A;  3OXA A;  3ER7 A;  3E99 A;  5TGN A;  3NV0 B;  1BUQ A;  3JUO A;  1DMN A;  1OUN A;  3F8H A;  5KP3 A;  5AIG A;  2K54 A;  4GB5 A;  4HZB B;  5DRV A;  2HMK B;  2CKF B;  1OHO A;  3EJV A;  3FF2 A;  5STD A;  4Q53 A;  1GY5 A;  2JQ5 A;  2YFI B;  1O7M B;  3WMD A;  5IG4 A;  4OVM A;  2UX0 A;  2HMN B;  5IG0 A;  1O7H B;  1IDP A;  3G16 A;  3FKA A;  4OUQ A;  1CQS A;  4XB5 A;  2QIY A;  1TP6 A;  3FF0 A;  4HM0 B;  1DMQ A;  1WQL B;  2GXF A;  3IPT A;  4HM6 B;  3B8L A;  3MG1 A;  3EC9 A;  1O7N B;  4H3U A;  5KP1 A;  3EX9 A;  3JUP A;  4WP5 A;  3STD A;  5KP4 A;  3K7C A;  1OF5 A;  4STD A;  1ZO2 A;  3NHX A;  4R1K A;  2BMQ B;  3GRD A;  3MYT A;  5AEW B;  2HMO B;  1OCV A;  3JUN A;  2HMJ B;  3B4O A;  2GBX B;  4R9L A;  5AIH A;  2YFL B;  2GEX A;  5IG3 A;  2BNG A;  3FLJ A;  5CXO A;  1K41 A;  4KVH A;  5IEO A;  1QMA A;  3F7S A;  3DXO A;  3RGA A;  4FCJ A;  3VSY A;  2Z77 A;  3ECF A;  2BMO B;  1JKG A;  3DMC A;  3JUQ A;  3I0Y A;  1VZZ A;  1Q42 A;  5BVB A;  5AEU B;  4XDV A;  1AR0 A;  4LEH A;  3GZX B;  4U13 A;  1OF5 B;  5G2G A;  3D9R A;  1EG9 B;  3MKI A;  3SOA A;  4J8T A;  4J9A A;  3VGN A;  3MG2 A;  2STD A;  4MJD A;  2F86 B;  2A15 A;  5DRE A;  3B7C A;  5IEN A;  3KZT A;  3DZL A;  1GY6 A;  3G0K A;  2CHC A;  3OWS A;  2Z7A A;  4XM4 A;  1E97 A;  2F99 A;  3EN1 B;  3H51 A;  4CDL A;  1C7H A;  2RFR A;  2XR8 B;  4X2H A;  5HGR A;  3EN8 A;  1E3R A;  1SJW A;  1ZX2 A;  2I9W A;  1OHS A;  3ROB A;  2Z76 A;  2W2C A;  3OWY A;  3DM8 A;  3HK4 A;  5CK6 A;  5D83 A;  3F7X A;  5BXQ A;  4PEJ A;  5CF2 A;  4HM7 B;  7STD A;  2GEY A;  4HM8 B;  1O7P B;  5IG5 A;  3BLZ A;  4HJL B;  3DUK A;  3EHC A;  1W6Y A;  4X2O A;  6STD A;  3LYG A;  3MHE A;  1Z1S A;  1JN5 A;  3KE7 A;  4WYK A;  4HKV B;  4N3V A;  1NU3 A;  4XBY A;  2YFJ B;  1W00 A;  2XSO B;  3K0Z A;  2XRX B;  5IER A;  5AII A;  3NUV A;  1ASK A;  1A2K A;  3EBY A;  3F14 A;  3SED A;  2BMR B;  3F9S A;  1UUV B;  3HX8 A;  5EVH A;  4HVN A;  3EF8 A;  4XBT A;  1Q40 A;  1O7G B;  1STD A;  4R9K A;  1O7W B;  8CHO A;  1GYB A;  1U5O A;  1UUW B;  2B1X B;  3KKG A;  3MG3 A;  4XBX A;  1NWW A;  3SOY A;  3JUM A;  4L8P A;  4HZ9 B;  1OH0 A;  3M8C A;  1GY7 A;  4WYK B;  2RGQ A;  3LZA A;  1DMM A;  3BB9 A;  1JB4 A;  4XDW A;  3MSO A;  2HMM B;  3NBR A;  1E3V A;  3H3H A;  4HM4 B;  5JPP A;  5AIF A;  2HML B;  1GS3 A;  4K1U A;  1Q40 B;  3F8X A;  4WWU C;  1JKG B;  5D81 A;  1S5A A;  1W02 A;  3F40 A;  3GZR A;  1OGZ A;  4HM5 B;  5JPU A;  1OHP A;  1TUH A;  5AI1 A;  3UNL A;  4IIA A;  5FW5 A;  3FZW A;  4ORL A;  2GBW B;  3HZP A;  3EQQ B;  2IMJ A;  4HM1 B;  1EA2 A;  2B24 B; 
#chains in the Genus database with same CATH topology
 1ULJ B;  2F98 A;  2P0M A;  1MGW A;  2CFL A;  5IF6 A;  1QAF A;  1MWU A;  4KFF A;  4N6N B;  1TRQ A;  1NDO B;  3LXU X;  3A76 A;  3EBT A;  3LTD A;  2C11 A;  4RZM A;  2QEX 3;  1BAO A;  1VQL 3;  1RGE A;  3VF1 A;  4MMX B;  4NHF A;  1IT8 A;  1QJG A;  3LOY A;  1ULI B;  2O9U X;  3D5I A;  3CU3 A;  1JJ2 2;  2ML5 A;  1JNQ A;  3L0R A;  3GAX A;  4LMI A;  4LGQ A;  2SBL A;  2UUG C;  1SIH A;  2H0H A;  1I0X A;  3RGR A;  3KSP A;  2KF3 A;  2R41 A;  3AHS A;  1W01 A;  2LYX A;  2RSX A;  3PS8 A;  1LOW A;  1N9J A;  2CFG A;  1VQ4 3;  4N6U A;  3NV0 A;  1Q9E A;  3UJM A;  3S5C A;  3CNX A;  1YHQ 3;  1RNT A;  2CFW A;  3PYJ A;  1MNL A;  1TRP A;  3GWR A;  4EBG A;  1W7C A;  2OWP A;  3RDE A;  3ZG5 A;  2KF5 A;  4EV2 A;  5CF1 A;  4N6V 0;  1RLS A;  3CNM A;  3CPW 2;  2R4I A;  3GZY B;  3FH1 A;  3CPO A;  1PFP A;  2IYJ A;  3EE1 A;  4CCV A;  1FGR A;  1FGM A;  4L8O A;  2RCD A;  1ISK A;  2XSH B;  5CLK A;  1RNB A;  3IJE B;  2QGU A;  1WMO A;  5JBS A;  3AMO B;  2CG0 A;  3S28 A;  3NM7 A;  5IEP A;  4MEI A;  2CWT A;  2KXG A;  1OGX A;  3DGO A;  3FGY A;  4K1V A;  3BIR A;  5D82 A;  1TIJ A;  2ZA4 A;  3WOD G;  3OV4 A;  4AEQ A;  1B2X A;  3FSD A;  4DKI A;  2AAD A;  3OX9 A;  4HM2 B;  1JB2 A;  3CME 3;  2W0Q A;  3UL6 A;  3GZB A;  3Q90 A;  2XH9 A;  1B2M A;  2E2V A;  3BND A;  3G8Z A;  2H0I A;  1ROV A;  1A2P A;  5FGO A;  1FUW A;  2F5M A;  1EKM A;  4FCM A;  1LOV A;  4GL6 A;  3G6E 3;  1B2Z A;  1YGW A;  4L7K A;  2F4Y A;  4I4K A;  1D6Y A;  1I70 A;  4EV5 A;  1YJ9 3;  3D5G A;  2INX A;  2BT3 A;  3T8U A;  1I3I A;  5G1L A;  1JN5 B;  3AGO A;  2CC3 A;  2XFS A;  3HIG A;  3OWU A;  2BO9 B;  2CFK A;  1HKX A;  3NM2 A;  4HM3 B;  1K8A 4;  2MF7 A;  5AYS C;  1OPY A;  2OOV C;  1CYU A;  1YJN 3;  1BSE A;  4AKY A;  1G0T A;  1EUI C;  1RCK A;  4MMY B;  1Q81 4;  2PZV A;  1JB5 A;  1GOU A;  3NXJ A;  2CH9 A;  1BOX A;  7GSP A;  3CC2 3;  1BRK A;  3B4P A;  4LSO A;  1RJO A;  2CFD A;  3T8N A;  5GSP A;  1B2U A;  3OXA A;  1LNI A;  1IVU A;  5AYR B;  5M19 A;  3ER7 A;  4RBN A;  3S67 A;  1QVF 2;  3E99 A;  3DY5 A;  4N6O B;  1DE3 A;  3FG3 A;  5TGN A;  2Y74 A;  3NV0 B;  3FG4 A;  1BUQ A;  2CX0 A;  3DGM A;  3JUO A;  1MOL A;  1DMN A;  3NQZ A;  1OUN A;  3BNC A;  3CCL 3;  1TTO A;  1IYY A;  3F8H A;  5KP3 A;  5AIG A;  1LRA A;  1RN4 A;  2K54 A;  4IT7 A;  4TX4 A;  4BU4 A;  6RNT A;  3CCU 3;  1RKY A;  3A5E A;  2WO0 A;  4GB5 A;  4HZB B;  5DRV A;  1UCK A;  2CKF B;  2HMK B;  4WHA A;  5LC6 A;  1VQK 3;  2RNT A;  1BNR A;  2W9Q A;  1Q7Y 4;  2C4B A;  1OHO A;  3EJV A;  1RN7 A;  3DH2 A;  3FF2 A;  4BIR A;  5LC7 A;  5STD A;  1GY5 A;  4Q53 A;  3URP A;  2E2T A;  1JZO A;  2JQ5 A;  2YFI B;  1O7M B;  1BIR A;  1NB5 I;  1CH0 A;  3WMD A;  2XF3 A;  5IG4 A;  4OVM A;  2UX0 A;  3MWZ A;  2W03 A;  3QK9 A;  2HMN B;  3HOH A;  4J5G A;  4KT3 B;  4FMD A;  1VQ5 3;  2CIU A;  3DGY A;  3CCV 3;  1VQO 3;  3CMA 3;  3RNT A;  1BRI A;  5IG0 A;  3G71 3;  1O7H B;  1IDP A;  1W2Z A;  2WGQ A;  2IUJ A;  3CCS 3;  2WGO A;  1U8C B;  3G16 A;  3FKA A;  1G02 A;  4OUQ A;  1LQG C;  1CQS A;  1TU5 A;  1IV7 A;  4N6T A;  2P05 A;  1RHL A;  4XB5 A;  2QIY A;  1TP6 A;  1BNJ A;  1IVW A;  2CX1 A;  3FF0 A;  4HM0 B;  1DMQ A;  1NO3 A;  2L1S A;  1WQL B;  2GXF A;  2XGN A;  3IPT A;  4LYL B;  3WA3 A;  1UI8 A;  4HM6 B;  1IQX A;  2KAA A;  5M1A A;  3MPH A;  1LNH A;  3B8L A;  3MG1 A;  1WTH A;  3EC9 A;  1O7N B;  3QRD A;  1D6U A;  4RNZ A;  3X3Z A;  5A0O B;  3CD6 3;  2GU3 A;  4HYZ A;  4H3U A;  1L5G B;  1FGT A;  5KP1 A;  2LQV A;  3EX9 A;  3JUP A;  3N8B A;  4WP5 A;  3STD A;  1GMP A;  5KP4 A;  3CCQ 3;  3FCS B;  3K7C A;  1B27 A;  1Q86 4;  1BRS A;  3KSE D;  1OF5 A;  1STF I;  1ZO2 A;  2XFT A;  3NHX A;  3Q3F A;  4STD A;  4EYC A;  1IK3 A;  3WR2 A;  2KF4 A;  1N9E A;  4R1K A;  1R4C A;  2BMQ B;  1VQ8 3;  3GRD A;  4O2H A;  1WNH A;  1TJD A;  1HU9 A;  3EB8 A;  3MYT A;  2KRT A;  2HOH A;  2Y73 A;  5AEW B;  3AGN A;  1T2I A;  2HMO B;  1OCV A;  4J5K A;  1RN1 A;  1HZ1 A;  2J8X B;  1WMP A;  1TFO A;  3JUN A;  1OAC A;  2HMJ B;  1C54 A;  1CYV A;  3LH4 A;  1T3B A;  1BRJ A;  3LTB A;  3B4O A;  3SYU A;  1T5Y A;  2GBX B;  2OQE C;  4R9L A;  5AIH A;  2YFL B;  1CEW I;  3LT9 A;  2FXT A;  2GEX A;  1N5H A;  4GSP A;  3DGL A;  5IG3 A;  1FYS A;  2BNG A;  3IMA B;  5G1K A;  3CCM 3;  1UGI A;  3FLJ A;  5CXO A;  1V58 A;  2Q07 A;  3UL5 A;  1K41 A;  4G1M B;  1N5P A;  1MWR A;  2UGI A;  1BRH A;  4KVH A;  4H61 A;  5IEO A;  1LOX A;  1FUT A;  1JRQ A;  3NQY A;  4MMZ B;  1KC8 4;  3N9H A;  4BTY A;  1VQM 3;  1M90 4;  1MGR A;  2K0M A;  1QMA A;  3O8Y A;  3F7S A;  3FG1 A;  3HII A;  1DYU A;  1SQW A;  3DXO A;  1GMQ A;  2QA4 3;  1JBS A;  4CPK A;  3I56 3;  1X1U A;  4I5Q A;  3NBB A;  3RGA A;  2ZDJ A;  1I2F A;  2WOF A;  4FCJ A;  4HBR A;  3VSY A;  4BTW A;  3ZG0 A;  1MWT A;  1SPU A;  2Z77 A;  3ECF A;  1M1X B;  2BMO B;  1GSP A;  2F56 A;  3PXM A;  3WHO A;  1JKG A;  2OTJ 3;  3DMC A;  1BSC A;  1GD3 A;  5EQL A;  3JUQ A;  3I0Y A;  3X41 A;  1GMR A;  1VZZ A;  7RNT A;  1Q42 A;  5BVB A;  5AEU B;  4XDV A;  1AR0 A;  4LEH A;  3GZX B;  4U13 A;  3HI7 A;  1OF5 B;  3I55 3;  5G2G A;  3WOF B;  1RGF A;  3D9R A;  4EC6 A;  1Q82 4;  5HOH A;  1EG9 B;  3CC7 3;  3MKI A;  3U97 A;  3SOA A;  4J8T A;  4J9A A;  1B3S A;  1BRN L;  3Q1C A;  2XEP A;  3VGN A;  1PY3 A;  3D3L A;  3MG2 A;  2E2U A;  3KII A;  4O02 B;  4FMB A;  4NPB A;  2STD A;  4MJD A;  1IQ8 A;  4K61 A;  2F86 B;  1X1Y A;  4AKZ A;  3BU4 A;  4JF8 A;  1M9G A;  2A15 A;  1Y4K A;  3PCS A;  1KSI A;  1T2H A;  1SII A;  1JBT A;  2IY2 A;  1W6C A;  3B7C A;  5DRE A;  5IEN A;  3S29 A;  4BTX A;  1RGA A;  3SXX A;  2KCD A;  2W04 A;  4R4K A;  3KZT A;  1M1K 4;  5M18 A;  1NB3 I;  1IQY A;  1KD1 4;  4QWT A;  3DZL A;  1BNE A;  3WOE B;  1HYF A;  1BUJ A;  1GY6 A;  1W5Z A;  2XGL A;  3CC4 3;  9RNT A;  3G0K A;  1BU4 A;  1YGE A;  2CHC A;  3OWS A;  2ZL8 A;  2Z7A A;  4FMC A;  2C10 A;  1I0V A;  3K9M C;  3WA2 X;  2O3O A;  2P38 A;  4XM4 A;  2OOV A;  1BNG A;  1E97 A;  2CW9 A;  2F99 A;  1K28 A;  3EN1 B;  1C7H A;  3H51 A;  4CDL A;  4ZM8 A;  1UDI I;  2RFR A;  1B20 A;  2XR8 B;  4LZI A;  4X2H A;  2P0X A;  2IA7 A;  1AV4 A;  3BNE A;  5HGR A;  1F8N A;  1FW7 A;  3TDG A;  1N8R 4;  3EN8 A;  4FMA A;  1E3R A;  1RGG A;  1SJW A;  1ZX2 A;  2I9W A;  1OHS A;  3K63 A;  2BHM A;  3ROB A;  2Z76 A;  3NBJ A;  4OK0 A;  1V57 A;  2W2C A;  2JDI H;  1MWS A;  2ZHX B;  3LML A;  3OWY A;  4NRE A;  2FNQ A;  3SX1 A;  1YVS A;  3DM8 A;  3HK4 A;  2IUK A;  1PU4 A;  1A2V A;  4K90 B;  5CK6 A;  1LQM B;  5D83 A;  1W6G A;  3CXC 2;  1YIT 3;  1RGC A;  1UI7 A;  1NJI 4;  3F7X A;  1BAN A;  1BRG A;  3V99 A;  5BXQ A;  4PEJ A;  5BIR A;  5CF2 A;  4HM7 B;  7STD A;  2GEY A;  4HM8 B;  1O7P B;  5IG5 A;  3BLZ A;  4HJL B;  4KFD A;  2RBI A;  3DUK A;  3EHC A;  1WMN A;  3X3X A;  5I97 A;  1IT7 A;  2BIR A;  1W6Y A;  1GOV A;  4X2O A;  3LYG A;  3MHE A;  3X42 A;  6STD A;  3CCJ 3;  5EEO A;  3PCR A;  2BU4 A;  1DVC A;  1LXE A;  1Z1S A;  1JN5 A;  1QAL A;  3KE7 A;  3X3Y A;  4EXR A;  1VQN 3;  2KF6 A;  4WYK A;  1I8V A;  3D4A A;  3UB1 A;  4HKV B;  4N3V A;  1S72 3;  1YJW 3;  1IV9 A;  4IPB A;  1NU3 A;  4JRF A;  1UCL A;  2D1W A;  1UGH I;  4XBY A;  2MC8 A;  1IVV A;  2YFJ B;  1BSD A;  1RRL A;  4EW5 A;  1YIJ 3;  1W2B 2;  2H0G A;  1YI2 3;  1W00 A;  2XSO B;  1UCJ A;  1RGH A;  1NNV A;  5BU4 A;  3K0Z A;  2XRX B;  1B21 A;  5IER A;  5AII A;  1UUG B;  1FUS A;  2L4V A;  4BL2 A;  3T0U A;  3NUV A;  1EQK A;  1ASK A;  4WFO A;  1A2K A;  3EBY A;  3U1W A;  2D42 A;  1DVD A;  1IU7 A;  4RNT A;  4FCZ A;  1QAK A;  1KQS 2;  3F14 A;  4KZ1 A;  1DET A;  1IVX A;  3SED A;  1BNF A;  3ALA A;  2BMR B;  2Z6B A;  1UUV B;  3F9S A;  3HX8 A;  4R80 A;  5EVH A;  1VQQ A;  4HVN A;  4FR9 A;  3EF8 A;  1RGL A;  2F5W A;  3KN4 A;  4XBT A;  1Q40 A;  1AQZ A;  1BVI A;  1YNV X;  1O7G B;  1RTU A;  1STD A;  1A67 A;  1TFK A;  3DGN A;  1BGS A;  4R9K A;  3J7Y d;  5RNT A;  4O8S A;  1PYL A;  1RRH A;  1VQ7 3;  1Q7H A;  3GSP A;  4N6M A;  1O7W B;  1ZGX A;  4HAA A;  3BNB A;  8CHO A;  1GYB A;  1GD4 A;  1U5O A;  1RMS A;  1UUW B;  3ZFZ A;  2B1X B;  3KKG A;  2K3D A;  3MG3 A;  1BSB A;  2W6J H;  1V74 A;  3N54 B;  1NWW A;  4XBX A;  3LTC A;  1RSN A;  3SOY A;  1K9M 4;  1AVL A;  2YX9 A;  3JUM A;  3KCH A;  1I3F A;  4L8P A;  3KFQ C;  3S27 A;  3G4S 3;  1J2B A;  4HZ9 B;  1FGO A;  2OQE A;  1UW1 A;  2V1L A;  3Q2P A;  1OH0 A;  3M8C A;  5ELU A;  1GY7 A;  1RDS A;  3OW2 2;  2W56 A;  2OCT A;  4WYK B;  2RGQ A;  1K73 4;  3SLU A;  3LZA A;  1DMM A;  2W9P A;  3AHW A;  3BB9 A;  4N6L A;  1JB4 A;  2M7O A;  2WOH A;  2GU1 A;  3LTA A;  4XDW A;  4CJN A;  3MSO A;  1LOY A;  1US1 A;  2HMM B;  3NBR A;  3CCE 3;  1EEJ A;  1ZS7 A;  3V98 A;  1W4N A;  4ILF A;  1UCI A;  1E3V A;  1BNS A;  1BSA A;  3H3H A;  8RNT A;  4HM4 B;  1LVN A;  5JPP A;  2SAR A;  1N8Q A;  2ML6 A;  1VQ9 3;  5AIF A;  1X1X A;  1JBR A;  1FA3 A;  2CK3 H;  2HML B;  2GSP A;  1GS3 A;  1KWI A;  4KFE A;  3V92 A;  1RGK A;  4GHO A;  2CG1 A;  5IW9 A;  2FGT A;  3JVC A;  4K1U A;  1Q40 B;  1I2G A;  3F8X A;  1JZD A;  1SAR A;  4WWU C;  1JKG B;  2AAE A;  1BNI A;  1FGQ A;  5D81 A;  1QVG 2;  1S5A A;  2CWV A;  3NX0 A;  4RNY A;  1W02 A;  1YVB I;  3F40 A;  2PNC A;  4HOH A;  1FZU A;  1R4Y A;  1X1W A;  1OGZ A;  3GZR A;  4HM5 B;  3X40 A;  5JPU A;  1GOY A;  1OHP A;  1VQ6 3;  1A90 A;  1ROA A;  3AMO A;  3D79 A;  1I2E A;  4BL3 A;  1TUH A;  3PGB A;  5AI1 A;  3UNL A;  6GSP A;  1G96 A;  4IIA A;  1RCL A;  5FW5 A;  3K5T A;  5ELJ A;  3CCR 3;  3FZW A;  1JV2 B;  4ORL A;  1AY7 A;  2GBW B;  1AVK A;  3LT8 A;  3HZP A;  3EQQ B;  2IMJ A;  4HM1 B;  1EA2 A;  1VQP 3;  1B2S A;  2P09 A;  3WDG B;  2OTL 3;  2W56 B;  2B24 B;  2CWU A;  3PZW A;  4O3V A;  3SVA A;  1D6Z A; 
#chains in the Genus database with same CATH homology
 1ULJ B;  2F98 A;  2P0M A;  2CFL A;  5IF6 A;  1QAF A;  4KFF A;  4N6N B;  1NDO B;  3LXU X;  3A76 A;  3EBT A;  3LTD A;  2C11 A;  4RZM A;  2QEX 3;  1VQL 3;  3VF1 A;  4MMX B;  4NHF A;  1IT8 A;  1QJG A;  3LOY A;  1ULI B;  2O9U X;  1JJ2 2;  3CU3 A;  2ML5 A;  1JNQ A;  3L0R A;  3GAX A;  4LMI A;  4LGQ A;  2SBL A;  1SIH A;  3RGR A;  3KSP A;  1W01 A;  2LYX A;  2RSX A;  3PS8 A;  1N9J A;  2CFG A;  1VQ4 3;  4N6U A;  3NV0 A;  3UJM A;  3S5C A;  3CNX A;  1YHQ 3;  2CFW A;  3PYJ A;  1MNL A;  3GWR A;  4EBG A;  1W7C A;  2OWP A;  3RDE A;  4EV2 A;  5CF1 A;  4N6V 0;  3CNM A;  3CPW 2;  2R4I A;  3GZY B;  3FH1 A;  3CPO A;  1PFP A;  3EE1 A;  4CCV A;  1FGR A;  1FGM A;  4L8O A;  2RCD A;  1ISK A;  2XSH B;  5CLK A;  3IJE B;  2QGU A;  1WMO A;  5JBS A;  3AMO B;  2CG0 A;  3S28 A;  3NM7 A;  5IEP A;  4MEI A;  2CWT A;  2KXG A;  1OGX A;  3DGO A;  3FGY A;  4K1V A;  5D82 A;  1TIJ A;  3WOD G;  3OV4 A;  4AEQ A;  3FSD A;  3OX9 A;  4HM2 B;  1JB2 A;  3CME 3;  2W0Q A;  3UL6 A;  3GZB A;  3Q90 A;  2XH9 A;  2E2V A;  3BND A;  3G8Z A;  1ROV A;  5FGO A;  1FUW A;  1EKM A;  4FCM A;  4GL6 A;  3G6E 3;  4L7K A;  4EV5 A;  1YJ9 3;  4I4K A;  1D6Y A;  3T8U A;  2INX A;  2BT3 A;  1JN5 B;  2CC3 A;  2XFS A;  3HIG A;  3OWU A;  2BO9 B;  2CFK A;  1HKX A;  3NM2 A;  4HM3 B;  1K8A 4;  2MF7 A;  5AYS C;  1OPY A;  2OOV C;  1CYU A;  1YJN 3;  4AKY A;  4MMY B;  1Q81 4;  2PZV A;  1JB5 A;  3NXJ A;  2CH9 A;  3CC2 3;  3B4P A;  4LSO A;  1RJO A;  2CFD A;  3T8N A;  3OXA A;  1IVU A;  5AYR B;  3ER7 A;  4RBN A;  3S67 A;  1QVF 2;  3E99 A;  3DY5 A;  4N6O B;  3FG3 A;  5TGN A;  2Y74 A;  3NV0 B;  3FG4 A;  1BUQ A;  3DGM A;  3JUO A;  1MOL A;  1DMN A;  3NQZ A;  1OUN A;  3BNC A;  3CCL 3;  3F8H A;  5KP3 A;  5AIG A;  2K54 A;  4IT7 A;  4TX4 A;  3CCU 3;  1RKY A;  4GB5 A;  2WO0 A;  4HZB B;  1J2B A;  5DRV A;  2HMK B;  2CKF B;  4WHA A;  5LC6 A;  1VQK 3;  2W9Q A;  1Q7Y 4;  1OHO A;  3EJV A;  1RN7 A;  3FF2 A;  5LC7 A;  5STD A;  1GY5 A;  4Q53 A;  2E2T A;  2JQ5 A;  2YFI B;  1O7M B;  1NB5 I;  3WMD A;  2XF3 A;  5IG4 A;  4OVM A;  2UX0 A;  3MWZ A;  2W03 A;  3QK9 A;  2HMN B;  1VQ5 3;  4FMD A;  2CIU A;  1VQO 3;  3CCV 3;  3CMA 3;  5IG0 A;  3G71 3;  1O7H B;  1IDP A;  1W2Z A;  2WGQ A;  2IUJ A;  3CCS 3;  2WGO A;  1U8C B;  3G16 A;  3FKA A;  4OUQ A;  1CQS A;  1TU5 A;  1IV7 A;  4N6T A;  2P05 A;  4XB5 A;  2QIY A;  1TP6 A;  1IVW A;  3FF0 A;  4HM0 B;  1DMQ A;  1NO3 A;  1WQL B;  2GXF A;  2XGN A;  3IPT A;  3WA3 A;  1UI8 A;  4HM6 B;  1IQX A;  3MPH A;  1LNH A;  3B8L A;  3MG1 A;  1WTH A;  3EC9 A;  1O7N B;  3QRD A;  1D6U A;  4RNZ A;  3X3Z A;  5A0O B;  3CD6 3;  2GU3 A;  4HYZ A;  4H3U A;  1L5G B;  1FGT A;  5KP1 A;  2LQV A;  3EX9 A;  3JUP A;  3N8B A;  4WP5 A;  3STD A;  5KP4 A;  3CCQ 3;  3FCS B;  3K7C A;  1Q86 4;  3KSE D;  1OF5 A;  1STF I;  1ZO2 A;  2XFT A;  3NHX A;  4STD A;  1IK3 A;  4EYC A;  1N9E A;  4R1K A;  1R4C A;  2BMQ B;  1VQ8 3;  3GRD A;  4O2H A;  1WNH A;  3MYT A;  1HU9 A;  3EB8 A;  2KRT A;  2Y73 A;  5AEW B;  2HMO B;  1OCV A;  1WMP A;  1TFO A;  3JUN A;  1OAC A;  2HMJ B;  1CYV A;  3LH4 A;  3LTB A;  3B4O A;  1T5Y A;  2GBX B;  2OQE C;  4R9L A;  5AIH A;  2YFL B;  1CEW I;  3LT9 A;  2FXT A;  2GEX A;  1N5H A;  3DGL A;  5IG3 A;  2BNG A;  3IMA B;  3CCM 3;  3FLJ A;  5CXO A;  2Q07 A;  3UL5 A;  1K41 A;  4G1M B;  1N5P A;  4KVH A;  5IEO A;  4H61 A;  1LOX A;  1JRQ A;  3NQY A;  4MMZ B;  1KC8 4;  3N9H A;  4BTY A;  1VQM 3;  1M90 4;  2K0M A;  1QMA A;  3O8Y A;  3F7S A;  3FG1 A;  3HII A;  1DYU A;  1SQW A;  3DXO A;  2QA4 3;  3I56 3;  3NBB A;  3RGA A;  2ZDJ A;  4FCJ A;  2WOF A;  4HBR A;  3VSY A;  4BTW A;  1SPU A;  2Z77 A;  3ECF A;  1M1X B;  2BMO B;  3PXM A;  1JKG A;  2OTJ 3;  3DMC A;  1GD3 A;  5EQL A;  3JUQ A;  3I0Y A;  3X41 A;  1VZZ A;  1Q42 A;  5BVB A;  5AEU B;  4XDV A;  1AR0 A;  4LEH A;  3GZX B;  4U13 A;  3HI7 A;  1OF5 B;  3I55 3;  5G2G A;  3WOF B;  3D9R A;  4EC6 A;  1Q82 4;  1EG9 B;  3CC7 3;  3MKI A;  3U97 A;  3SOA A;  4J8T A;  4J9A A;  3Q1C A;  2XEP A;  3VGN A;  3D3L A;  3MG2 A;  2E2U A;  3KII A;  4O02 B;  4FMB A;  2STD A;  4MJD A;  1IQ8 A;  4K61 A;  2F86 B;  4AKZ A;  4JF8 A;  1M9G A;  2A15 A;  1Y4K A;  3PCS A;  1KSI A;  1SII A;  1W6C A;  3B7C A;  5DRE A;  5IEN A;  3S29 A;  4BTX A;  3SXX A;  2KCD A;  2W04 A;  4R4K A;  3KZT A;  1M1K 4;  1NB3 I;  1IQY A;  4QWT A;  3DZL A;  3WOE B;  1GY6 A;  1W5Z A;  2XGL A;  3CC4 3;  3G0K A;  1YGE A;  2CHC A;  3OWS A;  2ZL8 A;  2Z7A A;  4FMC A;  2C10 A;  3K9M C;  3WA2 X;  2O3O A;  2P38 A;  4XM4 A;  2OOV A;  1E97 A;  2CW9 A;  2F99 A;  1K28 A;  3EN1 B;  1C7H A;  3H51 A;  4CDL A;  4ZM8 A;  2RFR A;  2XR8 B;  4LZI A;  4X2H A;  2P0X A;  2IA7 A;  1AV4 A;  3BNE A;  5HGR A;  1F8N A;  3TDG A;  1N8R 4;  3EN8 A;  4FMA A;  1E3R A;  1SJW A;  1ZX2 A;  2I9W A;  1OHS A;  3K63 A;  2BHM A;  3ROB A;  2Z76 A;  3NBJ A;  4OK0 A;  2W2C A;  2JDI H;  3OWY A;  3LML A;  4NRE A;  2FNQ A;  3SX1 A;  3DM8 A;  3HK4 A;  2IUK A;  1PU4 A;  1A2V A;  4K90 B;  5CK6 A;  5D83 A;  1W6G A;  3CXC 2;  1YIT 3;  1UI7 A;  1NJI 4;  3F7X A;  3V99 A;  5BXQ A;  4PEJ A;  5CF2 A;  4HM7 B;  7STD A;  2GEY A;  4HM8 B;  1O7P B;  5IG5 A;  3BLZ A;  4HJL B;  4KFD A;  3DUK A;  3EHC A;  1WMN A;  3X3X A;  5I97 A;  1IT7 A;  1W6Y A;  4X2O A;  3X42 A;  3LYG A;  3MHE A;  6STD A;  3CCJ 3;  5EEO A;  3PCR A;  1KD1 4;  1DVC A;  1LXE A;  1Z1S A;  1JN5 A;  1QAL A;  3KE7 A;  3X3Y A;  4EXR A;  1VQN 3;  4WYK A;  3UB1 A;  4HKV B;  4N3V A;  1S72 3;  1YJW 3;  1IV9 A;  4IPB A;  1NU3 A;  4JRF A;  2D1W A;  2MC8 A;  4XBY A;  1IVV A;  2YFJ B;  1RRL A;  1YIJ 3;  1W2B 2;  1YI2 3;  1W00 A;  2XSO B;  3K0Z A;  2XRX B;  5IER A;  5AII A;  2L4V A;  3T0U A;  3NUV A;  1EQK A;  1ASK A;  4WFO A;  1A2K A;  3EBY A;  3U1W A;  2D42 A;  1DVD A;  1IU7 A;  4FCZ A;  1QAK A;  1KQS 2;  3F14 A;  4KZ1 A;  1IVX A;  3SED A;  3ALA A;  2BMR B;  2Z6B A;  1UUV B;  3F9S A;  3HX8 A;  4R80 A;  5EVH A;  4HVN A;  4FR9 A;  3EF8 A;  3KN4 A;  4XBT A;  1Q40 A;  1O7G B;  1STD A;  1A67 A;  1TFK A;  3DGN A;  4R9K A;  3J7Y d;  4O8S A;  1RRH A;  1VQ7 3;  4N6M A;  1O7W B;  3BNB A;  8CHO A;  1GYB A;  1GD4 A;  1U5O A;  1UUW B;  2B1X B;  3KKG A;  3MG3 A;  2W6J H;  1V74 A;  3N54 B;  1NWW A;  4XBX A;  3LTC A;  3SOY A;  1K9M 4;  1AVL A;  2YX9 A;  3JUM A;  3S27 A;  4L8P A;  3KFQ C;  3G4S 3;  4HZ9 B;  1FGO A;  2OQE A;  1UW1 A;  2V1L A;  3Q2P A;  1OH0 A;  3M8C A;  5ELU A;  1GY7 A;  3OW2 2;  2W56 A;  2OCT A;  4WYK B;  2RGQ A;  1K73 4;  3SLU A;  3LZA A;  1DMM A;  2W9P A;  3BB9 A;  4N6L A;  1JB4 A;  2M7O A;  2WOH A;  2GU1 A;  3LTA A;  4XDW A;  3MSO A;  1US1 A;  2HMM B;  3NBR A;  3CCE 3;  3V98 A;  1W4N A;  1E3V A;  3H3H A;  4HM4 B;  1LVN A;  5JPP A;  1N8Q A;  2ML6 A;  1VQ9 3;  5AIF A;  1FA3 A;  2CK3 H;  2HML B;  1GS3 A;  1KWI A;  4KFE A;  3V92 A;  2CG1 A;  5IW9 A;  2FGT A;  3JVC A;  4K1U A;  1Q40 B;  3F8X A;  4WWU C;  1JKG B;  5D81 A;  1FGQ A;  1QVG 2;  1S5A A;  2CWV A;  3NX0 A;  4RNY A;  1W02 A;  1YVB I;  3F40 A;  2PNC A;  3GZR A;  1OGZ A;  4HM5 B;  3X40 A;  5JPU A;  1VQ6 3;  1OHP A;  1A90 A;  1ROA A;  3AMO A;  1TUH A;  3PGB A;  5AI1 A;  3UNL A;  1G96 A;  4IIA A;  5FW5 A;  3K5T A;  5ELJ A;  3CCR 3;  3FZW A;  1JV2 B;  4ORL A;  2GBW B;  1AVK A;  3LT8 A;  3HZP A;  3EQQ B;  2IMJ A;  4HM1 B;  1EA2 A;  1VQP 3;  2P09 A;  3WDG B;  2OTL 3;  2W56 B;  2B24 B;  2CWU A;  3PZW A;  4O3V A;  3SVA A;  1D6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...