5JPPA

Structure of limonene epoxide hydrolase mutant - h-2-h5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
STPDEKIVLEFMDALTSNDAAKLIDYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFKVFSIDAVETFHIGSTKGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords limonene epoxide hydrolase
publication title Multi-Parameter Optimization in Directed Evolution: Engineering Thermostability, Enantioselectivity and Activity of an Epoxide Hydrolase
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 31
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5jppA00
4XBYA 5STDA 3GWRA 5CXOA 4R1KA 4XBTA 3G16A 4XB5A 3MSOA 4WP5A 8CHOA 3UJMA 3FKAA 5EVHA 1UUVB 1OHSA 5IG4A 2INXA 3JUPA 2W2CA 3VSYA 4WWUC 5JPPA 4WYKB 2XR8B 1E3VA 3T8NA 1O7PB 1O7NB 3S5CA 3K7CA 2HMKB 1JB2A 4L7KA 1JN5A 1GY5A 3F7SA 3MG3A 3JUOA 3NHXA 1QMAA 5IEPA 1OPYA 2GEXA 5D82A 3GZBA 1DMNA 1O7WB 5KP3A 3E99A 3GZRA 2Z76A 2HMJB 2K54A 1GS3A 2BMRB 5BXQA 3RGRA 3OWUA 3SEDA 3JUMA 1NDOB 3CPOA 4GB5A 3K0ZA 3RGAA 3CNMA 2A15A 2PZVA 4J8TA 2XSHB 1OF5A 3B8LA 2GBXB 3ROBA 3JUNA 1AR0A 1HKXA 1OHOA 2STDA 4K1VA 3GZXB 1Q40B 4HM1B 3NXJA 3STDA 1A2KA 2GBWB 3FLJA 2BMOB 3GZYB 5DREA 3FSDA 3BB9A 1EG9B 4X2OA 3EHCA 1IDPA 3CNXA 3F8XA 2F98A 3DMCA 2IMJA 3OX9A 5IG0A 3M8CA 1Z1SA 3NV0A 4OUQA 1E3RA 4PEJA 2CHCA 5AIHA 4X2HA 2HMLB 2YFJB 3D9RA 3ER7A 5D83A 1ISKA 1TUHA 4HM7B 5D81A 3WMDA 4CDLA 3HX8A 2HMMB 5IG3A 4HM0B 5TGNA 3FF0A 4XDWA 3LZAA 3FF2A 3I0YA 5IENA 1WQLB 4R9KA 3EX9A 4J9AA 2I9WA 3Q90A 3G0KA 5BVBA 4R9LA 4KVHA 4XBXA 3F40A 4MJDA 1W00A 2RCDA 1Q42A 3DXOA 3DM8A 5AI1A 1JB5A 1U5OA 3B4OA 3MHEA 1W01A 7STDA 3B7CA 5IG5A 3F7XA 2RGQA 3MYTA 2HMOB 1CQSA 3A76A 2HMNB 2YFLB 3H3HA 3FZWA 4U13A 3EBTA 1ULIB 3EJVA 1UUWB 1W02A 4L8PA 1JKGA 3DZLA 4L8OA 1C7HA 3OWYA 3UNLA 2F99A 4FCMA 1ULJB 1TP6A 1W6YA 5KP4A 3NM2A 3IPTA 2BMQB 4HM2B 3T8UA 3KSPA 3EC9A 5AEWB 4LMIA 4STDA 1DMQA 2GEYA 4IIAA 1OHPA 4HJLB 3G8ZA 4K1UA 3OWSA 4FCJA 6STDA 3KKGA 5AIIA 1S5AA 2GXFA 4OVMA 3CU3A 4HKVB 1E97A 5G2GA 4XDVA 1QJGA 1O7HB 3DUKA 5FW5A 3KZTA 5AEUB 3EN1B 3B4PA 3OXAA 3FGYA 1SJWA 2RFRA 4XM4A 2JQ5A 4HM8B 5JPUA 3LYGA 1STDA 1OGXA 3EQQB 2Z7AA 1JN5B 3MG1A 4HM3B 5IEOA 4WYKA 1GYBA 4HM6B 2CKFB 3SOYA 3GRDA 3JUQA 2Z77A 3F14A 5AIFA 2R4IA 2XSOB 1EA2A 2B1XB 4RZMA 1O7MB 1ASKA 1ZO2A 3BLZA 5CF1A 5CF2A 1OH0A 2B24B 4ORLA 4HZBB 4LEHA 1NU3A 3HK4A 3HZPA 4HVNA 5AIGA 1DMMA 2BNGA 4LGQA 1OF5B 3FH1A 1JKGB 2F86B 3SOAA 4H3UA 1JB4A 3EBYA 3KE7A 3H51A 1K41A 5KP1A 2YFIB 4HM4B 5IF6A 2QGUA 4HZ9B 4N3VA 1NWWA 5CK6A 1OUNA 3NUVA 3F8HA 3NBRA 1BUQA 4HM5B 1ZX2A 4Q53A 3MG2A 2UX0A 1OGZA 2OWPA 1Q40A 4I4KA 5CLKA 3EN8A 1O7GB 3VGNA 3ECFA 1GY6A 5IERA 2XRXB 5HGRA 5DRVA 3NV0B 3F9SA 1GY7A 1VZZA 2QIYA 3EF8A 3MKIA 1OCVA 3OV4A
chains in the Genus database with same CATH superfamily
4XBYA 4N6LA 5STDA 1BRNL 3GWRA 2CWTA 3CCM3 5CXOA 4R1KA 1RGHA 4XBTA 3G16A 4XB5A 1GMRA 3MSOA 3N54B 3WOFB 2IA7A 2LYXA 3U1WA 2CFKA 2RBIA 4WP5A 3DGLA 2MF7A 3UJMA 8CHOA 3FKAA 5EVHA 3D4AA 1UDII 2BIRA 3HIGA 1UUVB 1JBSA 1OHSA 2W9PA 1QAKA 5IG4A 5G1KA 1GD4A 2INXA 3TDGA 3GAXA 4CPKA 7GSPA 1NJI4 3HIIA 1B2ZA 1N5HA 4MMXB 1LOWA 3JUPA 2W2CA 3VSYA 4WWUC 4MMYB 1RRHA 4TX4A 1VQ93 1BSBA 1RN1A 1TJDA 4R4KA 2KF4A 2W56B 3X3XA 5JPPA 4WYKB 2XR8B 2C4BA 1E3VA 3QK9A 3T8NA 1A2PA 1O7PB 1O7NB 2K3DA 2O3OA 1RHLA 2KRTA 4N6MA 3X3YA 1BRKA 3S5CA 3S28A 4J5KA 4JRFA 1FGOA 1AV4A 1RKYA 3K7CA 2HMKB 4RNYA 1TFKA 1JB2A 3V92A 4IT7A 4L7KA 1T3BA 1I2EA 2GU1A 3X41A 2H0IA 1LXEA 1M1XB 1JN5A 1GY5A 3URPA 3F7SA 3MG3A 3JUOA 1YJW3 1VQ83 2CX0A 4FCZA 3MWZA 3NHXA 1QMAA 5IEPA 3ZFZA 1LVNA 2C10A 3IMAB 2FXTA 1OPYA 4FMDA 3DGNA 2GEXA 1BSAA 2FGTA 5D82A 1YIT3 1UCKA 3OW22 1TRQA 2L1SA 3GZBA 1DMNA 3LOYA 1O7WB 3BNCA 1I3FA 5KP3A 5M1AA 1RGFA 1QALA 1C54A 1BNJA 3D5GA 3E99A 3GZRA 1FGRA 2Z76A 5GSPA 3SVAA 2HMJB 3U97A 3CC23 2K54A 2GU3A 4FMCA 1GS3A 2CC3A 4WHAA 2BMRB 3UL6A 5BXQA 3RGRA 4R80A 2XFSA 3OWUA 4N6UA 1WNHA 1BRIA 3SEDA 4O3VA 3JUMA 3SYUA 2MC8A 1NDOB 1WMPA 3EB8A 3KSED 3CPOA 4GB5A 1IQYA 2OQEC 3K0ZA 2CG1A 1GMQA 3RGAA 5JBSA 3CNMA 1B21A 3CCJ3 2A15A 1BRJA 1HYFA 2PZVA 1YIJ3 2KAAA 4J8TA 2WOFA 1AQZA 4EBGA 2BHMA 2IUKA 4BU4A 2XSHB 3NQYA 1WMNA 2W6JH 3AGNA 1OF5A 4NHFA 1EEJA 3B8LA 4AKZA 2F56A 2GBXB 1RGAA 3ROBA 1R4YA 3PZWA 1Q7Y4 1U8CB 8RNTA 2WO0A 3JUNA 3NM7A 3G4S3 1UCJA 2CWUA 4LZIA 1FA3A 1AR0A 1HKXA 3JVCA 3FG3A 4FR9A 3WDGB 3AMOA 4GHOA 1OHOA 1WTHA 2STDA 4JF8A 1M1K4 4K1VA 1A67A 3GZXB 1Q40B 4HM1B 1JZDA 2CFDA 2CWVA 3NXJA 2ZA4A 1VQK3 1B27A 5A0OB 1B20A 3WR2A 5IW9A 3STDA 1T2HA 5G1LA 4J5GA 1A2KA 4ILFA 2P09A 5BU4A 1D6ZA 2P0MA 5EQLA 2GBWB 1BOXA 3FLJA 2BMOB 2H0HA 3GZYB 1BRHA 5DREA 3FSDA 5EEOA 2AAEA 3BB9A 4EC6A 1EG9B 2IY2A 3LTBA 2WGQA 2CX1A 4HYZA 3LTCA 1X1WA 3NBBA 4X2OA 1RN4A 1VQL3 1FGMA 3EHCA 1IDPA 3LTAA 3CNXA 3F8XA 3LH4A 2BT3A 4CJNA 2F98A 3DMCA 2W0QA 2IMJA 1SARA 1N5PA 1ROVA 3OX9A 1K734 4MEIA 4WFOA 1ZGXA 1EQKA 2P0XA 3KIIA 5IG0A 3V98A 1BIRA 1RGEA 3M8CA 3FG4A 4BL2A 1Z1SA 3CPW2 4EV5A 1A90A 3NV0A 4OUQA 1TU5A 1E3RA 1MWTA 4PEJA 1RN7A 2CK3H 2KF5A 1FUWA 1Q814 2CHCA 3ALAA 5AIHA 2OOVA 4KFDA 4G1MB 4BIRA 4X2HA 3X40A 2XEPA 4LSOA 1N9JA 1BANA 2HMLB 1QVF2 1FUTA 1IU7A 3Q3FA 1IVVA 1RGLA 1Q7HA 2YFJB 1SIHA 1VQ53 3D9RA 3ER7A 1DVDA 4KT3B 3SXXA 4LYLB 1YJN3 4N6NB 5D83A 1ISKA 1MOLA 1TUHA 4HM7B 3I563 1PYLA 2SBLA 3RDEA 5D81A 3J7Yd 3KFQC 1B2SA 1NB3I 3WMDA 4CDLA 3G6E3 3HX8A 2HMMB 5IG3A 4HM0B 4ZM8A 3K63A 1JJ22 1UCIA 1IK3A 3Q1CA 2XF3A 1CYUA 5TGNA 1SPUA 3FF0A 4XDWA 3CCV3 3LZAA 1ZS7A 3DGYA 3FF2A 2K0MA 3K5TA 1BRSA 3I0YA 1B3SA 1V57A 1WQLB 5IENA 1BSDA 4R9KA 4RBNA 3EX9A 2BU4A 3PCSA 4J9AA 2I9WA 3Q90A 3G0KA 5LC7A 5BVBA 1JBTA 4R9LA 1BRGA 1I2GA 4KVHA 1M904 2OTJ3 4K90B 4XBXA 1LOXA 1Q864 2F4YA 1V58A 3F40A 3NX0A 4MJDA 1W00A 2RCDA 1Q42A 3DXOA 3DM8A 1LNIA 4H61A 5AI1A 4EV2A 1A2VA 4KFEA 1J2BA 1JB5A 2CIUA 1U5OA 3PGBA 3B4OA 3MHEA 1HU9A 1BNSA 4N6OB 1SQWA 1K28A 1UW1A 1YGEA 1W01A 3WA3A 4BTYA 5HOHA 7STDA 3BNBA 3B7CA 4RNZA 5IG5A 3F7XA 1KD14 5M18A 1BNGA 3CCE3 2PNCA 3D5IA 2RGQA 1FUSA 4I5QA 1YNVX 1JNQA 1RGGA 2ML6A 5I97A 3MYTA 2HMOB 1DE3A 1CQSA 4AKYA 1GD3A 2W03A 1QAFA 3A76A 7RNTA 2HMNB 1IT7A 2F5WA 2YFLB 3H3HA 1GOUA 3FZWA 4NPBA 1RGCA 3LXUX 4FMAA 4NREA 1MGRA 4U13A 3EBTA 1D6UA 1ULIB 2P38A 4O8SA 3ZG5A 3EJVA 1UUWB 3LT9A 1W02A 4L8PA 4O2HA 1K9M4 1JKGA 3LT8A 3DZLA 4L8OA 1C7HA 5FGOA 1BSCA 3OWYA 1BSEA 3UNLA 2ZHXB 1IVWA 3BU4A 3IJEB 2F99A 6GSPA 1EKMA 1GMPA 2D1WA 3DGOA 4FCMA 4N6V0 1GSPA 1N8R4 1T2IA 1ULJB 1TP6A 1W6YA 2OCTA 3AMOB 3Q2PA 4EYCA 1VQ43 5KP4A 3V99A 1VQN3 3T0UA 1RDSA 3NM2A 3IPTA 2BMQB 3AHSA 1W6GA 4HM2B 1VQO3 4N6TA 3T8UA 3KSPA 3DY5A 5BIRA 1AVKA 1LQGC 3KN4A 3EC9A 1JZOA 4AEQA 1HZ1A 2W04A 2XGNA 5AEWB 4LMIA 2CG0A 4STDA 4MMZB 1US1A 1YI23 2H0GA 1DMQA 2GEYA 2KF6A 4IIAA 1OHPA 3CC73 4HJLB 3HI7A 1IVXA 1FZUA 2CFLA 1JV2B 1N9EA 4GSPA 3G8ZA 1RMSA 1VQM3 2GSPA 4CCVA 4K1UA 3AGOA 3OWSA 4FCJA 5AYRB 6STDA 1BNRA 1N8QA 2BO9B 1RCLA 3KKGA 1CH0A 1FGQA 1S5AA 2GXFA 2M7OA 5AIIA 1YVBI 5M19A 4OVMA 3FCSB 2IUJA 3S27A 3N8BA 3CC43 1LRAA 2J8XB 1G02A 3DGMA 3CU3A 4KZ1A 4HKVB 1E97A 5G2GA 4XDVA 1QJGA 1O7HB 3DUKA 1PFPA 1YJ93 1I70A 2Y73A 5FW5A 2CW9A 5LC6A 3KZTA 1LQMB 2F5MA 1TFOA 3X3ZA 1T5YA 3CCS3 2E2VA 5AEUB 3CMA3 1SIIA 3S29A 1TTOA 2AADA 3EN1B 1RRLA 3B4PA 1M9GA 1X1YA 3BIRA 3BNEA 3FG1A 1MGWA 1LOVA 3OXAA 3FGYA 1SJWA 2RFRA 1BNFA 1UGIA 3CD63 4BL3A 4XM4A 2CFWA 2JQ5A 4HM8B 1VQQA 5JPUA 1RJOA 2D42A 1AVLA 3PCRA 1D6YA 1KWIA 1Y4KA 2ZL8A 3LYGA 1YVSA 2RNTA 1STDA 1OGXA 3EQQB 2Z7AA 1W4NA 2Y74A 2XFTA 1JN5B 3MG1A 3NQZA 4HM3B 5IEOA 1VQ73 2UGIA 2W56A 4WYKA 1GYBA 3LTDA 3CCU3 4RNTA 4K61A 4HM6B 1S723 2C11A 3PXMA 1DETA 1IT8A 1B2UA 2CKFB 1W6CA 1KSIA 3NBJA 1RNTA 3BNDA 3WOEB 3SOYA 2OOVC 2IYJA 2XGLA 3GRDA 3SLUA 1GOYA 3JUQA 2Z77A 3F14A 4HBRA 5AIFA 2R4IA 1FW7A 1JRQA 2KF3A 2OQEA 1CEWI 1VQP3 3G713 2XSOB 1EA2A 1UUGB 1OACA 2B1XB 3ZG0A 1RLSA 4RZMA 2OTL3 1O7MB 1ASKA 3X42A 2UUGC 1RSNA 1ZO2A 2YX9A 1DVCA 1IQXA 4O02B 2W9QA 1IQ8A 3BLZA 4DKIA 5CF1A 2LQVA 1FGTA 5ELUA 1G0TA 1PU4A 1QVG2 4GL6A 5CF2A 5RNTA 1YGWA 1OH0A 1Q9EA 2B24B 2WOHA 4ORLA 1K8A4 1I0VA 4HZBB 1DYUA 1UI8A 4LEHA 3CME3 4HOHA 1R4CA 1NU3A 1IYYA 3HK4A 1W7CA 2SARA 3CCL3 1W2B2 1ROAA 3HZPA 1B2MA 4HVNA 3LMLA 5AIGA 1DMMA 3I553 1Q824 1RGKA 3RNTA 1BVIA 2BNGA 4HAAA 4LGQA 3PS8A 1OF5B 2P05A 3FH1A 1JKGB 1I8VA 2F86B 1IV9A 3L0RA 3SOAA 4H3UA 1JB4A 2QEX3 1B2XA 2V1LA 3QRDA 3EBYA 3AHWA 1W2ZA 3K9MC 3KE7A 3H51A 2HOHA 3O8YA 1K41A 2L4VA 5KP1A 1CYVA 2FNQA 2YFIB 2ZDJA 5AYSC 1GOVA 1RTUA 1WMOA 1VQ63 1LNHA 4HM4B 5IF6A 1TIJA 1BUJA 1PY3A 2QGUA 2R41A 4HZ9B 4N3VA 1NWWA 2E2UA 2KXGA 2RSXA 3S67A 5CK6A 1MWUA 1OUNA 3NUVA 2QA43 1BNIA 6RNTA 1AY7A 1UCLA 3F8HA 3NBRA 3N9HA 3WHOA 1BUQA 3WODG 3SX1A 4BTXA 4HM5B 1ZX2A 4Q53A 3MG2A 2UX0A 3VF1A 1JBRA 1UI7A 1BAOA 1OGZA 3CCQ3 1V74A 2OWPA 1YHQ3 4KFFA 1BNEA 1Q40A 2O9UX 3CXC2 4I4KA 4FMBA 5CLKA 1KC84 3D79A 1FYSA 1O7GB 3EN8A 3VGNA 1MWRA 4IPBA 1X1UA 3ECFA 1GY6A 2Q07A 2Z6BA 2KCDA 3WA2X 3UB1A 5IERA 3CCR3 2XRXB 3KCHA 1BU4A 5HGRA 4OK0A 1LOYA 3EE1A 1EUIC 5DRVA 1STFI 1W5ZA 3PYJA 3UL5A 4BTWA 1I0XA 1RNBA 1MNLA 1I2FA 2E2TA 1UGHI 3NV0B 3D3LA 2WGOA 3GSPA 1IVUA 1NB5I 3F9SA 1GY7A 2ML5A 3HOHA 3MPHA 3DH2A 2CH9A 3A5EA 1VZZA 1L5GB 1TRPA 9RNTA 2QIYA 3EF8A 4QWTA 1IV7A 1G96A 4EXRA 1MWSA 1NNVA 1KQS2 3MKIA 2XH9A 2JDIH 1BGSA 1OCVA 4EW5A 2CFGA 3OV4A 1RCKA 5ELJA 1I3IA 1F8NA 1NO3A 1X1XA
chains in the Genus database with same CATH topology
4XBYA 4N6LA 5STDA 3GWRA 2CWTA 3CCM3 5CXOA 4R1KA 4XBTA 3G16A 4XB5A 3MSOA 3N54B 3WOFB 2IA7A 2LYXA 3U1WA 2CFKA 4WP5A 8CHOA 3DGLA 2MF7A 3UJMA 3FKAA 5EVHA 3HIGA 1UUVB 1OHSA 2W9PA 1QAKA 5IG4A 1NJI4 1GD4A 2INXA 3TDGA 3GAXA 3HIIA 1N5HA 4MMXB 3JUPA 2W2CA 3VSYA 4WWUC 4MMYB 1RRHA 4TX4A 1VQ93 4R4KA 2W56B 3X3XA 5JPPA 4WYKB 2XR8B 1E3VA 3QK9A 3T8NA 1O7PB 1O7NB 2O3OA 4N6MA 2KRTA 3X3YA 3S5CA 3S28A 4JRFA 1FGOA 1AV4A 1RKYA 3K7CA 2HMKB 4RNYA 1TFKA 1JB2A 3V92A 4IT7A 4L7KA 2GU1A 3X41A 1LXEA 1M1XB 1JN5A 1GY5A 3F7SA 3MG3A 3JUOA 1YJW3 1VQ83 4FCZA 3MWZA 3NHXA 1QMAA 5IEPA 1LVNA 2C10A 3IMAB 2FXTA 1OPYA 4FMDA 3DGNA 2GEXA 2FGTA 5D82A 1YIT3 3OW22 3GZBA 1DMNA 3LOYA 1O7WB 3BNCA 5KP3A 1QALA 3E99A 3GZRA 1FGRA 2Z76A 3U97A 3SVAA 2HMJB 3CC23 2K54A 2GU3A 4FMCA 1GS3A 2CC3A 4WHAA 2BMRB 3UL6A 5BXQA 3RGRA 4R80A 2XFSA 3OWUA 4N6UA 1WNHA 3SEDA 4O3VA 3JUMA 2MC8A 1NDOB 1WMPA 3EB8A 3KSED 3CPOA 4GB5A 1IQYA 2OQEC 3K0ZA 2CG1A 3RGAA 5JBSA 3CNMA 3CCJ3 2A15A 2PZVA 1YIJ3 4J8TA 2WOFA 4EBGA 2BHMA 2IUKA 2XSHB 3NQYA 1WMNA 2W6JH 1OF5A 4NHFA 4AKZA 3B8LA 2GBXB 3ROBA 3PZWA 1Q7Y4 1U8CB 2WO0A 3JUNA 3NM7A 3G4S3 2CWUA 4LZIA 1FA3A 1AR0A 1HKXA 3JVCA 3FG3A 4FR9A 3WDGB 3AMOA 1OHOA 2STDA 1WTHA 4JF8A 1M1K4 4K1VA 1A67A 3GZXB 1Q40B 4HM1B 2CFDA 2CWVA 1VQK3 3NXJA 5A0OB 5IW9A 3STDA 1A2KA 2P09A 1D6ZA 2P0MA 5EQLA 2GBWB 3FLJA 2BMOB 3GZYB 5DREA 3FSDA 5EEOA 3BB9A 4EC6A 1EG9B 3LTBA 2WGQA 4HYZA 4X2OA 3LTCA 1VQL3 3NBBA 1FGMA 3EHCA 1IDPA 3LTAA 3CNXA 3F8XA 3LH4A 2BT3A 2F98A 3DMCA 2W0QA 2IMJA 1N5PA 1ROVA 3OX9A 1K734 4MEIA 4WFOA 1EQKA 2P0XA 3KIIA 5IG0A 3V98A 3M8CA 3FG4A 1Z1SA 3CPW2 4EV5A 1A90A 3NV0A 4OUQA 1TU5A 1E3RA 4PEJA 1RN7A 2CK3H 1FUWA 1Q814 2CHCA 3ALAA 5AIHA 2OOVA 4KFDA 4G1MB 4X2HA 3X40A 2XEPA 4LSOA 1N9JA 2HMLB 1QVF2 1IU7A 1IVVA 2YFJB 1VQ53 1SIHA 1DVDA 3D9RA 3ER7A 3SXXA 1YJN3 4N6NB 5D83A 1ISKA 1MOLA 1TUHA 4HM7B 3I563 3RDEA 2SBLA 5D81A 3J7Yd 3WMDA 1NB3I 4CDLA 3G6E3 3HX8A 2HMMB 5IG3A 4HM0B 4ZM8A 3K63A 1JJ22 1IK3A 3Q1CA 2XF3A 1CYUA 5TGNA 1SPUA 3FF0A 4XDWA 3CCV3 3LZAA 3FF2A 2K0MA 3K5TA 3I0YA 5IENA 1WQLB 4R9KA 4RBNA 3EX9A 3PCSA 4J9AA 2I9WA 3Q90A 3G0KA 5LC7A 5BVBA 4R9LA 4KVHA 1M904 2OTJ3 4K90B 4XBXA 1LOXA 1Q864 3F40A 3NX0A 4MJDA 1W00A 2RCDA 1Q42A 3DXOA 3DM8A 4H61A 5AI1A 4EV2A 1A2VA 4KFEA 1J2BA 1JB5A 2CIUA 1U5OA 3PGBA 3B4OA 3MHEA 1HU9A 4N6OB 1SQWA 1K28A 1UW1A 1YGEA 1W01A 3WA3A 4BTYA 7STDA 3BNBA 3B7CA 4RNZA 5IG5A 3F7XA 1KD14 3CCE3 2PNCA 2RGQA 1JNQA 2ML6A 5I97A 3MYTA 2HMOB 1CQSA 4AKYA 1GD3A 2W03A 1QAFA 3A76A 2HMNB 1IT7A 2YFLB 3H3HA 3FZWA 4U13A 3LXUX 4NREA 3EBTA 1D6UA 1ULIB 2P38A 4O8SA 3EJVA 1UUWB 3LT9A 1W02A 4L8PA 4O2HA 1K9M4 1JKGA 3LT8A 3DZLA 4L8OA 1C7HA 5FGOA 3OWYA 3UNLA 1IVWA 3IJEB 2F99A 1EKMA 2D1WA 3DGOA 4FCMA 4N6V0 1N8R4 1ULJB 1TP6A 1W6YA 2OCTA 3AMOB 3Q2PA 4EYCA 1VQ43 5KP4A 3V99A 1VQN3 3T0UA 3NM2A 3IPTA 2BMQB 1VQO3 1W6GA 4HM2B 4N6TA 3T8UA 3KSPA 3DY5A 1AVKA 3KN4A 3EC9A 4AEQA 2W04A 2XGNA 5AEWB 4LMIA 2CG0A 4STDA 4MMZB 1US1A 1YI23 1DMQA 2GEYA 4IIAA 1OHPA 3CC73 4HJLB 3HI7A 1IVXA 2CFLA 1JV2B 1N9EA 3G8ZA 1VQM3 4CCVA 4K1UA 3OWSA 4FCJA 5AYRB 6STDA 1N8QA 2BO9B 3KKGA 5AIIA 1S5AA 1FGQA 2M7OA 2GXFA 1YVBI 4OVMA 3FCSB 2IUJA 3S27A 3N8BA 3CC43 3DGMA 3CU3A 4KZ1A 4HKVB 1E97A 5G2GA 4XDVA 1QJGA 1O7HB 3DUKA 1PFPA 1YJ93 2Y73A 5FW5A 2CW9A 5LC6A 3KZTA 1TFOA 3X3ZA 1T5YA 3CCS3 2E2VA 5AEUB 3CMA3 1SIIA 3S29A 3EN1B 3KFQC 1RRLA 3B4PA 1M9GA 3BNEA 3FG1A 3OXAA 3FGYA 1SJWA 2RFRA 3CD63 4XM4A 2CFWA 2JQ5A 4HM8B 5JPUA 1RJOA 2D42A 1AVLA 3PCRA 1D6YA 1KWIA 1Y4KA 2ZL8A 3LYGA 1STDA 1OGXA 3EQQB 2Z7AA 2Y74A 1W4NA 2XFTA 1JN5B 3MG1A 3NQZA 4HM3B 5IEOA 1VQ73 2W56A 4WYKA 1GYBA 3LTDA 3CCU3 4K61A 4HM6B 1S723 2C11A 3PXMA 1IT8A 2CKFB 3NBJA 1W6CA 1KSIA 3WOEB 3BNDA 3SOYA 2OOVC 3GRDA 2XGLA 3SLUA 3JUQA 2Z77A 3F14A 4HBRA 5AIFA 2R4IA 1JRQA 2OQEA 1CEWI 1VQP3 3G713 2XSOB 1EA2A 1OACA 2B1XB 2OTL3 4RZMA 1O7MB 1ASKA 3X42A 1ZO2A 2YX9A 1DVCA 1IQXA 4O02B 2W9QA 1IQ8A 3BLZA 5CF1A 2LQVA 1FGTA 5ELUA 1PU4A 1QVG2 4GL6A 5CF2A 1OH0A 2WOHA 2B24B 4ORLA 1K8A4 4HZBB 1DYUA 1UI8A 4LEHA 3CME3 1R4CA 1NU3A 3HK4A 1W7CA 3CCL3 1W2B2 1ROAA 3HZPA 4HVNA 3LMLA 5AIGA 1DMMA 3I553 1Q824 2BNGA 4LGQA 3PS8A 1OF5B 2P05A 3FH1A 1JKGB 2F86B 1IV9A 3L0RA 3SOAA 4H3UA 1JB4A 2QEX3 2V1LA 3QRDA 3EBYA 1W2ZA 3K9MC 3KE7A 3H51A 3O8YA 1K41A 2L4VA 5KP1A 1CYVA 2FNQA 2YFIB 2ZDJA 5AYSC 1WMOA 1VQ63 1LNHA 4HM4B 5IF6A 1TIJA 2QGUA 4HZ9B 4N3VA 1NWWA 2E2UA 2KXGA 2RSXA 3S67A 5CK6A 1OUNA 3NUVA 2QA43 3F8HA 3NBRA 3N9HA 1BUQA 3WODG 3SX1A 4BTXA 4HM5B 1ZX2A 4Q53A 3MG2A 2UX0A 3VF1A 1UI7A 1OGZA 3CCQ3 1V74A 2OWPA 1YHQ3 4KFFA 1KC84 1Q40A 2O9UX 3CXC2 4I4KA 4FMBA 5CLKA 3EN8A 1O7GB 3VGNA 4IPBA 3ECFA 1GY6A 2Q07A 2Z6BA 2KCDA 3WA2X 3UB1A 5IERA 3CCR3 2XRXB 5HGRA 4OK0A 5DRVA 3EE1A 4BTWA 1STFI 1W5ZA 3PYJA 3UL5A 1MNLA 2E2TA 3NV0B 3D3LA 2WGOA 1IVUA 1NB5I 3F9SA 1GY7A 2ML5A 3MPHA 2CH9A 1VZZA 1L5GB 2QIYA 3EF8A 4QWTA 1IV7A 1G96A 4EXRA 1KQS2 3MKIA 2XH9A 2JDIH 1OCVA 2CFGA 3OV4A 5ELJA 4FMAA 1F8NA 1NO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBY A;  5STD A;  3GWR A;  5CXO A;  4R1K A;  4XBT A;  3G16 A;  4XB5 A;  3MSO A;  4WP5 A;  8CHO A;  3UJM A;  3FKA A;  5EVH A;  1UUV B;  1OHS A;  5IG4 A;  2INX A;  3JUP A;  2W2C A;  3VSY A;  4WWU C;  5JPP A;  4WYK B;  2XR8 B;  1E3V A;  3T8N A;  1O7P B;  1O7N B;  3S5C A;  3K7C A;  2HMK B;  1JB2 A;  4L7K A;  1JN5 A;  1GY5 A;  3F7S A;  3MG3 A;  3JUO A;  3NHX A;  1QMA A;  5IEP A;  1OPY A;  2GEX A;  5D82 A;  3GZB A;  1DMN A;  1O7W B;  5KP3 A;  3E99 A;  3GZR A;  2Z76 A;  2HMJ B;  2K54 A;  1GS3 A;  2BMR B;  5BXQ A;  3RGR A;  3OWU A;  3SED A;  3JUM A;  1NDO B;  3CPO A;  4GB5 A;  3K0Z A;  3RGA A;  3CNM A;  2A15 A;  2PZV A;  4J8T A;  2XSH B;  1OF5 A;  3B8L A;  2GBX B;  3ROB A;  3JUN A;  1AR0 A;  1HKX A;  1OHO A;  2STD A;  4K1V A;  3GZX B;  1Q40 B;  4HM1 B;  3NXJ A;  3STD A;  1A2K A;  2GBW B;  3FLJ A;  2BMO B;  3GZY B;  5DRE A;  3FSD A;  3BB9 A;  1EG9 B;  4X2O A;  3EHC A;  1IDP A;  3CNX A;  3F8X A;  2F98 A;  3DMC A;  2IMJ A;  3OX9 A;  5IG0 A;  3M8C A;  1Z1S A;  3NV0 A;  4OUQ A;  1E3R A;  4PEJ A;  2CHC A;  5AIH A;  4X2H A;  2HML B;  2YFJ B;  3D9R A;  3ER7 A;  5D83 A;  1ISK A;  1TUH A;  4HM7 B;  5D81 A;  3WMD A;  4CDL A;  3HX8 A;  2HMM B;  5IG3 A;  4HM0 B;  5TGN A;  3FF0 A;  4XDW A;  3LZA A;  3FF2 A;  3I0Y A;  5IEN A;  1WQL B;  4R9K A;  3EX9 A;  4J9A A;  2I9W A;  3Q90 A;  3G0K A;  5BVB A;  4R9L A;  4KVH A;  4XBX A;  3F40 A;  4MJD A;  1W00 A;  2RCD A;  1Q42 A;  3DXO A;  3DM8 A;  5AI1 A;  1JB5 A;  1U5O A;  3B4O A;  3MHE A;  1W01 A;  7STD A;  3B7C A;  5IG5 A;  3F7X A;  2RGQ A;  3MYT A;  2HMO B;  1CQS A;  3A76 A;  2HMN B;  2YFL B;  3H3H A;  3FZW A;  4U13 A;  3EBT A;  1ULI B;  3EJV A;  1UUW B;  1W02 A;  4L8P A;  1JKG A;  3DZL A;  4L8O A;  1C7H A;  3OWY A;  3UNL A;  2F99 A;  4FCM A;  1ULJ B;  1TP6 A;  1W6Y A;  5KP4 A;  3NM2 A;  3IPT A;  2BMQ B;  4HM2 B;  3T8U A;  3KSP A;  3EC9 A;  5AEW B;  4LMI A;  4STD A;  1DMQ A;  2GEY A;  4IIA A;  1OHP A;  4HJL B;  3G8Z A;  4K1U A;  3OWS A;  4FCJ A;  6STD A;  3KKG A;  5AII A;  1S5A A;  2GXF A;  4OVM A;  3CU3 A;  4HKV B;  1E97 A;  5G2G A;  4XDV A;  1QJG A;  1O7H B;  3DUK A;  5FW5 A;  3KZT A;  5AEU B;  3EN1 B;  3B4P A;  3OXA A;  3FGY A;  1SJW A;  2RFR A;  4XM4 A;  2JQ5 A;  4HM8 B;  5JPU A;  3LYG A;  1STD A;  1OGX A;  3EQQ B;  2Z7A A;  1JN5 B;  3MG1 A;  4HM3 B;  5IEO A;  4WYK A;  1GYB A;  4HM6 B;  2CKF B;  3SOY A;  3GRD A;  3JUQ A;  2Z77 A;  3F14 A;  5AIF A;  2R4I A;  2XSO B;  1EA2 A;  2B1X B;  4RZM A;  1O7M B;  1ASK A;  1ZO2 A;  3BLZ A;  5CF1 A;  5CF2 A;  1OH0 A;  2B24 B;  4ORL A;  4HZB B;  4LEH A;  1NU3 A;  3HK4 A;  3HZP A;  4HVN A;  5AIG A;  1DMM A;  2BNG A;  4LGQ A;  1OF5 B;  3FH1 A;  1JKG B;  2F86 B;  3SOA A;  4H3U A;  1JB4 A;  3EBY A;  3KE7 A;  3H51 A;  1K41 A;  5KP1 A;  2YFI B;  4HM4 B;  5IF6 A;  2QGU A;  4HZ9 B;  4N3V A;  1NWW A;  5CK6 A;  1OUN A;  3NUV A;  3F8H A;  3NBR A;  1BUQ A;  4HM5 B;  1ZX2 A;  4Q53 A;  3MG2 A;  2UX0 A;  1OGZ A;  2OWP A;  1Q40 A;  4I4K A;  5CLK A;  3EN8 A;  1O7G B;  3VGN A;  3ECF A;  1GY6 A;  5IER A;  2XRX B;  5HGR A;  5DRV A;  3NV0 B;  3F9S A;  1GY7 A;  1VZZ A;  2QIY A;  3EF8 A;  3MKI A;  1OCV A;  3OV4 A; 
#chains in the Genus database with same CATH topology
 4XBY A;  4N6L A;  5STD A;  1BRN L;  3GWR A;  2CWT A;  3CCM 3;  5CXO A;  4R1K A;  1RGH A;  4XBT A;  3G16 A;  4XB5 A;  1GMR A;  3MSO A;  3N54 B;  3WOF B;  2IA7 A;  2LYX A;  3U1W A;  2CFK A;  2RBI A;  4WP5 A;  3DGL A;  2MF7 A;  3UJM A;  8CHO A;  3FKA A;  5EVH A;  3D4A A;  1UDI I;  2BIR A;  3HIG A;  1UUV B;  1JBS A;  1OHS A;  2W9P A;  1QAK A;  5IG4 A;  5G1K A;  1GD4 A;  2INX A;  3TDG A;  3GAX A;  4CPK A;  7GSP A;  1NJI 4;  3HII A;  1B2Z A;  1N5H A;  4MMX B;  1LOW A;  3JUP A;  2W2C A;  3VSY A;  4WWU C;  4MMY B;  1RRH A;  4TX4 A;  1VQ9 3;  1BSB A;  1RN1 A;  1TJD A;  4R4K A;  2KF4 A;  2W56 B;  3X3X A;  5JPP A;  4WYK B;  2XR8 B;  2C4B A;  1E3V A;  3QK9 A;  3T8N A;  1A2P A;  1O7P B;  1O7N B;  2K3D A;  2O3O A;  1RHL A;  2KRT A;  4N6M A;  3X3Y A;  1BRK A;  3S5C A;  3S28 A;  4J5K A;  4JRF A;  1FGO A;  1AV4 A;  1RKY A;  3K7C A;  2HMK B;  4RNY A;  1TFK A;  1JB2 A;  3V92 A;  4IT7 A;  4L7K A;  1T3B A;  1I2E A;  2GU1 A;  3X41 A;  2H0I A;  1LXE A;  1M1X B;  1JN5 A;  1GY5 A;  3URP A;  3F7S A;  3MG3 A;  3JUO A;  1YJW 3;  1VQ8 3;  2CX0 A;  4FCZ A;  3MWZ A;  3NHX A;  1QMA A;  5IEP A;  3ZFZ A;  1LVN A;  2C10 A;  3IMA B;  2FXT A;  1OPY A;  4FMD A;  3DGN A;  2GEX A;  1BSA A;  2FGT A;  5D82 A;  1YIT 3;  1UCK A;  3OW2 2;  1TRQ A;  2L1S A;  3GZB A;  1DMN A;  3LOY A;  1O7W B;  3BNC A;  1I3F A;  5KP3 A;  5M1A A;  1RGF A;  1QAL A;  1C54 A;  1BNJ A;  3D5G A;  3E99 A;  3GZR A;  1FGR A;  2Z76 A;  5GSP A;  3SVA A;  2HMJ B;  3U97 A;  3CC2 3;  2K54 A;  2GU3 A;  4FMC A;  1GS3 A;  2CC3 A;  4WHA A;  2BMR B;  3UL6 A;  5BXQ A;  3RGR A;  4R80 A;  2XFS A;  3OWU A;  4N6U A;  1WNH A;  1BRI A;  3SED A;  4O3V A;  3JUM A;  3SYU A;  2MC8 A;  1NDO B;  1WMP A;  3EB8 A;  3KSE D;  3CPO A;  4GB5 A;  1IQY A;  2OQE C;  3K0Z A;  2CG1 A;  1GMQ A;  3RGA A;  5JBS A;  3CNM A;  1B21 A;  3CCJ 3;  2A15 A;  1BRJ A;  1HYF A;  2PZV A;  1YIJ 3;  2KAA A;  4J8T A;  2WOF A;  1AQZ A;  4EBG A;  2BHM A;  2IUK A;  4BU4 A;  2XSH B;  3NQY A;  1WMN A;  2W6J H;  3AGN A;  1OF5 A;  4NHF A;  1EEJ A;  3B8L A;  4AKZ A;  2F56 A;  2GBX B;  1RGA A;  3ROB A;  1R4Y A;  3PZW A;  1Q7Y 4;  1U8C B;  8RNT A;  2WO0 A;  3JUN A;  3NM7 A;  3G4S 3;  1UCJ A;  2CWU A;  4LZI A;  1FA3 A;  1AR0 A;  1HKX A;  3JVC A;  3FG3 A;  4FR9 A;  3WDG B;  3AMO A;  4GHO A;  1OHO A;  1WTH A;  2STD A;  4JF8 A;  1M1K 4;  4K1V A;  1A67 A;  3GZX B;  1Q40 B;  4HM1 B;  1JZD A;  2CFD A;  2CWV A;  3NXJ A;  2ZA4 A;  1VQK 3;  1B27 A;  5A0O B;  1B20 A;  3WR2 A;  5IW9 A;  3STD A;  1T2H A;  5G1L A;  4J5G A;  1A2K A;  4ILF A;  2P09 A;  5BU4 A;  1D6Z A;  2P0M A;  5EQL A;  2GBW B;  1BOX A;  3FLJ A;  2BMO B;  2H0H A;  3GZY B;  1BRH A;  5DRE A;  3FSD A;  5EEO A;  2AAE A;  3BB9 A;  4EC6 A;  1EG9 B;  2IY2 A;  3LTB A;  2WGQ A;  2CX1 A;  4HYZ A;  3LTC A;  1X1W A;  3NBB A;  4X2O A;  1RN4 A;  1VQL 3;  1FGM A;  3EHC A;  1IDP A;  3LTA A;  3CNX A;  3F8X A;  3LH4 A;  2BT3 A;  4CJN A;  2F98 A;  3DMC A;  2W0Q A;  2IMJ A;  1SAR A;  1N5P A;  1ROV A;  3OX9 A;  1K73 4;  4MEI A;  4WFO A;  1ZGX A;  1EQK A;  2P0X A;  3KII A;  5IG0 A;  3V98 A;  1BIR A;  1RGE A;  3M8C A;  3FG4 A;  4BL2 A;  1Z1S A;  3CPW 2;  4EV5 A;  1A90 A;  3NV0 A;  4OUQ A;  1TU5 A;  1E3R A;  1MWT A;  4PEJ A;  1RN7 A;  2CK3 H;  2KF5 A;  1FUW A;  1Q81 4;  2CHC A;  3ALA A;  5AIH A;  2OOV A;  4KFD A;  4G1M B;  4BIR A;  4X2H A;  3X40 A;  2XEP A;  4LSO A;  1N9J A;  1BAN A;  2HML B;  1QVF 2;  1FUT A;  1IU7 A;  3Q3F A;  1IVV A;  1RGL A;  1Q7H A;  2YFJ B;  1SIH A;  1VQ5 3;  3D9R A;  3ER7 A;  1DVD A;  4KT3 B;  3SXX A;  4LYL B;  1YJN 3;  4N6N B;  5D83 A;  1ISK A;  1MOL A;  1TUH A;  4HM7 B;  3I56 3;  1PYL A;  2SBL A;  3RDE A;  5D81 A;  3J7Y d;  3KFQ C;  1B2S A;  1NB3 I;  3WMD A;  4CDL A;  3G6E 3;  3HX8 A;  2HMM B;  5IG3 A;  4HM0 B;  4ZM8 A;  3K63 A;  1JJ2 2;  1UCI A;  1IK3 A;  3Q1C A;  2XF3 A;  1CYU A;  5TGN A;  1SPU A;  3FF0 A;  4XDW A;  3CCV 3;  3LZA A;  1ZS7 A;  3DGY A;  3FF2 A;  2K0M A;  3K5T A;  1BRS A;  3I0Y A;  1B3S A;  1V57 A;  1WQL B;  5IEN A;  1BSD A;  4R9K A;  4RBN A;  3EX9 A;  2BU4 A;  3PCS A;  4J9A A;  2I9W A;  3Q90 A;  3G0K A;  5LC7 A;  5BVB A;  1JBT A;  4R9L A;  1BRG A;  1I2G A;  4KVH A;  1M90 4;  2OTJ 3;  4K90 B;  4XBX A;  1LOX A;  1Q86 4;  2F4Y A;  1V58 A;  3F40 A;  3NX0 A;  4MJD A;  1W00 A;  2RCD A;  1Q42 A;  3DXO A;  3DM8 A;  1LNI A;  4H61 A;  5AI1 A;  4EV2 A;  1A2V A;  4KFE A;  1J2B A;  1JB5 A;  2CIU A;  1U5O A;  3PGB A;  3B4O A;  3MHE A;  1HU9 A;  1BNS A;  4N6O B;  1SQW A;  1K28 A;  1UW1 A;  1YGE A;  1W01 A;  3WA3 A;  4BTY A;  5HOH A;  7STD A;  3BNB A;  3B7C A;  4RNZ A;  5IG5 A;  3F7X A;  1KD1 4;  5M18 A;  1BNG A;  3CCE 3;  2PNC A;  3D5I A;  2RGQ A;  1FUS A;  4I5Q A;  1YNV X;  1JNQ A;  1RGG A;  2ML6 A;  5I97 A;  3MYT A;  2HMO B;  1DE3 A;  1CQS A;  4AKY A;  1GD3 A;  2W03 A;  1QAF A;  3A76 A;  7RNT A;  2HMN B;  1IT7 A;  2F5W A;  2YFL B;  3H3H A;  1GOU A;  3FZW A;  4NPB A;  1RGC A;  3LXU X;  4FMA A;  4NRE A;  1MGR A;  4U13 A;  3EBT A;  1D6U A;  1ULI B;  2P38 A;  4O8S A;  3ZG5 A;  3EJV A;  1UUW B;  3LT9 A;  1W02 A;  4L8P A;  4O2H A;  1K9M 4;  1JKG A;  3LT8 A;  3DZL A;  4L8O A;  1C7H A;  5FGO A;  1BSC A;  3OWY A;  1BSE A;  3UNL A;  2ZHX B;  1IVW A;  3BU4 A;  3IJE B;  2F99 A;  6GSP A;  1EKM A;  1GMP A;  2D1W A;  3DGO A;  4FCM A;  4N6V 0;  1GSP A;  1N8R 4;  1T2I A;  1ULJ B;  1TP6 A;  1W6Y A;  2OCT A;  3AMO B;  3Q2P A;  4EYC A;  1VQ4 3;  5KP4 A;  3V99 A;  1VQN 3;  3T0U A;  1RDS A;  3NM2 A;  3IPT A;  2BMQ B;  3AHS A;  1W6G A;  4HM2 B;  1VQO 3;  4N6T A;  3T8U A;  3KSP A;  3DY5 A;  5BIR A;  1AVK A;  1LQG C;  3KN4 A;  3EC9 A;  1JZO A;  4AEQ A;  1HZ1 A;  2W04 A;  2XGN A;  5AEW B;  4LMI A;  2CG0 A;  4STD A;  4MMZ B;  1US1 A;  1YI2 3;  2H0G A;  1DMQ A;  2GEY A;  2KF6 A;  4IIA A;  1OHP A;  3CC7 3;  4HJL B;  3HI7 A;  1IVX A;  1FZU A;  2CFL A;  1JV2 B;  1N9E A;  4GSP A;  3G8Z A;  1RMS A;  1VQM 3;  2GSP A;  4CCV A;  4K1U A;  3AGO A;  3OWS A;  4FCJ A;  5AYR B;  6STD A;  1BNR A;  1N8Q A;  2BO9 B;  1RCL A;  3KKG A;  1CH0 A;  1FGQ A;  1S5A A;  2GXF A;  2M7O A;  5AII A;  1YVB I;  5M19 A;  4OVM A;  3FCS B;  2IUJ A;  3S27 A;  3N8B A;  3CC4 3;  1LRA A;  2J8X B;  1G02 A;  3DGM A;  3CU3 A;  4KZ1 A;  4HKV B;  1E97 A;  5G2G A;  4XDV A;  1QJG A;  1O7H B;  3DUK A;  1PFP A;  1YJ9 3;  1I70 A;  2Y73 A;  5FW5 A;  2CW9 A;  5LC6 A;  3KZT A;  1LQM B;  2F5M A;  1TFO A;  3X3Z A;  1T5Y A;  3CCS 3;  2E2V A;  5AEU B;  3CMA 3;  1SII A;  3S29 A;  1TTO A;  2AAD A;  3EN1 B;  1RRL A;  3B4P A;  1M9G A;  1X1Y A;  3BIR A;  3BNE A;  3FG1 A;  1MGW A;  1LOV A;  3OXA A;  3FGY A;  1SJW A;  2RFR A;  1BNF A;  1UGI A;  3CD6 3;  4BL3 A;  4XM4 A;  2CFW A;  2JQ5 A;  4HM8 B;  1VQQ A;  5JPU A;  1RJO A;  2D42 A;  1AVL A;  3PCR A;  1D6Y A;  1KWI A;  1Y4K A;  2ZL8 A;  3LYG A;  1YVS A;  2RNT A;  1STD A;  1OGX A;  3EQQ B;  2Z7A A;  1W4N A;  2Y74 A;  2XFT A;  1JN5 B;  3MG1 A;  3NQZ A;  4HM3 B;  5IEO A;  1VQ7 3;  2UGI A;  2W56 A;  4WYK A;  1GYB A;  3LTD A;  3CCU 3;  4RNT A;  4K61 A;  4HM6 B;  1S72 3;  2C11 A;  3PXM A;  1DET A;  1IT8 A;  1B2U A;  2CKF B;  1W6C A;  1KSI A;  3NBJ A;  1RNT A;  3BND A;  3WOE B;  3SOY A;  2OOV C;  2IYJ A;  2XGL A;  3GRD A;  3SLU A;  1GOY A;  3JUQ A;  2Z77 A;  3F14 A;  4HBR A;  5AIF A;  2R4I A;  1FW7 A;  1JRQ A;  2KF3 A;  2OQE A;  1CEW I;  1VQP 3;  3G71 3;  2XSO B;  1EA2 A;  1UUG B;  1OAC A;  2B1X B;  3ZG0 A;  1RLS A;  4RZM A;  2OTL 3;  1O7M B;  1ASK A;  3X42 A;  2UUG C;  1RSN A;  1ZO2 A;  2YX9 A;  1DVC A;  1IQX A;  4O02 B;  2W9Q A;  1IQ8 A;  3BLZ A;  4DKI A;  5CF1 A;  2LQV A;  1FGT A;  5ELU A;  1G0T A;  1PU4 A;  1QVG 2;  4GL6 A;  5CF2 A;  5RNT A;  1YGW A;  1OH0 A;  1Q9E A;  2B24 B;  2WOH A;  4ORL A;  1K8A 4;  1I0V A;  4HZB B;  1DYU A;  1UI8 A;  4LEH A;  3CME 3;  4HOH A;  1R4C A;  1NU3 A;  1IYY A;  3HK4 A;  1W7C A;  2SAR A;  3CCL 3;  1W2B 2;  1ROA A;  3HZP A;  1B2M A;  4HVN A;  3LML A;  5AIG A;  1DMM A;  3I55 3;  1Q82 4;  1RGK A;  3RNT A;  1BVI A;  2BNG A;  4HAA A;  4LGQ A;  3PS8 A;  1OF5 B;  2P05 A;  3FH1 A;  1JKG B;  1I8V A;  2F86 B;  1IV9 A;  3L0R A;  3SOA A;  4H3U A;  1JB4 A;  2QEX 3;  1B2X A;  2V1L A;  3QRD A;  3EBY A;  3AHW A;  1W2Z A;  3K9M C;  3KE7 A;  3H51 A;  2HOH A;  3O8Y A;  1K41 A;  2L4V A;  5KP1 A;  1CYV A;  2FNQ A;  2YFI B;  2ZDJ A;  5AYS C;  1GOV A;  1RTU A;  1WMO A;  1VQ6 3;  1LNH A;  4HM4 B;  5IF6 A;  1TIJ A;  1BUJ A;  1PY3 A;  2QGU A;  2R41 A;  4HZ9 B;  4N3V A;  1NWW A;  2E2U A;  2KXG A;  2RSX A;  3S67 A;  5CK6 A;  1MWU A;  1OUN A;  3NUV A;  2QA4 3;  1BNI A;  6RNT A;  1AY7 A;  1UCL A;  3F8H A;  3NBR A;  3N9H A;  3WHO A;  1BUQ A;  3WOD G;  3SX1 A;  4BTX A;  4HM5 B;  1ZX2 A;  4Q53 A;  3MG2 A;  2UX0 A;  3VF1 A;  1JBR A;  1UI7 A;  1BAO A;  1OGZ A;  3CCQ 3;  1V74 A;  2OWP A;  1YHQ 3;  4KFF A;  1BNE A;  1Q40 A;  2O9U X;  3CXC 2;  4I4K A;  4FMB A;  5CLK A;  1KC8 4;  3D79 A;  1FYS A;  1O7G B;  3EN8 A;  3VGN A;  1MWR A;  4IPB A;  1X1U A;  3ECF A;  1GY6 A;  2Q07 A;  2Z6B A;  2KCD A;  3WA2 X;  3UB1 A;  5IER A;  3CCR 3;  2XRX B;  3KCH A;  1BU4 A;  5HGR A;  4OK0 A;  1LOY A;  3EE1 A;  1EUI C;  5DRV A;  1STF I;  1W5Z A;  3PYJ A;  3UL5 A;  4BTW A;  1I0X A;  1RNB A;  1MNL A;  1I2F A;  2E2T A;  1UGH I;  3NV0 B;  3D3L A;  2WGO A;  3GSP A;  1IVU A;  1NB5 I;  3F9S A;  1GY7 A;  2ML5 A;  3HOH A;  3MPH A;  3DH2 A;  2CH9 A;  3A5E A;  1VZZ A;  1L5G B;  1TRP A;  9RNT A;  2QIY A;  3EF8 A;  4QWT A;  1IV7 A;  1G96 A;  4EXR A;  1MWS A;  1NNV A;  1KQS 2;  3MKI A;  2XH9 A;  2JDI H;  1BGS A;  1OCV A;  4EW5 A;  2CFG A;  3OV4 A;  1RCK A;  5ELJ A;  1I3I A;  1F8N A;  1NO3 A;  1X1X A; 
#chains in the Genus database with same CATH homology
 4XBY A;  4N6L A;  5STD A;  3GWR A;  2CWT A;  3CCM 3;  5CXO A;  4R1K A;  4XBT A;  3G16 A;  4XB5 A;  3MSO A;  3N54 B;  3WOF B;  2IA7 A;  2LYX A;  3U1W A;  2CFK A;  4WP5 A;  8CHO A;  3DGL A;  2MF7 A;  3UJM A;  3FKA A;  5EVH A;  3HIG A;  1UUV B;  1OHS A;  2W9P A;  1QAK A;  5IG4 A;  1NJI 4;  1GD4 A;  2INX A;  3TDG A;  3GAX A;  3HII A;  1N5H A;  4MMX B;  3JUP A;  2W2C A;  3VSY A;  4WWU C;  4MMY B;  1RRH A;  4TX4 A;  1VQ9 3;  4R4K A;  2W56 B;  3X3X A;  5JPP A;  4WYK B;  2XR8 B;  1E3V A;  3QK9 A;  3T8N A;  1O7P B;  1O7N B;  2O3O A;  4N6M A;  2KRT A;  3X3Y A;  3S5C A;  3S28 A;  4JRF A;  1FGO A;  1AV4 A;  1RKY A;  3K7C A;  2HMK B;  4RNY A;  1TFK A;  1JB2 A;  3V92 A;  4IT7 A;  4L7K A;  2GU1 A;  3X41 A;  1LXE A;  1M1X B;  1JN5 A;  1GY5 A;  3F7S A;  3MG3 A;  3JUO A;  1YJW 3;  1VQ8 3;  4FCZ A;  3MWZ A;  3NHX A;  1QMA A;  5IEP A;  1LVN A;  2C10 A;  3IMA B;  2FXT A;  1OPY A;  4FMD A;  3DGN A;  2GEX A;  2FGT A;  5D82 A;  1YIT 3;  3OW2 2;  3GZB A;  1DMN A;  3LOY A;  1O7W B;  3BNC A;  5KP3 A;  1QAL A;  3E99 A;  3GZR A;  1FGR A;  2Z76 A;  3U97 A;  3SVA A;  2HMJ B;  3CC2 3;  2K54 A;  2GU3 A;  4FMC A;  1GS3 A;  2CC3 A;  4WHA A;  2BMR B;  3UL6 A;  5BXQ A;  3RGR A;  4R80 A;  2XFS A;  3OWU A;  4N6U A;  1WNH A;  3SED A;  4O3V A;  3JUM A;  2MC8 A;  1NDO B;  1WMP A;  3EB8 A;  3KSE D;  3CPO A;  4GB5 A;  1IQY A;  2OQE C;  3K0Z A;  2CG1 A;  3RGA A;  5JBS A;  3CNM A;  3CCJ 3;  2A15 A;  2PZV A;  1YIJ 3;  4J8T A;  2WOF A;  4EBG A;  2BHM A;  2IUK A;  2XSH B;  3NQY A;  1WMN A;  2W6J H;  1OF5 A;  4NHF A;  4AKZ A;  3B8L A;  2GBX B;  3ROB A;  3PZW A;  1Q7Y 4;  1U8C B;  2WO0 A;  3JUN A;  3NM7 A;  3G4S 3;  2CWU A;  4LZI A;  1FA3 A;  1AR0 A;  1HKX A;  3JVC A;  3FG3 A;  4FR9 A;  3WDG B;  3AMO A;  1OHO A;  2STD A;  1WTH A;  4JF8 A;  1M1K 4;  4K1V A;  1A67 A;  3GZX B;  1Q40 B;  4HM1 B;  2CFD A;  2CWV A;  1VQK 3;  3NXJ A;  5A0O B;  5IW9 A;  3STD A;  1A2K A;  2P09 A;  1D6Z A;  2P0M A;  5EQL A;  2GBW B;  3FLJ A;  2BMO B;  3GZY B;  5DRE A;  3FSD A;  5EEO A;  3BB9 A;  4EC6 A;  1EG9 B;  3LTB A;  2WGQ A;  4HYZ A;  4X2O A;  3LTC A;  1VQL 3;  3NBB A;  1FGM A;  3EHC A;  1IDP A;  3LTA A;  3CNX A;  3F8X A;  3LH4 A;  2BT3 A;  2F98 A;  3DMC A;  2W0Q A;  2IMJ A;  1N5P A;  1ROV A;  3OX9 A;  1K73 4;  4MEI A;  4WFO A;  1EQK A;  2P0X A;  3KII A;  5IG0 A;  3V98 A;  3M8C A;  3FG4 A;  1Z1S A;  3CPW 2;  4EV5 A;  1A90 A;  3NV0 A;  4OUQ A;  1TU5 A;  1E3R A;  4PEJ A;  1RN7 A;  2CK3 H;  1FUW A;  1Q81 4;  2CHC A;  3ALA A;  5AIH A;  2OOV A;  4KFD A;  4G1M B;  4X2H A;  3X40 A;  2XEP A;  4LSO A;  1N9J A;  2HML B;  1QVF 2;  1IU7 A;  1IVV A;  2YFJ B;  1VQ5 3;  1SIH A;  1DVD A;  3D9R A;  3ER7 A;  3SXX A;  1YJN 3;  4N6N B;  5D83 A;  1ISK A;  1MOL A;  1TUH A;  4HM7 B;  3I56 3;  3RDE A;  2SBL A;  5D81 A;  3J7Y d;  3WMD A;  1NB3 I;  4CDL A;  3G6E 3;  3HX8 A;  2HMM B;  5IG3 A;  4HM0 B;  4ZM8 A;  3K63 A;  1JJ2 2;  1IK3 A;  3Q1C A;  2XF3 A;  1CYU A;  5TGN A;  1SPU A;  3FF0 A;  4XDW A;  3CCV 3;  3LZA A;  3FF2 A;  2K0M A;  3K5T A;  3I0Y A;  5IEN A;  1WQL B;  4R9K A;  4RBN A;  3EX9 A;  3PCS A;  4J9A A;  2I9W A;  3Q90 A;  3G0K A;  5LC7 A;  5BVB A;  4R9L A;  4KVH A;  1M90 4;  2OTJ 3;  4K90 B;  4XBX A;  1LOX A;  1Q86 4;  3F40 A;  3NX0 A;  4MJD A;  1W00 A;  2RCD A;  1Q42 A;  3DXO A;  3DM8 A;  4H61 A;  5AI1 A;  4EV2 A;  1A2V A;  4KFE A;  1J2B A;  1JB5 A;  2CIU A;  1U5O A;  3PGB A;  3B4O A;  3MHE A;  1HU9 A;  4N6O B;  1SQW A;  1K28 A;  1UW1 A;  1YGE A;  1W01 A;  3WA3 A;  4BTY A;  7STD A;  3BNB A;  3B7C A;  4RNZ A;  5IG5 A;  3F7X A;  1KD1 4;  3CCE 3;  2PNC A;  2RGQ A;  1JNQ A;  2ML6 A;  5I97 A;  3MYT A;  2HMO B;  1CQS A;  4AKY A;  1GD3 A;  2W03 A;  1QAF A;  3A76 A;  2HMN B;  1IT7 A;  2YFL B;  3H3H A;  3FZW A;  4U13 A;  3LXU X;  4NRE A;  3EBT A;  1D6U A;  1ULI B;  2P38 A;  4O8S A;  3EJV A;  1UUW B;  3LT9 A;  1W02 A;  4L8P A;  4O2H A;  1K9M 4;  1JKG A;  3LT8 A;  3DZL A;  4L8O A;  1C7H A;  5FGO A;  3OWY A;  3UNL A;  1IVW A;  3IJE B;  2F99 A;  1EKM A;  2D1W A;  3DGO A;  4FCM A;  4N6V 0;  1N8R 4;  1ULJ B;  1TP6 A;  1W6Y A;  2OCT A;  3AMO B;  3Q2P A;  4EYC A;  1VQ4 3;  5KP4 A;  3V99 A;  1VQN 3;  3T0U A;  3NM2 A;  3IPT A;  2BMQ B;  1VQO 3;  1W6G A;  4HM2 B;  4N6T A;  3T8U A;  3KSP A;  3DY5 A;  1AVK A;  3KN4 A;  3EC9 A;  4AEQ A;  2W04 A;  2XGN A;  5AEW B;  4LMI A;  2CG0 A;  4STD A;  4MMZ B;  1US1 A;  1YI2 3;  1DMQ A;  2GEY A;  4IIA A;  1OHP A;  3CC7 3;  4HJL B;  3HI7 A;  1IVX A;  2CFL A;  1JV2 B;  1N9E A;  3G8Z A;  1VQM 3;  4CCV A;  4K1U A;  3OWS A;  4FCJ A;  5AYR B;  6STD A;  1N8Q A;  2BO9 B;  3KKG A;  5AII A;  1S5A A;  1FGQ A;  2M7O A;  2GXF A;  1YVB I;  4OVM A;  3FCS B;  2IUJ A;  3S27 A;  3N8B A;  3CC4 3;  3DGM A;  3CU3 A;  4KZ1 A;  4HKV B;  1E97 A;  5G2G A;  4XDV A;  1QJG A;  1O7H B;  3DUK A;  1PFP A;  1YJ9 3;  2Y73 A;  5FW5 A;  2CW9 A;  5LC6 A;  3KZT A;  1TFO A;  3X3Z A;  1T5Y A;  3CCS 3;  2E2V A;  5AEU B;  3CMA 3;  1SII A;  3S29 A;  3EN1 B;  3KFQ C;  1RRL A;  3B4P A;  1M9G A;  3BNE A;  3FG1 A;  3OXA A;  3FGY A;  1SJW A;  2RFR A;  3CD6 3;  4XM4 A;  2CFW A;  2JQ5 A;  4HM8 B;  5JPU A;  1RJO A;  2D42 A;  1AVL A;  3PCR A;  1D6Y A;  1KWI A;  1Y4K A;  2ZL8 A;  3LYG A;  1STD A;  1OGX A;  3EQQ B;  2Z7A A;  2Y74 A;  1W4N A;  2XFT A;  1JN5 B;  3MG1 A;  3NQZ A;  4HM3 B;  5IEO A;  1VQ7 3;  2W56 A;  4WYK A;  1GYB A;  3LTD A;  3CCU 3;  4K61 A;  4HM6 B;  1S72 3;  2C11 A;  3PXM A;  1IT8 A;  2CKF B;  3NBJ A;  1W6C A;  1KSI A;  3WOE B;  3BND A;  3SOY A;  2OOV C;  3GRD A;  2XGL A;  3SLU A;  3JUQ A;  2Z77 A;  3F14 A;  4HBR A;  5AIF A;  2R4I A;  1JRQ A;  2OQE A;  1CEW I;  1VQP 3;  3G71 3;  2XSO B;  1EA2 A;  1OAC A;  2B1X B;  2OTL 3;  4RZM A;  1O7M B;  1ASK A;  3X42 A;  1ZO2 A;  2YX9 A;  1DVC A;  1IQX A;  4O02 B;  2W9Q A;  1IQ8 A;  3BLZ A;  5CF1 A;  2LQV A;  1FGT A;  5ELU A;  1PU4 A;  1QVG 2;  4GL6 A;  5CF2 A;  1OH0 A;  2WOH A;  2B24 B;  4ORL A;  1K8A 4;  4HZB B;  1DYU A;  1UI8 A;  4LEH A;  3CME 3;  1R4C A;  1NU3 A;  3HK4 A;  1W7C A;  3CCL 3;  1W2B 2;  1ROA A;  3HZP A;  4HVN A;  3LML A;  5AIG A;  1DMM A;  3I55 3;  1Q82 4;  2BNG A;  4LGQ A;  3PS8 A;  1OF5 B;  2P05 A;  3FH1 A;  1JKG B;  2F86 B;  1IV9 A;  3L0R A;  3SOA A;  4H3U A;  1JB4 A;  2QEX 3;  2V1L A;  3QRD A;  3EBY A;  1W2Z A;  3K9M C;  3KE7 A;  3H51 A;  3O8Y A;  1K41 A;  2L4V A;  5KP1 A;  1CYV A;  2FNQ A;  2YFI B;  2ZDJ A;  5AYS C;  1WMO A;  1VQ6 3;  1LNH A;  4HM4 B;  5IF6 A;  1TIJ A;  2QGU A;  4HZ9 B;  4N3V A;  1NWW A;  2E2U A;  2KXG A;  2RSX A;  3S67 A;  5CK6 A;  1OUN A;  3NUV A;  2QA4 3;  3F8H A;  3NBR A;  3N9H A;  1BUQ A;  3WOD G;  3SX1 A;  4BTX A;  4HM5 B;  1ZX2 A;  4Q53 A;  3MG2 A;  2UX0 A;  3VF1 A;  1UI7 A;  1OGZ A;  3CCQ 3;  1V74 A;  2OWP A;  1YHQ 3;  4KFF A;  1KC8 4;  1Q40 A;  2O9U X;  3CXC 2;  4I4K A;  4FMB A;  5CLK A;  3EN8 A;  1O7G B;  3VGN A;  4IPB A;  3ECF A;  1GY6 A;  2Q07 A;  2Z6B A;  2KCD A;  3WA2 X;  3UB1 A;  5IER A;  3CCR 3;  2XRX B;  5HGR A;  4OK0 A;  5DRV A;  3EE1 A;  4BTW A;  1STF I;  1W5Z A;  3PYJ A;  3UL5 A;  1MNL A;  2E2T A;  3NV0 B;  3D3L A;  2WGO A;  1IVU A;  1NB5 I;  3F9S A;  1GY7 A;  2ML5 A;  3MPH A;  2CH9 A;  1VZZ A;  1L5G B;  2QIY A;  3EF8 A;  4QWT A;  1IV7 A;  1G96 A;  4EXR A;  1KQS 2;  3MKI A;  2XH9 A;  2JDI H;  1OCV A;  2CFG A;  3OV4 A;  5ELJ A;  4FMA A;  1F8N A;  1NO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...