5JPPA

Structure of limonene epoxide hydrolase mutant - h-2-h5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
b'STPDEKIVLEFMDALTSNDAAKLIDYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFKVFSIDAVETFHIGSTKGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords limonene epoxide hydrolase
publication title Multi-Parameter Optimization in Directed Evolution: Engineering Thermostability, Enantioselectivity and Activity of an Epoxide Hydrolase
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 31
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5jppA00
5IG0A 2F86B 1EG9B 3JUNA 4XM4A 4HM5B 3B8LA 3FGYA 3I0YA 5BVBA 3NV0A 3H3HA 5IG4A 1OF5A 3Q90A 5CF2A 1W01A 5AIFA 2GEXA 2I9WA 8CHOA 4HZ9B 3NUVA 3B4OA 3MSOA 1OHOA 2XRXB 3EC9A 2XSHB 1A2KA 3GZRA 2GXFA 1GYBA 5EVHA 1OCVA 4OUQA 4XBYA 3KE7A 1ULIB 3F8XA 3KZTA 2RCDA 3FLJA 3FH1A 1JB5A 1QJGA 4WP5A 4HM0B 5IENA 2HMNB 3NM2A 1ISKA 1GY7A 3OXAA 3FZWA 5IG3A 2F98A 3KSPA 1W6YA 3SEDA 4R9KA 3F14A 2YFJB 3EBTA 2XSOB 7STDA 1O7MB 4LGQA 2PZVA 1JB4A 4R9LA 4N3VA 3HX8A 2HMOB 2BMQB 3K7CA 1NWWA 3GZYB 3VGNA 1E97A 3G0KA 3B4PA 3NV0B 3NXJA 3EN8A 5AEUB 4MJDA 1TUHA 4L8PA 1OF5B 2OWPA 4GB5A 4PEJA 2QGUA 3UNLA 1HKXA 2BNGA 3NHXA 1JKGB 5DREA 3EF8A 4WYKA 1OH0A 2RFRA 1EA2A 3DUKA 3DXOA 1ULJB 3GWRA 5D81A 3CNMA 1DMQA 3F7SA 1W02A 4J8TA 3STDA 1STDA 3GZXB 4Q53A 5AIGA 3T8UA 3RGAA 5D83A 5IERA 5JPPA 1JKGA 3BB9A 2B1XB 5KP4A 3NBRA 1C7HA 6STDA 1NU3A 2HMJB 2Z76A 1Q42A 5KP3A 1OPYA 4K1VA 3IPTA 3CNXA 3HZPA 4XDVA 3DMCA 1U5OA 2GBWB 1K41A 4STDA 1UUWB 4LMIA 1Q40A 4OVMA 3EQQB 2HMLB 1O7NB 3F7XA 3D9RA 5IF6A 3S5CA 5AIIA 5AIHA 4WWUC 3MKIA 3UJMA 5CK6A 1O7WB 2STDA 3OWSA 1WQLB 3A76A 4HM7B 3SOYA 4L7KA 1GS3A 5HGRA 2W2CA 2CHCA 3LYGA 3FF0A 3OWUA 1W00A 1DMMA 1Z1SA 4WYKB 3JUMA 5DRVA 5BXQA 4I4KA 1ASKA 3DM8A 1OGXA 5STDA 4RZMA 4HM4B 2YFIB 5CF1A 1BUQA 3OV4A 4HM2B 4HZBB 1IDPA 4FCMA 3DZLA 3ROBA 1ZO2A 2A15A 1GY6A 2UX0A 4IIAA 5CXOA 4J9AA 2HMMB 4XB5A 3ECFA 3JUQA 5IG5A 3F9SA 5JPUA 3HK4A 1S5AA 1E3RA 2CKFB 5IEOA 1OGZA 1TP6A 3FSDA 1ZX2A 4HM8B 2F99A 2GEYA 2XR8B 3GZBA 1Q40B 3WMDA 3CPOA 3FKAA 3LZAA 4U13A 4HKVB 2IMJA 2K54A 3H51A 3E99A 3B7CA 5CLKA 1O7HB 4L8OA 4LEHA 3SOAA 5TGNA 2Z77A 1AR0A 1O7GB 3EN1B 4HM6B 3F8HA 2GBXB 1OUNA 3FF2A 4FCJA 1GY5A 4KVHA 3G16A 1DMNA 1JN5A 5G2GA 3OX9A 1QMAA 5AI1A 3MYTA 3ER7A 2RGQA 5AEWB 2BMRB 2R4IA 2JQ5A 1CQSA 4R1KA 3VSYA 3MHEA 2YFLB 5FW5A 1VZZA 4XBTA 3G8ZA 1NDOB 2HMKB 4ORLA 3K0ZA 1SJWA 4K1UA 3EHCA 4X2HA 1O7PB 3OWYA 1E3VA 2QIYA 3GRDA 1OHPA 4XDWA 3F40A 2BMOB 1OHSA 3T8NA 3RGRA 3JUPA 3EX9A 3MG1A 4HM3B 1JB2A 5D82A 4HVNA 1UUVB 3EBYA 4HM1B 3CU3A 3MG3A 4CDLA 3EJVA 3KKGA 5KP1A 3JUOA 2Z7AA 5IEPA 2INXA 3BLZA 4HJLB 3M8CA 4XBXA 3MG2A 2B24B 4H3UA 1JN5B 4X2OA
chains in the Genus database with same CATH superfamily
3DGOA 4BTXA 1K9M4 5IG0A 2F86B 1EG9B 1M1K4 1BOXA 3CC23 3LOYA 3CCJ3 3JUNA 3CMA3 1BNGA 2UUGC 3RNTA 4XM4A 1VQM3 4HM5B 4BL3A 1BRHA 3B8LA 3FGYA 1G0TA 1FGOA 1SIIA 3I0YA 5BVBA 3NV0A 1DYUA 1W5ZA 2ZDJA 2BU4A 1RTUA 3SYUA 3CCM3 1RGEA 3Q2PA 1W2ZA 3K63A 2BIRA 2M7OA 3H3HA 4WHAA 1LVNA 2CG1A 5IG4A 1OF5A 2SARA 1RRHA 1WTHA 4IT7A 3G4S3 3Q90A 5CF2A 1ZS7A 2KF3A 3FG1A 1W01A 1BGSA 1UI8A 1LQGC 4CJNA 5AIFA 1CH0A 1LXEA 2GEXA 2I9WA 1BNEA 2C4BA 1W7CA 8CHOA 1I0VA 3AGOA 4HZ9B 4KFEA 1A2PA 3B4OA 3NUVA 2XEPA 4FCZA 3MSOA 3CCV3 4LSOA 1OHOA 1TTOA 2WGOA 2XRXB 3WR2A 1MWUA 3EC9A 1S723 4KFDA 2ZHXB 2E2UA 2IUKA 1GMRA 3I563 4TX4A 2D42A 3CCL3 1RGCA 2XSHB 1MWSA 1A2KA 6RNTA 4G1MB 4GHOA 1IVWA 1IV7A 4OK0A 1YJ93 3DGNA 3QRDA 3GZRA 4FMDA 2MC8A 1WMPA 2GXFA 1GYBA 3SX1A 1QAKA 1JBSA 5EVHA 4RBNA 1RGFA 1KC84 1K734 3JVCA 1I0XA 1EQKA 1OCVA 4OUQA 3X3YA 1YGEA 1B2XA 1MWRA 3HI7A 1JNQA 3NX0A 3VF1A 1VQ93 1FUTA 1JV2B 4FMBA 4K90B 4XBYA 4ILFA 2R41A 3KE7A 4O8SA 1ULIB 3F8XA 2CFDA 2XGNA 3KN4A 1B27A 3KZTA 4N6OB 2RCDA 1YJW3 3FLJA 1YVBI 2W9QA 4BL2A 3S27A 3FH1A 1ZGXA 1JB5A 1QJGA 1I2EA 1JRQA 4HM0B 4MMXB 4WP5A 1UCIA 5LC6A 2HMNB 3NM2A 5IENA 1ISKA 1GY7A 4KFFA 1GOUA 3IMAB 3OXAA 3FZWA 5IG3A 1KD14 2F98A 3KSPA 1W6YA 3SEDA 4R9KA 5AYRB 4EC6A 3NM7A 3N9HA 1YJN3 3F14A 1TRQA 2YFJB 2CH9A 2XSOB 3EBTA 5M19A 7STDA 1BSEA 1O7MB 4EXRA 1AVKA 2AADA 3D5GA 2PZVA 4LGQA 3FCSB 1JB4A 4R9LA 4N3VA 1T5YA 3PGBA 1BRNL 1DVDA 3KFQC 3HX8A 3WA3A 2HMOB 1W6CA 3QK9A 3Q3FA 1VQP3 1JBRA 4ZM8A 2BT3A 1BAOA 1IV9A 2BMQB 2QEX3 3KCHA 2BO9B 1IVUA 3K7CA 1TFOA 1NWWA 1FW7A 1YNVX 3DGLA 1RHLA 3GZYB 5AYSC 3VGNA 1E97A 4CCVA 1EKMA 1VQK3 1BSBA 1BSCA 3G0KA 4R4KA 3B4PA 7RNTA 1I8VA 3DGYA 3NV0B 3HIIA 3LT9A 3EN8A 1BNFA 3NXJA 4GL6A 1TUHA 4MJDA 2OQEA 5AEUB 4EYCA 1QAFA 1X1YA 2XFSA 1VQ43 3K9MC 3CCQ3 2P0MA 4L8PA 1OF5B 2OWPA 1JZDA 3UB1A 4GB5A 2P0XA 4J5GA 4PEJA 1CYUA 1B2ZA 2QGUA 3UNLA 2KCDA 1HKXA 1W6GA 2BNGA 3NHXA 2Q07A 3LTAA 1BUJA 4N6LA 3SXXA 3CCR3 1JKGB 5DREA 2BHMA 2D1WA 3EF8A 2W6JH 4WYKA 1RGHA 1B21A 1UDII 5BIRA 2W04A 3IJEB 2CG0A 1VQ53 1IQXA 1OH0A 2RFRA 5I97A 3LH4A 3FG3A 4BTWA 1K28A 1EA2A 1RGGA 2C10A 3DUKA 3X42A 3DGMA 1EEJA 2F4YA 3LTDA 3DXOA 2W03A 2P05A 1ULJB 2CK3H 1IU7A 3GWRA 5D81A 3CNMA 1DMQA 3CCU3 1J2BA 3F7SA 1WMOA 1W02A 4J8TA 3FG4A 4FMAA 3STDA 3CCS3 3X41A 1STDA 4EV5A 1FGMA 1VQ83 3GZXB 2IY2A 5FGOA 4Q53A 1IVVA 2OCTA 3MPHA 1V57A 5AIGA 4NPBA 1B3SA 1D6ZA 3WDGB 1R4CA 3T8UA 1FUSA 1LRAA 3RGAA 3ZG0A 1UCJA 3ZFZA 1LOYA 1Q864 1X1XA 2CFWA 5D83A 4HOHA 5IERA 5JPPA 1JKGA 2K3DA 3D4AA 3BB9A 2B1XB 1G02A 2O9UX 1Q7HA 5KP4A 2GU1A 3GAXA 3NBRA 1C7HA 1KSIA 1UCKA 3K5TA 6STDA 5BU4A 1NU3A 3KSED 5IW9A 2HMJB 2Z76A 1AY7A 1MNLA 1Q42A 5KP3A 1OPYA 3G6E3 3NQYA 1FGQA 1N5HA 4K1VA 1VQN3 3IPTA 3PZWA 3CNXA 3HZPA 4EBGA 4XDVA 1K8A4 3DMCA 2OTJ3 1I70A 1LOWA 1U5OA 3BNCA 3HOHA 2UGIA 2GBWB 1K41A 2RSXA 2IUJA 4STDA 1DVCA 1PFPA 3PYJA 1VQ73 1LOXA 1YIJ3 1UUWB 4LMIA 2OTL3 1Q40A 2HOHA 3U1WA 5RNTA 1FZUA 1NO3A 4OVMA 3EQQB 1N8QA 2HMLB 4O02B 1IQ8A 1RLSA 1O7NB 2XFTA 3F7XA 1G96A 1SQWA 1YGWA 3GSPA 1KWIA 1RCLA 3D9RA 2L4VA 1QVG2 2Z6BA 5IF6A 2K0MA 3S5CA 1FUWA 5AIIA 2WO0A 4EV2A 1BSDA 3SVAA 5AIHA 1N9EA 2OOVA 5EEOA 1RN1A 4BIRA 4WWUC 1CYVA 3MKIA 4RNYA 3UJMA 4CPKA 2KF5A 1M9GA 1BRKA 3BIRA 5CK6A 2OQEC 3URPA 1LNIA 4AEQA 1GOYA 1O7WB 2STDA 4JRFA 3OWSA 2H0IA 1WQLB 1EUIC 1TFKA 3WOFB 3A76A 1RN4A 3EB8A 4HM7B 4L7KA 3SOYA 1Q7Y4 1MGRA 2AAEA 2CWTA 1GS3A 5HGRA 6GSPA 2W2CA 2E2VA 1UGHI 2KRTA 1T3BA 2CHCA 3LMLA 1RGKA 5LC7A 1N8R4 3PCRA 3LYGA 1RNBA 3FF0A 3LXUX 3OWUA 1W00A 1DMMA 1Z1SA 3AMOA 2CIUA 4WYKB 3JUMA 5DRVA 1TRPA 4QWTA 4KZ1A 3G713 5HOHA 2C11A 5BXQA 4I4KA 1ASKA 3DM8A 3AHWA 3SLUA 1OGXA 3HIGA 5STDA 1FYSA 4RZMA 1BRIA 4NREA 4HM4B 2YFIB 3T0UA 5CF1A 1BVIA 2YX9A 1BUQA 3OV4A 3NQZA 4HM2B 4HZBB 1Q814 1C54A 4MMZB 1IDPA 4FCMA 3WHOA 1RCKA 2SBLA 3N54B 1VQ63 3DZLA 3ROBA 1ZO2A 2A15A 1I2GA 3CD63 1GY6A 2UX0A 3CME3 4IIAA 1IQYA 5CXOA 4J9AA 4N6MA 2HMMB 1HU9A 4J5KA 1VQL3 2WOHA 3D79A 3S67A 4HAAA 4XB5A 2V1LA 3ECFA 1IYYA 1I2FA 3JUQA 5IG5A 3F9SA 9RNTA 4AKZA 5JPUA 2CFLA 2F56A 3D3LA 3HK4A 1SARA 1BNSA 1BNJA 2IYJA 3AHSA 1S5AA 1I3FA 4LZIA 1A67A 1E3RA 2CKFB 1GMQA 4RNZA 5IEOA 1GD4A 1GSPA 1OGZA 4R80A 2CWUA 5M1AA 3CCE3 2P38A 2F5MA 4O3VA 3ZG5A 4HBRA 1B2MA 1PY3A 1BNRA 1BSAA 1TP6A 1X1WA 1RDSA 1QVF2 2Y73A 3FSDA 2P09A 1LNHA 1V74A 4BTYA 1V58A 2QA43 1N9JA 2O3OA 1ZX2A 3NBBA 1DE3A 4HM8B 3WODG 2F99A 2GEYA 2W0QA 3PS8A 2XR8B 4O2HA 2XF3A 3GZBA 3UL5A 1JBTA 1Q40B 4K61A 2ZA4A 3WMDA 3CPOA 1NJI4 1IVXA 1RNTA 1L5GB 4RNTA 5EQLA 1BRGA 1STFI 1IK3A 1RSNA 3FKAA 3LZAA 4MMYB 4HKVB 4U13A 2IMJA 1HYFA 3DY5A 1GMPA 1UGIA 2K54A 1GOVA 2E2TA 3H51A 3NBJA 3E99A 1JJ22 2CWVA 3B7CA 5CLKA 2WOFA 3S28A 1BRJA 1O7HB 4L8OA 4LEHA 1ROAA 1WMNA 3SOAA 4GSPA 5TGNA 1AV4A 2Z77A 1AR0A 1O7GB 2OOVC 3EN1B 4HM6B 3F8HA 3WOEB 1MWTA 2GBXB 1X1UA 1IT7A 4IPBA 1MGWA 2FGTA 1FGTA 1OUNA 3FF2A 1FA3A 4WFOA 1WNHA 4FCJA 1TU5A 1GY5A 2J8XB 1DETA 3PCSA 2XH9A 4KVHA 3J7Yd 3U97A 3G16A 2ZL8A 3X3ZA 1DMNA 3UL6A 4FMCA 3S29A 1NB5I 3CC43 3LT8A 1T2HA 3AMOB 4N6TA 2W56B 1JN5A 3O8YA 5G2GA 4N6NB 3OX9A 1BIRA 2RBIA 1QMAA 1JZOA 2KF6A 3X40A 5AI1A 1F8NA 3MYTA 3ER7A 1A2VA 2RGQA 1UI7A 4BU4A 4KT3B 1BNIA 1GD3A 5G1KA 3Q1CA 5AEWB 3LTCA 2JDIH 2H0HA 2BMRB 1R4YA 2R4IA 4H61A 4N6UA 2JQ5A 1CQSA 2FXTA 4R1KA 2CFGA 1BANA 3VSYA 1RKYA 1VQO3 1TJDA 1LOVA 3CXC2 1BU4A 5A0OB 3LTBA 3MHEA 2F5WA 2PNCA 1Q9EA 2YFLB 3MWZA 5FW5A 7GSPA 1VZZA 3ALAA 4XBTA 2LYXA 2GSPA 3G8ZA 1NDOB 1U8CB 3V92A 1KQS2 2HMKB 2WGQA 5M18A 3BNBA 4ORLA 1D6YA 1FGRA 3K0ZA 1SJWA 3CPW2 4K1UA 1M1XB 2W56A 1PYLA 3EHCA 4X2HA 1O7PB 1SPUA 1YIT3 2CC3A 3OWYA 3EE1A 2IA7A 2CX0A 5ELUA 1E3VA 1SIHA 2QIYA 3AGNA 4NHFA 3GRDA 2ML6A 1OHPA 1CEWI 2H0GA 3L0RA 3V98A 2CW9A 4XDWA 1RMSA 1ROVA 1Q824 3F40A 1LQMB 1NNVA 4LYLB 2BMOB 1OHSA 3T8NA 4EW5A 5JBSA 3A5EA 3RGRA 1W4NA 3JUPA 1RRLA 5ELJA 3EX9A 3MG1A 1OACA 4HM3B 1RGAA 1JB2A 4DKIA 5GSPA 5G1LA 1BRSA 3V99A 2L1SA 2Y74A 1B20A 1N5PA 4FR9A 1UW1A 1VQQA 1A90A 3BU4A 3KIIA 5D82A 3OW22 4HVNA 1UUVB 3EBYA 2CX1A 1PU4A 4HM1B 3CU3A 3PXMA 2GU3A 2CFKA 2ML5A 1US1A 1B2SA 4HYZA 1YHQ3 3MG3A 2W9PA 3RDEA 4MEIA 1AVLA 2KF4A 2MF7A 4CDLA 3DH2A 2FNQA 1AQZA 3X3XA 3EJVA 4JF8A 3KKGA 1T2IA 1YI23 1M904 5KP1A 3JUOA 3TDGA 1Y4KA 2RNTA 1YVSA 4I5QA 2Z7AA 2KXGA 3WA2X 1B2UA 2LQVA 4AKYA 1NB3I 5IEPA 3N8BA 2INXA 8RNTA 3BNEA 1TIJA 1UUGB 1D6UA 1RJOA 3BLZA 4HJLB 1QALA 1RGLA 3M8CA 4N6V0 4XBXA 3I553 2KAAA 1UCLA 1HZ1A 1I3IA 3D5IA 3MG2A 3BNDA 2B24B 4H3UA 1IT8A 1RN7A 3CC73 2XGLA 1JN5B 4X2OA 1W2B2 1MOLA
chains in the Genus database with same CATH topology
3DGOA 4BTXA 1K9M4 5IG0A 2F86B 1EG9B 1M1K4 3CC23 3LOYA 3CCJ3 3JUNA 3CMA3 4XM4A 1VQM3 4HM5B 3B8LA 3FGYA 1FGOA 1SIIA 3I0YA 5BVBA 3NV0A 1DYUA 1W5ZA 2ZDJA 3CCM3 3Q2PA 1W2ZA 3K63A 2M7OA 3H3HA 4WHAA 1LVNA 2CG1A 5IG4A 1OF5A 1RRHA 1WTHA 4IT7A 3G4S3 3Q90A 5CF2A 3FG1A 1W01A 1UI8A 5AIFA 1LXEA 2GEXA 2I9WA 1W7CA 8CHOA 4KFEA 4HZ9B 3NUVA 3B4OA 4FCZA 2XEPA 3CCV3 3MSOA 1VQ43 4LSOA 1OHOA 2WGOA 2XRXB 1S723 3EC9A 4KFDA 2E2UA 2IUKA 4TX4A 2D42A 3CCL3 2XSHB 1A2KA 4G1MB 1IVWA 1IV7A 4OK0A 1YJ93 3DGNA 3QRDA 3GZRA 4FMDA 2MC8A 1WMPA 2GXFA 1GYBA 3SX1A 1QAKA 5EVHA 4RBNA 1KC84 1K734 3JVCA 1EQKA 1OCVA 4OUQA 3X3YA 1YGEA 3HI7A 1VQ93 1JNQA 3NX0A 3VF1A 1JV2B 4FMBA 4K90B 4XBYA 3KE7A 4O8SA 1ULIB 3F8XA 2CFDA 2XGNA 3KN4A 3KZTA 4N6OB 1YJW3 2RCDA 3FLJA 1YVBI 2W9QA 3S27A 3FH1A 1JB5A 1QJGA 4WP5A 1JRQA 4HM0B 4MMXB 5LC6A 5IENA 3I563 2HMNB 3NM2A 1ISKA 1GY7A 4KFFA 3IMAB 3OXAA 3FZWA 5IG3A 1KD14 2F98A 3KSPA 1W6YA 3SEDA 4R9KA 5AYRB 4EC6A 3NM7A 3N9HA 1YJN3 3F14A 2YFJB 2CH9A 2XSOB 3EBTA 7STDA 1O7MB 4EXRA 1AVKA 4LGQA 2PZVA 3FCSB 1JB4A 4R9LA 4N3VA 1T5YA 3PGBA 1DVDA 3KFQC 3HX8A 3WA3A 2HMOB 1W6CA 3QK9A 1VQP3 4ZM8A 2BT3A 2QEX3 1IV9A 2BMQB 2BO9B 1IVUA 3K7CA 1TFOA 1NWWA 3DGLA 3GZYB 5AYSC 3VGNA 1E97A 4CCVA 1EKMA 1VQK3 3G0KA 4R4KA 3B4PA 3NV0B 3HIIA 3LT9A 3EN8A 3NXJA 4GL6A 4MJDA 1TUHA 5AEUB 2OQEA 4EYCA 1QAFA 2XFSA 3K9MC 3CCQ3 2P0MA 4L8PA 1OF5B 2OWPA 3UB1A 4GB5A 2P0XA 4PEJA 1CYUA 2QGUA 3UNLA 2KCDA 1HKXA 1W6GA 2BNGA 3NHXA 2Q07A 3LTAA 4N6LA 3SXXA 3CCR3 1JKGB 5DREA 2BHMA 2D1WA 3EF8A 2W6JH 4WYKA 2W04A 3IJEB 2CG0A 1VQ53 1IQXA 1OH0A 2RFRA 5I97A 3LH4A 3FG3A 4BTWA 1K28A 1EA2A 3X42A 2C10A 3DUKA 3DGMA 3LTDA 3DXOA 2W03A 2P05A 1ULJB 2CK3H 1IU7A 3GWRA 5D81A 3CNMA 1DMQA 3CCU3 1J2BA 3F7SA 1WMOA 1W02A 4J8TA 3FG4A 4FMAA 3STDA 3CCS3 3X41A 1STDA 4EV5A 1FGMA 1VQ83 3GZXB 5FGOA 4Q53A 1IVVA 2OCTA 3MPHA 5AIGA 1D6ZA 3WDGB 1R4CA 3T8UA 3RGAA 1Q864 2CFWA 5D83A 5IERA 5JPPA 1JKGA 3BB9A 2B1XB 2O9UX 5KP4A 2GU1A 3GAXA 3NBRA 1C7HA 1KSIA 3K5TA 6STDA 1NU3A 3KSED 5IW9A 2HMJB 2Z76A 1MNLA 1Q42A 5KP3A 1OPYA 3G6E3 3NQYA 1FGQA 1N5HA 4K1VA 1VQN3 3IPTA 3PZWA 3CNXA 3HZPA 4EBGA 4XDVA 1K8A4 3DMCA 2OTJ3 1U5OA 3BNCA 2GBWB 1K41A 2RSXA 2IUJA 4STDA 1DVCA 1PFPA 3PYJA 1VQ73 1LOXA 1YIJ3 1UUWB 4LMIA 2OTL3 1Q40A 3U1WA 1NO3A 4OVMA 3EQQB 1N8QA 2HMLB 4O02B 1IQ8A 1O7NB 2XFTA 3F7XA 1G96A 1SQWA 1KWIA 1QVG2 3D9RA 2L4VA 2Z6BA 5IF6A 2K0MA 3S5CA 1FUWA 5AIIA 2WO0A 4EV2A 3SVAA 5AIHA 1N9EA 2OOVA 5EEOA 4WWUC 1CYVA 3MKIA 4RNYA 3UJMA 1M9GA 5CK6A 2OQEC 4AEQA 1O7WB 2STDA 4JRFA 3OWSA 1WQLB 1TFKA 3WOFB 3A76A 3EB8A 4HM7B 3SOYA 4L7KA 1Q7Y4 2CWTA 1GS3A 5HGRA 2W2CA 2E2VA 2KRTA 2CHCA 3LMLA 5LC7A 1N8R4 3PCRA 3LYGA 3FF0A 3LXUX 3OWUA 1W00A 1DMMA 1Z1SA 3AMOA 2CIUA 4WYKB 3JUMA 5DRVA 4QWTA 4KZ1A 3G713 2C11A 5BXQA 4I4KA 1ASKA 3DM8A 3SLUA 1OGXA 3HIGA 5STDA 4RZMA 4NREA 4HM4B 2YFIB 3T0UA 5CF1A 2YX9A 1BUQA 3OV4A 3NQZA 4HM2B 4HZBB 1Q814 4MMZB 1IDPA 4FCMA 2SBLA 3N54B 1VQ63 3DZLA 3ROBA 1ZO2A 2A15A 3CD63 1GY6A 2UX0A 3CME3 4IIAA 1IQYA 5CXOA 4J9AA 4N6MA 2HMMB 1HU9A 1VQL3 2WOHA 3S67A 4XB5A 2V1LA 3ECFA 3JUQA 5IG5A 3F9SA 4AKZA 5JPUA 2CFLA 3D3LA 3HK4A 4LZIA 1S5AA 1A67A 1E3RA 2CKFB 4RNZA 5IEOA 1GD4A 1OGZA 4R80A 2CWUA 3CCE3 2P38A 4O3VA 4HBRA 1TP6A 1QVF2 2Y73A 3FSDA 2P09A 1LNHA 1V74A 4BTYA 2QA43 1N9JA 2O3OA 1ZX2A 3NBBA 4HM8B 3WODG 2F99A 2GEYA 2W0QA 3PS8A 2XR8B 4O2HA 2XF3A 3GZBA 3UL5A 1Q40B 4K61A 3WMDA 3CPOA 1NJI4 1IVXA 1L5GB 5EQLA 1STFI 1IK3A 3FKAA 3LZAA 4MMYB 4HKVB 4U13A 2IMJA 3DY5A 2K54A 3H51A 2E2TA 3NBJA 3E99A 1JJ22 2CWVA 3B7CA 5CLKA 2WOFA 3S28A 1O7HB 4L8OA 4LEHA 1ROAA 1WMNA 3SOAA 5TGNA 1AV4A 2Z77A 1AR0A 1O7GB 2OOVC 3EN1B 4HM6B 3F8HA 3WOEB 2GBXB 1IT7A 4IPBA 2FGTA 1FGTA 1OUNA 3FF2A 1FA3A 4WFOA 1WNHA 4FCJA 1TU5A 1GY5A 4KVHA 3PCSA 2XH9A 3J7Yd 3U97A 3G16A 2ZL8A 3X3ZA 1DMNA 3UL6A 4FMCA 3S29A 1NB5I 3CC43 3LT8A 3AMOB 4N6TA 2W56B 1JN5A 3O8YA 5G2GA 4N6NB 3OX9A 1QMAA 3X40A 5AI1A 1F8NA 3MYTA 3ER7A 1A2VA 2RGQA 1UI7A 1GD3A 3Q1CA 5AEWB 3LTCA 2JDIH 2BMRB 2R4IA 4H61A 4N6UA 2JQ5A 1CQSA 2FXTA 4R1KA 2CFGA 3VSYA 1RKYA 1VQO3 3CXC2 5A0OB 3LTBA 3MHEA 2PNCA 2YFLB 3MWZA 5FW5A 1VZZA 3ALAA 4XBTA 2LYXA 3G8ZA 1NDOB 1U8CB 3V92A 1KQS2 2HMKB 2WGQA 3BNBA 4ORLA 1D6YA 1FGRA 3K0ZA 1SJWA 3CPW2 4K1UA 1M1XB 2W56A 3EHCA 4X2HA 1YIT3 1O7PB 1SPUA 2CC3A 3OWYA 3EE1A 2IA7A 5ELUA 1E3VA 1SIHA 2QIYA 4NHFA 3GRDA 2ML6A 1OHPA 1CEWI 3L0RA 3V98A 2CW9A 4XDWA 1ROVA 1Q824 3F40A 2BMOB 1OHSA 3T8NA 5JBSA 3RGRA 1W4NA 3JUPA 1RRLA 5ELJA 3EX9A 3MG1A 1OACA 4HM3B 1JB2A 3V99A 2Y74A 1N5PA 4FR9A 1UW1A 1A90A 3KIIA 5D82A 3OW22 4HVNA 1UUVB 3EBYA 1PU4A 4HM1B 3CU3A 3PXMA 2GU3A 2CFKA 2ML5A 1US1A 4HYZA 1YHQ3 3MG3A 2W9PA 3RDEA 4MEIA 1AVLA 2MF7A 4CDLA 2FNQA 3X3XA 3EJVA 4JF8A 3KKGA 1YI23 1M904 5KP1A 3JUOA 3TDGA 1Y4KA 2Z7AA 2KXGA 3WA2X 5IEPA 2LQVA 4AKYA 1NB3I 3N8BA 2INXA 3BNEA 1TIJA 1D6UA 1RJOA 3BLZA 4HJLB 1QALA 4N6V0 3M8CA 4XBXA 3I553 3MG2A 3BNDA 2B24B 4H3UA 1IT8A 1RN7A 3CC73 2XGLA 1JN5B 4X2OA 1W2B2 1MOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IG0 A;  2F86 B;  1EG9 B;  3JUN A;  4XM4 A;  4HM5 B;  3B8L A;  3FGY A;  3I0Y A;  5BVB A;  3NV0 A;  3H3H A;  5IG4 A;  1OF5 A;  3Q90 A;  5CF2 A;  1W01 A;  5AIF A;  2GEX A;  2I9W A;  8CHO A;  4HZ9 B;  3NUV A;  3B4O A;  3MSO A;  1OHO A;  2XRX B;  3EC9 A;  2XSH B;  1A2K A;  3GZR A;  2GXF A;  1GYB A;  5EVH A;  1OCV A;  4OUQ A;  4XBY A;  3KE7 A;  1ULI B;  3F8X A;  3KZT A;  2RCD A;  3FLJ A;  3FH1 A;  1JB5 A;  1QJG A;  4WP5 A;  4HM0 B;  5IEN A;  2HMN B;  3NM2 A;  1ISK A;  1GY7 A;  3OXA A;  3FZW A;  5IG3 A;  2F98 A;  3KSP A;  1W6Y A;  3SED A;  4R9K A;  3F14 A;  2YFJ B;  3EBT A;  2XSO B;  7STD A;  1O7M B;  4LGQ A;  2PZV A;  1JB4 A;  4R9L A;  4N3V A;  3HX8 A;  2HMO B;  2BMQ B;  3K7C A;  1NWW A;  3GZY B;  3VGN A;  1E97 A;  3G0K A;  3B4P A;  3NV0 B;  3NXJ A;  3EN8 A;  5AEU B;  4MJD A;  1TUH A;  4L8P A;  1OF5 B;  2OWP A;  4GB5 A;  4PEJ A;  2QGU A;  3UNL A;  1HKX A;  2BNG A;  3NHX A;  1JKG B;  5DRE A;  3EF8 A;  4WYK A;  1OH0 A;  2RFR A;  1EA2 A;  3DUK A;  3DXO A;  1ULJ B;  3GWR A;  5D81 A;  3CNM A;  1DMQ A;  3F7S A;  1W02 A;  4J8T A;  3STD A;  1STD A;  3GZX B;  4Q53 A;  5AIG A;  3T8U A;  3RGA A;  5D83 A;  5IER A;  5JPP A;  1JKG A;  3BB9 A;  2B1X B;  5KP4 A;  3NBR A;  1C7H A;  6STD A;  1NU3 A;  2HMJ B;  2Z76 A;  1Q42 A;  5KP3 A;  1OPY A;  4K1V A;  3IPT A;  3CNX A;  3HZP A;  4XDV A;  3DMC A;  1U5O A;  2GBW B;  1K41 A;  4STD A;  1UUW B;  4LMI A;  1Q40 A;  4OVM A;  3EQQ B;  2HML B;  1O7N B;  3F7X A;  3D9R A;  5IF6 A;  3S5C A;  5AII A;  5AIH A;  4WWU C;  3MKI A;  3UJM A;  5CK6 A;  1O7W B;  2STD A;  3OWS A;  1WQL B;  3A76 A;  4HM7 B;  3SOY A;  4L7K A;  1GS3 A;  5HGR A;  2W2C A;  2CHC A;  3LYG A;  3FF0 A;  3OWU A;  1W00 A;  1DMM A;  1Z1S A;  4WYK B;  3JUM A;  5DRV A;  5BXQ A;  4I4K A;  1ASK A;  3DM8 A;  1OGX A;  5STD A;  4RZM A;  4HM4 B;  2YFI B;  5CF1 A;  1BUQ A;  3OV4 A;  4HM2 B;  4HZB B;  1IDP A;  4FCM A;  3DZL A;  3ROB A;  1ZO2 A;  2A15 A;  1GY6 A;  2UX0 A;  4IIA A;  5CXO A;  4J9A A;  2HMM B;  4XB5 A;  3ECF A;  3JUQ A;  5IG5 A;  3F9S A;  5JPU A;  3HK4 A;  1S5A A;  1E3R A;  2CKF B;  5IEO A;  1OGZ A;  1TP6 A;  3FSD A;  1ZX2 A;  4HM8 B;  2F99 A;  2GEY A;  2XR8 B;  3GZB A;  1Q40 B;  3WMD A;  3CPO A;  3FKA A;  3LZA A;  4U13 A;  4HKV B;  2IMJ A;  2K54 A;  3H51 A;  3E99 A;  3B7C A;  5CLK A;  1O7H B;  4L8O A;  4LEH A;  3SOA A;  5TGN A;  2Z77 A;  1AR0 A;  1O7G B;  3EN1 B;  4HM6 B;  3F8H A;  2GBX B;  1OUN A;  3FF2 A;  4FCJ A;  1GY5 A;  4KVH A;  3G16 A;  1DMN A;  1JN5 A;  5G2G A;  3OX9 A;  1QMA A;  5AI1 A;  3MYT A;  3ER7 A;  2RGQ A;  5AEW B;  2BMR B;  2R4I A;  2JQ5 A;  1CQS A;  4R1K A;  3VSY A;  3MHE A;  2YFL B;  5FW5 A;  1VZZ A;  4XBT A;  3G8Z A;  1NDO B;  2HMK B;  4ORL A;  3K0Z A;  1SJW A;  4K1U A;  3EHC A;  4X2H A;  1O7P B;  3OWY A;  1E3V A;  2QIY A;  3GRD A;  1OHP A;  4XDW A;  3F40 A;  2BMO B;  1OHS A;  3T8N A;  3RGR A;  3JUP A;  3EX9 A;  3MG1 A;  4HM3 B;  1JB2 A;  5D82 A;  4HVN A;  1UUV B;  3EBY A;  4HM1 B;  3CU3 A;  3MG3 A;  4CDL A;  3EJV A;  3KKG A;  5KP1 A;  3JUO A;  2Z7A A;  5IEP A;  2INX A;  3BLZ A;  4HJL B;  3M8C A;  4XBX A;  3MG2 A;  2B24 B;  4H3U A;  1JN5 B;  4X2O A; 
#chains in the Genus database with same CATH topology
 3DGO A;  4BTX A;  1K9M 4;  5IG0 A;  2F86 B;  1EG9 B;  1M1K 4;  1BOX A;  3CC2 3;  3LOY A;  3CCJ 3;  3JUN A;  3CMA 3;  1BNG A;  2UUG C;  3RNT A;  4XM4 A;  1VQM 3;  4HM5 B;  4BL3 A;  1BRH A;  3B8L A;  3FGY A;  1G0T A;  1FGO A;  1SII A;  3I0Y A;  5BVB A;  3NV0 A;  1DYU A;  1W5Z A;  2ZDJ A;  2BU4 A;  1RTU A;  3SYU A;  3CCM 3;  1RGE A;  3Q2P A;  1W2Z A;  3K63 A;  2BIR A;  2M7O A;  3H3H A;  4WHA A;  1LVN A;  2CG1 A;  5IG4 A;  1OF5 A;  2SAR A;  1RRH A;  1WTH A;  4IT7 A;  3G4S 3;  3Q90 A;  5CF2 A;  1ZS7 A;  2KF3 A;  3FG1 A;  1W01 A;  1BGS A;  1UI8 A;  1LQG C;  4CJN A;  5AIF A;  1CH0 A;  1LXE A;  2GEX A;  2I9W A;  1BNE A;  2C4B A;  1W7C A;  8CHO A;  1I0V A;  3AGO A;  4HZ9 B;  4KFE A;  1A2P A;  3B4O A;  3NUV A;  2XEP A;  4FCZ A;  3MSO A;  3CCV 3;  4LSO A;  1OHO A;  1TTO A;  2WGO A;  2XRX B;  3WR2 A;  1MWU A;  3EC9 A;  1S72 3;  4KFD A;  2ZHX B;  2E2U A;  2IUK A;  1GMR A;  3I56 3;  4TX4 A;  2D42 A;  3CCL 3;  1RGC A;  2XSH B;  1MWS A;  1A2K A;  6RNT A;  4G1M B;  4GHO A;  1IVW A;  1IV7 A;  4OK0 A;  1YJ9 3;  3DGN A;  3QRD A;  3GZR A;  4FMD A;  2MC8 A;  1WMP A;  2GXF A;  1GYB A;  3SX1 A;  1QAK A;  1JBS A;  5EVH A;  4RBN A;  1RGF A;  1KC8 4;  1K73 4;  3JVC A;  1I0X A;  1EQK A;  1OCV A;  4OUQ A;  3X3Y A;  1YGE A;  1B2X A;  1MWR A;  3HI7 A;  1JNQ A;  3NX0 A;  3VF1 A;  1VQ9 3;  1FUT A;  1JV2 B;  4FMB A;  4K90 B;  4XBY A;  4ILF A;  2R41 A;  3KE7 A;  4O8S A;  1ULI B;  3F8X A;  2CFD A;  2XGN A;  3KN4 A;  1B27 A;  3KZT A;  4N6O B;  2RCD A;  1YJW 3;  3FLJ A;  1YVB I;  2W9Q A;  4BL2 A;  3S27 A;  3FH1 A;  1ZGX A;  1JB5 A;  1QJG A;  1I2E A;  1JRQ A;  4HM0 B;  4MMX B;  4WP5 A;  1UCI A;  5LC6 A;  2HMN B;  3NM2 A;  5IEN A;  1ISK A;  1GY7 A;  4KFF A;  1GOU A;  3IMA B;  3OXA A;  3FZW A;  5IG3 A;  1KD1 4;  2F98 A;  3KSP A;  1W6Y A;  3SED A;  4R9K A;  5AYR B;  4EC6 A;  3NM7 A;  3N9H A;  1YJN 3;  3F14 A;  1TRQ A;  2YFJ B;  2CH9 A;  2XSO B;  3EBT A;  5M19 A;  7STD A;  1BSE A;  1O7M B;  4EXR A;  1AVK A;  2AAD A;  3D5G A;  2PZV A;  4LGQ A;  3FCS B;  1JB4 A;  4R9L A;  4N3V A;  1T5Y A;  3PGB A;  1BRN L;  1DVD A;  3KFQ C;  3HX8 A;  3WA3 A;  2HMO B;  1W6C A;  3QK9 A;  3Q3F A;  1VQP 3;  1JBR A;  4ZM8 A;  2BT3 A;  1BAO A;  1IV9 A;  2BMQ B;  2QEX 3;  3KCH A;  2BO9 B;  1IVU A;  3K7C A;  1TFO A;  1NWW A;  1FW7 A;  1YNV X;  3DGL A;  1RHL A;  3GZY B;  5AYS C;  3VGN A;  1E97 A;  4CCV A;  1EKM A;  1VQK 3;  1BSB A;  1BSC A;  3G0K A;  4R4K A;  3B4P A;  7RNT A;  1I8V A;  3DGY A;  3NV0 B;  3HII A;  3LT9 A;  3EN8 A;  1BNF A;  3NXJ A;  4GL6 A;  1TUH A;  4MJD A;  2OQE A;  5AEU B;  4EYC A;  1QAF A;  1X1Y A;  2XFS A;  1VQ4 3;  3K9M C;  3CCQ 3;  2P0M A;  4L8P A;  1OF5 B;  2OWP A;  1JZD A;  3UB1 A;  4GB5 A;  2P0X A;  4J5G A;  4PEJ A;  1CYU A;  1B2Z A;  2QGU A;  3UNL A;  2KCD A;  1HKX A;  1W6G A;  2BNG A;  3NHX A;  2Q07 A;  3LTA A;  1BUJ A;  4N6L A;  3SXX A;  3CCR 3;  1JKG B;  5DRE A;  2BHM A;  2D1W A;  3EF8 A;  2W6J H;  4WYK A;  1RGH A;  1B21 A;  1UDI I;  5BIR A;  2W04 A;  3IJE B;  2CG0 A;  1VQ5 3;  1IQX A;  1OH0 A;  2RFR A;  5I97 A;  3LH4 A;  3FG3 A;  4BTW A;  1K28 A;  1EA2 A;  1RGG A;  2C10 A;  3DUK A;  3X42 A;  3DGM A;  1EEJ A;  2F4Y A;  3LTD A;  3DXO A;  2W03 A;  2P05 A;  1ULJ B;  2CK3 H;  1IU7 A;  3GWR A;  5D81 A;  3CNM A;  1DMQ A;  3CCU 3;  1J2B A;  3F7S A;  1WMO A;  1W02 A;  4J8T A;  3FG4 A;  4FMA A;  3STD A;  3CCS 3;  3X41 A;  1STD A;  4EV5 A;  1FGM A;  1VQ8 3;  3GZX B;  2IY2 A;  5FGO A;  4Q53 A;  1IVV A;  2OCT A;  3MPH A;  1V57 A;  5AIG A;  4NPB A;  1B3S A;  1D6Z A;  3WDG B;  1R4C A;  3T8U A;  1FUS A;  1LRA A;  3RGA A;  3ZG0 A;  1UCJ A;  3ZFZ A;  1LOY A;  1Q86 4;  1X1X A;  2CFW A;  5D83 A;  4HOH A;  5IER A;  5JPP A;  1JKG A;  2K3D A;  3D4A A;  3BB9 A;  2B1X B;  1G02 A;  2O9U X;  1Q7H A;  5KP4 A;  2GU1 A;  3GAX A;  3NBR A;  1C7H A;  1KSI A;  1UCK A;  3K5T A;  6STD A;  5BU4 A;  1NU3 A;  3KSE D;  5IW9 A;  2HMJ B;  2Z76 A;  1AY7 A;  1MNL A;  1Q42 A;  5KP3 A;  1OPY A;  3G6E 3;  3NQY A;  1FGQ A;  1N5H A;  4K1V A;  1VQN 3;  3IPT A;  3PZW A;  3CNX A;  3HZP A;  4EBG A;  4XDV A;  1K8A 4;  3DMC A;  2OTJ 3;  1I70 A;  1LOW A;  1U5O A;  3BNC A;  3HOH A;  2UGI A;  2GBW B;  1K41 A;  2RSX A;  2IUJ A;  4STD A;  1DVC A;  1PFP A;  3PYJ A;  1VQ7 3;  1LOX A;  1YIJ 3;  1UUW B;  4LMI A;  2OTL 3;  1Q40 A;  2HOH A;  3U1W A;  5RNT A;  1FZU A;  1NO3 A;  4OVM A;  3EQQ B;  1N8Q A;  2HML B;  4O02 B;  1IQ8 A;  1RLS A;  1O7N B;  2XFT A;  3F7X A;  1G96 A;  1SQW A;  1YGW A;  3GSP A;  1KWI A;  1RCL A;  3D9R A;  2L4V A;  1QVG 2;  2Z6B A;  5IF6 A;  2K0M A;  3S5C A;  1FUW A;  5AII A;  2WO0 A;  4EV2 A;  1BSD A;  3SVA A;  5AIH A;  1N9E A;  2OOV A;  5EEO A;  1RN1 A;  4BIR A;  4WWU C;  1CYV A;  3MKI A;  4RNY A;  3UJM A;  4CPK A;  2KF5 A;  1M9G A;  1BRK A;  3BIR A;  5CK6 A;  2OQE C;  3URP A;  1LNI A;  4AEQ A;  1GOY A;  1O7W B;  2STD A;  4JRF A;  3OWS A;  2H0I A;  1WQL B;  1EUI C;  1TFK A;  3WOF B;  3A76 A;  1RN4 A;  3EB8 A;  4HM7 B;  4L7K A;  3SOY A;  1Q7Y 4;  1MGR A;  2AAE A;  2CWT A;  1GS3 A;  5HGR A;  6GSP A;  2W2C A;  2E2V A;  1UGH I;  2KRT A;  1T3B A;  2CHC A;  3LML A;  1RGK A;  5LC7 A;  1N8R 4;  3PCR A;  3LYG A;  1RNB A;  3FF0 A;  3LXU X;  3OWU A;  1W00 A;  1DMM A;  1Z1S A;  3AMO A;  2CIU A;  4WYK B;  3JUM A;  5DRV A;  1TRP A;  4QWT A;  4KZ1 A;  3G71 3;  5HOH A;  2C11 A;  5BXQ A;  4I4K A;  1ASK A;  3DM8 A;  3AHW A;  3SLU A;  1OGX A;  3HIG A;  5STD A;  1FYS A;  4RZM A;  1BRI A;  4NRE A;  4HM4 B;  2YFI B;  3T0U A;  5CF1 A;  1BVI A;  2YX9 A;  1BUQ A;  3OV4 A;  3NQZ A;  4HM2 B;  4HZB B;  1Q81 4;  1C54 A;  4MMZ B;  1IDP A;  4FCM A;  3WHO A;  1RCK A;  2SBL A;  3N54 B;  1VQ6 3;  3DZL A;  3ROB A;  1ZO2 A;  2A15 A;  1I2G A;  3CD6 3;  1GY6 A;  2UX0 A;  3CME 3;  4IIA A;  1IQY A;  5CXO A;  4J9A A;  4N6M A;  2HMM B;  1HU9 A;  4J5K A;  1VQL 3;  2WOH A;  3D79 A;  3S67 A;  4HAA A;  4XB5 A;  2V1L A;  3ECF A;  1IYY A;  1I2F A;  3JUQ A;  5IG5 A;  3F9S A;  9RNT A;  4AKZ A;  5JPU A;  2CFL A;  2F56 A;  3D3L A;  3HK4 A;  1SAR A;  1BNS A;  1BNJ A;  2IYJ A;  3AHS A;  1S5A A;  1I3F A;  4LZI A;  1A67 A;  1E3R A;  2CKF B;  1GMQ A;  4RNZ A;  5IEO A;  1GD4 A;  1GSP A;  1OGZ A;  4R80 A;  2CWU A;  5M1A A;  3CCE 3;  2P38 A;  2F5M A;  4O3V A;  3ZG5 A;  4HBR A;  1B2M A;  1PY3 A;  1BNR A;  1BSA A;  1TP6 A;  1X1W A;  1RDS A;  1QVF 2;  2Y73 A;  3FSD A;  2P09 A;  1LNH A;  1V74 A;  4BTY A;  1V58 A;  2QA4 3;  1N9J A;  2O3O A;  1ZX2 A;  3NBB A;  1DE3 A;  4HM8 B;  3WOD G;  2F99 A;  2GEY A;  2W0Q A;  3PS8 A;  2XR8 B;  4O2H A;  2XF3 A;  3GZB A;  3UL5 A;  1JBT A;  1Q40 B;  4K61 A;  2ZA4 A;  3WMD A;  3CPO A;  1NJI 4;  1IVX A;  1RNT A;  1L5G B;  4RNT A;  5EQL A;  1BRG A;  1STF I;  1IK3 A;  1RSN A;  3FKA A;  3LZA A;  4MMY B;  4HKV B;  4U13 A;  2IMJ A;  1HYF A;  3DY5 A;  1GMP A;  1UGI A;  2K54 A;  1GOV A;  2E2T A;  3H51 A;  3NBJ A;  3E99 A;  1JJ2 2;  2CWV A;  3B7C A;  5CLK A;  2WOF A;  3S28 A;  1BRJ A;  1O7H B;  4L8O A;  4LEH A;  1ROA A;  1WMN A;  3SOA A;  4GSP A;  5TGN A;  1AV4 A;  2Z77 A;  1AR0 A;  1O7G B;  2OOV C;  3EN1 B;  4HM6 B;  3F8H A;  3WOE B;  1MWT A;  2GBX B;  1X1U A;  1IT7 A;  4IPB A;  1MGW A;  2FGT A;  1FGT A;  1OUN A;  3FF2 A;  1FA3 A;  4WFO A;  1WNH A;  4FCJ A;  1TU5 A;  1GY5 A;  2J8X B;  1DET A;  3PCS A;  2XH9 A;  4KVH A;  3J7Y d;  3U97 A;  3G16 A;  2ZL8 A;  3X3Z A;  1DMN A;  3UL6 A;  4FMC A;  3S29 A;  1NB5 I;  3CC4 3;  3LT8 A;  1T2H A;  3AMO B;  4N6T A;  2W56 B;  1JN5 A;  3O8Y A;  5G2G A;  4N6N B;  3OX9 A;  1BIR A;  2RBI A;  1QMA A;  1JZO A;  2KF6 A;  3X40 A;  5AI1 A;  1F8N A;  3MYT A;  3ER7 A;  1A2V A;  2RGQ A;  1UI7 A;  4BU4 A;  4KT3 B;  1BNI A;  1GD3 A;  5G1K A;  3Q1C A;  5AEW B;  3LTC A;  2JDI H;  2H0H A;  2BMR B;  1R4Y A;  2R4I A;  4H61 A;  4N6U A;  2JQ5 A;  1CQS A;  2FXT A;  4R1K A;  2CFG A;  1BAN A;  3VSY A;  1RKY A;  1VQO 3;  1TJD A;  1LOV A;  3CXC 2;  1BU4 A;  5A0O B;  3LTB A;  3MHE A;  2F5W A;  2PNC A;  1Q9E A;  2YFL B;  3MWZ A;  5FW5 A;  7GSP A;  1VZZ A;  3ALA A;  4XBT A;  2LYX A;  2GSP A;  3G8Z A;  1NDO B;  1U8C B;  3V92 A;  1KQS 2;  2HMK B;  2WGQ A;  5M18 A;  3BNB A;  4ORL A;  1D6Y A;  1FGR A;  3K0Z A;  1SJW A;  3CPW 2;  4K1U A;  1M1X B;  2W56 A;  1PYL A;  3EHC A;  4X2H A;  1O7P B;  1SPU A;  1YIT 3;  2CC3 A;  3OWY A;  3EE1 A;  2IA7 A;  2CX0 A;  5ELU A;  1E3V A;  1SIH A;  2QIY A;  3AGN A;  4NHF A;  3GRD A;  2ML6 A;  1OHP A;  1CEW I;  2H0G A;  3L0R A;  3V98 A;  2CW9 A;  4XDW A;  1RMS A;  1ROV A;  1Q82 4;  3F40 A;  1LQM B;  1NNV A;  4LYL B;  2BMO B;  1OHS A;  3T8N A;  4EW5 A;  5JBS A;  3A5E A;  3RGR A;  1W4N A;  3JUP A;  1RRL A;  5ELJ A;  3EX9 A;  3MG1 A;  1OAC A;  4HM3 B;  1RGA A;  1JB2 A;  4DKI A;  5GSP A;  5G1L A;  1BRS A;  3V99 A;  2L1S A;  2Y74 A;  1B20 A;  1N5P A;  4FR9 A;  1UW1 A;  1VQQ A;  1A90 A;  3BU4 A;  3KII A;  5D82 A;  3OW2 2;  4HVN A;  1UUV B;  3EBY A;  2CX1 A;  1PU4 A;  4HM1 B;  3CU3 A;  3PXM A;  2GU3 A;  2CFK A;  2ML5 A;  1US1 A;  1B2S A;  4HYZ A;  1YHQ 3;  3MG3 A;  2W9P A;  3RDE A;  4MEI A;  1AVL A;  2KF4 A;  2MF7 A;  4CDL A;  3DH2 A;  2FNQ A;  1AQZ A;  3X3X A;  3EJV A;  4JF8 A;  3KKG A;  1T2I A;  1YI2 3;  1M90 4;  5KP1 A;  3JUO A;  3TDG A;  1Y4K A;  2RNT A;  1YVS A;  4I5Q A;  2Z7A A;  2KXG A;  3WA2 X;  1B2U A;  2LQV A;  4AKY A;  1NB3 I;  5IEP A;  3N8B A;  2INX A;  8RNT A;  3BNE A;  1TIJ A;  1UUG B;  1D6U A;  1RJO A;  3BLZ A;  4HJL B;  1QAL A;  1RGL A;  3M8C A;  4N6V 0;  4XBX A;  3I55 3;  2KAA A;  1UCL A;  1HZ1 A;  1I3I A;  3D5I A;  3MG2 A;  3BND A;  2B24 B;  4H3U A;  1IT8 A;  1RN7 A;  3CC7 3;  2XGL A;  1JN5 B;  4X2O A;  1W2B 2;  1MOL A; 
#chains in the Genus database with same CATH homology
 3DGO A;  4BTX A;  1K9M 4;  5IG0 A;  2F86 B;  1EG9 B;  1M1K 4;  3CC2 3;  3LOY A;  3CCJ 3;  3JUN A;  3CMA 3;  4XM4 A;  1VQM 3;  4HM5 B;  3B8L A;  3FGY A;  1FGO A;  1SII A;  3I0Y A;  5BVB A;  3NV0 A;  1DYU A;  1W5Z A;  2ZDJ A;  3CCM 3;  3Q2P A;  1W2Z A;  3K63 A;  2M7O A;  3H3H A;  4WHA A;  1LVN A;  2CG1 A;  5IG4 A;  1OF5 A;  1RRH A;  1WTH A;  4IT7 A;  3G4S 3;  3Q90 A;  5CF2 A;  3FG1 A;  1W01 A;  1UI8 A;  5AIF A;  1LXE A;  2GEX A;  2I9W A;  1W7C A;  8CHO A;  4KFE A;  4HZ9 B;  3NUV A;  3B4O A;  4FCZ A;  2XEP A;  3CCV 3;  3MSO A;  1VQ4 3;  4LSO A;  1OHO A;  2WGO A;  2XRX B;  1S72 3;  3EC9 A;  4KFD A;  2E2U A;  2IUK A;  4TX4 A;  2D42 A;  3CCL 3;  2XSH B;  1A2K A;  4G1M B;  1IVW A;  1IV7 A;  4OK0 A;  1YJ9 3;  3DGN A;  3QRD A;  3GZR A;  4FMD A;  2MC8 A;  1WMP A;  2GXF A;  1GYB A;  3SX1 A;  1QAK A;  5EVH A;  4RBN A;  1KC8 4;  1K73 4;  3JVC A;  1EQK A;  1OCV A;  4OUQ A;  3X3Y A;  1YGE A;  3HI7 A;  1VQ9 3;  1JNQ A;  3NX0 A;  3VF1 A;  1JV2 B;  4FMB A;  4K90 B;  4XBY A;  3KE7 A;  4O8S A;  1ULI B;  3F8X A;  2CFD A;  2XGN A;  3KN4 A;  3KZT A;  4N6O B;  1YJW 3;  2RCD A;  3FLJ A;  1YVB I;  2W9Q A;  3S27 A;  3FH1 A;  1JB5 A;  1QJG A;  4WP5 A;  1JRQ A;  4HM0 B;  4MMX B;  5LC6 A;  5IEN A;  3I56 3;  2HMN B;  3NM2 A;  1ISK A;  1GY7 A;  4KFF A;  3IMA B;  3OXA A;  3FZW A;  5IG3 A;  1KD1 4;  2F98 A;  3KSP A;  1W6Y A;  3SED A;  4R9K A;  5AYR B;  4EC6 A;  3NM7 A;  3N9H A;  1YJN 3;  3F14 A;  2YFJ B;  2CH9 A;  2XSO B;  3EBT A;  7STD A;  1O7M B;  4EXR A;  1AVK A;  4LGQ A;  2PZV A;  3FCS B;  1JB4 A;  4R9L A;  4N3V A;  1T5Y A;  3PGB A;  1DVD A;  3KFQ C;  3HX8 A;  3WA3 A;  2HMO B;  1W6C A;  3QK9 A;  1VQP 3;  4ZM8 A;  2BT3 A;  2QEX 3;  1IV9 A;  2BMQ B;  2BO9 B;  1IVU A;  3K7C A;  1TFO A;  1NWW A;  3DGL A;  3GZY B;  5AYS C;  3VGN A;  1E97 A;  4CCV A;  1EKM A;  1VQK 3;  3G0K A;  4R4K A;  3B4P A;  3NV0 B;  3HII A;  3LT9 A;  3EN8 A;  3NXJ A;  4GL6 A;  4MJD A;  1TUH A;  5AEU B;  2OQE A;  4EYC A;  1QAF A;  2XFS A;  3K9M C;  3CCQ 3;  2P0M A;  4L8P A;  1OF5 B;  2OWP A;  3UB1 A;  4GB5 A;  2P0X A;  4PEJ A;  1CYU A;  2QGU A;  3UNL A;  2KCD A;  1HKX A;  1W6G A;  2BNG A;  3NHX A;  2Q07 A;  3LTA A;  4N6L A;  3SXX A;  3CCR 3;  1JKG B;  5DRE A;  2BHM A;  2D1W A;  3EF8 A;  2W6J H;  4WYK A;  2W04 A;  3IJE B;  2CG0 A;  1VQ5 3;  1IQX A;  1OH0 A;  2RFR A;  5I97 A;  3LH4 A;  3FG3 A;  4BTW A;  1K28 A;  1EA2 A;  3X42 A;  2C10 A;  3DUK A;  3DGM A;  3LTD A;  3DXO A;  2W03 A;  2P05 A;  1ULJ B;  2CK3 H;  1IU7 A;  3GWR A;  5D81 A;  3CNM A;  1DMQ A;  3CCU 3;  1J2B A;  3F7S A;  1WMO A;  1W02 A;  4J8T A;  3FG4 A;  4FMA A;  3STD A;  3CCS 3;  3X41 A;  1STD A;  4EV5 A;  1FGM A;  1VQ8 3;  3GZX B;  5FGO A;  4Q53 A;  1IVV A;  2OCT A;  3MPH A;  5AIG A;  1D6Z A;  3WDG B;  1R4C A;  3T8U A;  3RGA A;  1Q86 4;  2CFW A;  5D83 A;  5IER A;  5JPP A;  1JKG A;  3BB9 A;  2B1X B;  2O9U X;  5KP4 A;  2GU1 A;  3GAX A;  3NBR A;  1C7H A;  1KSI A;  3K5T A;  6STD A;  1NU3 A;  3KSE D;  5IW9 A;  2HMJ B;  2Z76 A;  1MNL A;  1Q42 A;  5KP3 A;  1OPY A;  3G6E 3;  3NQY A;  1FGQ A;  1N5H A;  4K1V A;  1VQN 3;  3IPT A;  3PZW A;  3CNX A;  3HZP A;  4EBG A;  4XDV A;  1K8A 4;  3DMC A;  2OTJ 3;  1U5O A;  3BNC A;  2GBW B;  1K41 A;  2RSX A;  2IUJ A;  4STD A;  1DVC A;  1PFP A;  3PYJ A;  1VQ7 3;  1LOX A;  1YIJ 3;  1UUW B;  4LMI A;  2OTL 3;  1Q40 A;  3U1W A;  1NO3 A;  4OVM A;  3EQQ B;  1N8Q A;  2HML B;  4O02 B;  1IQ8 A;  1O7N B;  2XFT A;  3F7X A;  1G96 A;  1SQW A;  1KWI A;  1QVG 2;  3D9R A;  2L4V A;  2Z6B A;  5IF6 A;  2K0M A;  3S5C A;  1FUW A;  5AII A;  2WO0 A;  4EV2 A;  3SVA A;  5AIH A;  1N9E A;  2OOV A;  5EEO A;  4WWU C;  1CYV A;  3MKI A;  4RNY A;  3UJM A;  1M9G A;  5CK6 A;  2OQE C;  4AEQ A;  1O7W B;  2STD A;  4JRF A;  3OWS A;  1WQL B;  1TFK A;  3WOF B;  3A76 A;  3EB8 A;  4HM7 B;  3SOY A;  4L7K A;  1Q7Y 4;  2CWT A;  1GS3 A;  5HGR A;  2W2C A;  2E2V A;  2KRT A;  2CHC A;  3LML A;  5LC7 A;  1N8R 4;  3PCR A;  3LYG A;  3FF0 A;  3LXU X;  3OWU A;  1W00 A;  1DMM A;  1Z1S A;  3AMO A;  2CIU A;  4WYK B;  3JUM A;  5DRV A;  4QWT A;  4KZ1 A;  3G71 3;  2C11 A;  5BXQ A;  4I4K A;  1ASK A;  3DM8 A;  3SLU A;  1OGX A;  3HIG A;  5STD A;  4RZM A;  4NRE A;  4HM4 B;  2YFI B;  3T0U A;  5CF1 A;  2YX9 A;  1BUQ A;  3OV4 A;  3NQZ A;  4HM2 B;  4HZB B;  1Q81 4;  4MMZ B;  1IDP A;  4FCM A;  2SBL A;  3N54 B;  1VQ6 3;  3DZL A;  3ROB A;  1ZO2 A;  2A15 A;  3CD6 3;  1GY6 A;  2UX0 A;  3CME 3;  4IIA A;  1IQY A;  5CXO A;  4J9A A;  4N6M A;  2HMM B;  1HU9 A;  1VQL 3;  2WOH A;  3S67 A;  4XB5 A;  2V1L A;  3ECF A;  3JUQ A;  5IG5 A;  3F9S A;  4AKZ A;  5JPU A;  2CFL A;  3D3L A;  3HK4 A;  4LZI A;  1S5A A;  1A67 A;  1E3R A;  2CKF B;  4RNZ A;  5IEO A;  1GD4 A;  1OGZ A;  4R80 A;  2CWU A;  3CCE 3;  2P38 A;  4O3V A;  4HBR A;  1TP6 A;  1QVF 2;  2Y73 A;  3FSD A;  2P09 A;  1LNH A;  1V74 A;  4BTY A;  2QA4 3;  1N9J A;  2O3O A;  1ZX2 A;  3NBB A;  4HM8 B;  3WOD G;  2F99 A;  2GEY A;  2W0Q A;  3PS8 A;  2XR8 B;  4O2H A;  2XF3 A;  3GZB A;  3UL5 A;  1Q40 B;  4K61 A;  3WMD A;  3CPO A;  1NJI 4;  1IVX A;  1L5G B;  5EQL A;  1STF I;  1IK3 A;  3FKA A;  3LZA A;  4MMY B;  4HKV B;  4U13 A;  2IMJ A;  3DY5 A;  2K54 A;  3H51 A;  2E2T A;  3NBJ A;  3E99 A;  1JJ2 2;  2CWV A;  3B7C A;  5CLK A;  2WOF A;  3S28 A;  1O7H B;  4L8O A;  4LEH A;  1ROA A;  1WMN A;  3SOA A;  5TGN A;  1AV4 A;  2Z77 A;  1AR0 A;  1O7G B;  2OOV C;  3EN1 B;  4HM6 B;  3F8H A;  3WOE B;  2GBX B;  1IT7 A;  4IPB A;  2FGT A;  1FGT A;  1OUN A;  3FF2 A;  1FA3 A;  4WFO A;  1WNH A;  4FCJ A;  1TU5 A;  1GY5 A;  4KVH A;  3PCS A;  2XH9 A;  3J7Y d;  3U97 A;  3G16 A;  2ZL8 A;  3X3Z A;  1DMN A;  3UL6 A;  4FMC A;  3S29 A;  1NB5 I;  3CC4 3;  3LT8 A;  3AMO B;  4N6T A;  2W56 B;  1JN5 A;  3O8Y A;  5G2G A;  4N6N B;  3OX9 A;  1QMA A;  3X40 A;  5AI1 A;  1F8N A;  3MYT A;  3ER7 A;  1A2V A;  2RGQ A;  1UI7 A;  1GD3 A;  3Q1C A;  5AEW B;  3LTC A;  2JDI H;  2BMR B;  2R4I A;  4H61 A;  4N6U A;  2JQ5 A;  1CQS A;  2FXT A;  4R1K A;  2CFG A;  3VSY A;  1RKY A;  1VQO 3;  3CXC 2;  5A0O B;  3LTB A;  3MHE A;  2PNC A;  2YFL B;  3MWZ A;  5FW5 A;  1VZZ A;  3ALA A;  4XBT A;  2LYX A;  3G8Z A;  1NDO B;  1U8C B;  3V92 A;  1KQS 2;  2HMK B;  2WGQ A;  3BNB A;  4ORL A;  1D6Y A;  1FGR A;  3K0Z A;  1SJW A;  3CPW 2;  4K1U A;  1M1X B;  2W56 A;  3EHC A;  4X2H A;  1YIT 3;  1O7P B;  1SPU A;  2CC3 A;  3OWY A;  3EE1 A;  2IA7 A;  5ELU A;  1E3V A;  1SIH A;  2QIY A;  4NHF A;  3GRD A;  2ML6 A;  1OHP A;  1CEW I;  3L0R A;  3V98 A;  2CW9 A;  4XDW A;  1ROV A;  1Q82 4;  3F40 A;  2BMO B;  1OHS A;  3T8N A;  5JBS A;  3RGR A;  1W4N A;  3JUP A;  1RRL A;  5ELJ A;  3EX9 A;  3MG1 A;  1OAC A;  4HM3 B;  1JB2 A;  3V99 A;  2Y74 A;  1N5P A;  4FR9 A;  1UW1 A;  1A90 A;  3KII A;  5D82 A;  3OW2 2;  4HVN A;  1UUV B;  3EBY A;  1PU4 A;  4HM1 B;  3CU3 A;  3PXM A;  2GU3 A;  2CFK A;  2ML5 A;  1US1 A;  4HYZ A;  1YHQ 3;  3MG3 A;  2W9P A;  3RDE A;  4MEI A;  1AVL A;  2MF7 A;  4CDL A;  2FNQ A;  3X3X A;  3EJV A;  4JF8 A;  3KKG A;  1YI2 3;  1M90 4;  5KP1 A;  3JUO A;  3TDG A;  1Y4K A;  2Z7A A;  2KXG A;  3WA2 X;  5IEP A;  2LQV A;  4AKY A;  1NB3 I;  3N8B A;  2INX A;  3BNE A;  1TIJ A;  1D6U A;  1RJO A;  3BLZ A;  4HJL B;  1QAL A;  4N6V 0;  3M8C A;  4XBX A;  3I55 3;  3MG2 A;  3BND A;  2B24 B;  4H3U A;  1IT8 A;  1RN7 A;  3CC7 3;  2XGL A;  1JN5 B;  4X2O A;  1W2B 2;  1MOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...