4X2OA

Sac3n peptide bound to mex67:mtr2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
179
Chain Sequence
SPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFAQDPASSSCSKFSRNLLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Putative mRNA export protein
publication title Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 43
structure length 179
sequence length 193
ec nomenclature
pdb deposition date 2014-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4x2oA00
3VSYA 5BXQA 2HMMB 3T8UA 1CQSA 1OPYA 3GRDA 3MG1A 3FF0A 4X2HA 3EF8A 3FGYA 2XSOB 1ZX2A 4J9AA 3DUKA 2F86B 4MJDA 3NV0B 1OF5A 3EN1B 3SEDA 3GZRA 2QGUA 1S5AA 3ER7A 2Z76A 5IG5A 2HMLB 4I4KA 3UNLA 1OHOA 3OXAA 1W01A 1JB2A 3F40A 2HMNB 5AIGA 1JB5A 3RGAA 1GYBA 8CHOA 1K41A 4XBTA 2CKFB 4L7KA 2BMOB 3BB9A 2BMQB 3MKIA 1QMAA 1NU3A 5DRVA 4WP5A 3F8HA 4ORLA 1Q40A 3CNXA 2JQ5A 3SOAA 3FZWA 1OCVA 3MHEA 3BLZA 5AIIA 5BVBA 2HMKB 3OWUA 3DM8A 2GEYA 3LYGA 3FSDA 4K1UA 3NBRA 4XBXA 1U5OA 5EVHA 1OHPA 3SOYA 3ECFA 3ROBA 5JPPA 2F99A 3EC9A 3KSPA 3JUQA 2CHCA 2GBWB 3JUPA 1TP6A 1UUVB 2IMJA 1QJGA 5CF1A 1ZO2A 2B24B 3EN8A 1WQLB 1ISKA 4PEJA 3WMDA 2XRXB 3F7SA 1O7PB 1O7NB 5IEPA 2B1XB 2GBXB 3NM2A 1C7HA 1OGXA 4HJLB 4WWUC 1JN5A 4CDLA 5IG4A 2YFLB 3CPOA 5KP3A 5KP4A 3JUNA 3G16A 2GEXA 5AIHA 3VGNA 4OVMA 2K54A 3EQQB 4LEHA 2HMJB 3RGRA 2I9WA 1GY7A 3EJVA 4LGQA 4R9LA 3B4PA 4R1KA 2R4IA 3HZPA 1TUHA 3GWRA 2YFJB 4LMIA 3JUMA 1OHSA 5IERA 2RFRA 3CNMA 3EX9A 4HM2B 4STDA 1E3RA 5CLKA 1DMMA 5CF2A 3OV4A 1STDA 4HM6B 2A15A 3NUVA 2RCDA 1DMNA 1E3VA 4GB5A 1O7GB 5AIFA 4WYKA 5STDA 3G0KA 3FF2A 2Z7AA 5AEWB 1SJWA 4K1VA 4HM3B 3FH1A 1ULJB 3NV0A 1VZZA 2PZVA 2XSHB 3DXOA 1NWWA 3B7CA 1O7WB 4XB5A 5HGRA 1JN5B 2RGQA 1NDOB 3K0ZA 2QIYA 3F9SA 3F7XA 3H51A 4FCMA 4N3VA 4J8TA 1OF5B 3UJMA 4XM4A 4H3UA 3GZXB 4R9KA 5D82A 5DREA 1JKGA 2BMRB 5D81A 1ULIB 3EBYA 3NXJA 3D9RA 1W6YA 3K7CA 3B4OA 4HM4B 1EA2A 2XR8B 4HZ9B 3NHXA 3FLJA 3IPTA 3STDA 4U13A 4XDVA 4HKVB 5CXOA 5AEUB 1HKXA 2OWPA 3F14A 3OWYA 3MG2A 4KVHA 1Z1SA 5G2GA 3T8NA 3I0YA 5IEOA 3H3HA 1OUNA 1UUWB 3HK4A 4WYKB 5IF6A 3KKGA 3KZTA 3MYTA 3GZBA 1Q40B 5CK6A 2STDA 6STDA 1IDPA 2UX0A 3OX9A 4HVNA 4L8OA 2Z77A 5IG0A 3JUOA 3DZLA 2F98A 5KP1A 1Q42A 2HMOB 5IG3A 4HM8B 1ASKA 1DMQA 3S5CA 4RZMA 1A2KA 1GY6A 1JKGB 1OH0A 1O7HB 3B8LA 4XBYA 2INXA 1GS3A 1JB4A 3A76A 4HM1B 3EBTA 1GY5A 3FKAA 3OWSA 3CU3A 1BUQA 5D83A 3G8ZA 4L8PA 4HZBB 1EG9B 7STDA 4HM0B 5JPUA 3MSOA 2GXFA 3KE7A 4IIAA 3HX8A 5IENA 4FCJA 1OGZA 3GZYB 2YFIB 1AR0A 4X2OA 3LZAA 3Q90A 3DMCA 4HM5B 4Q53A 5AI1A 2BNGA 1E97A 4XDWA 5FW5A 3E99A 5TGNA 1W00A 4HM7B 3EHCA 2W2CA 1W02A 3F8XA 1O7MB 3MG3A 3M8CA 4OUQA
chains in the Genus database with same CATH superfamily
3VSYA 3FG3A 3S67A 1RKYA 5BXQA 1V57A 1EUIC 1BRNL 5BU4A 1LXEA 2HMMB 1PY3A 3O8YA 1RN1A 1CQSA 1OPYA 3GRDA 3MG1A 3T8UA 1AV4A 1KWIA 1NO3A 2CW9A 4H61A 1JNQA 3FF0A 4X2HA 1A67A 3EF8A 4MMYB 1L5GB 3D3LA 3FGYA 1RCLA 1LOWA 4NREA 1RHLA 1W6CA 2XSOB 2PNCA 1ZX2A 4J9AA 3ZG5A 3DUKA 2F86B 4MJDA 1LVNA 3NV0B 1OF5A 4KFFA 1WNHA 3EN1B 3FCSB 1VQ53 1VQO3 5M1AA 2OOVC 1YJW3 2CFDA 1B27A 1GSPA 2CK3H 3SEDA 3WA3A 3GZRA 1SIIA 3BNEA 2KAAA 2O3OA 2QGUA 1S5AA 3AMOB 3ER7A 4J5KA 3LMLA 4NHFA 2W9PA 2Z76A 3G6E3 3CPW2 1UGHI 5IG5A 4N6OB 1RDSA 3Q3FA 1BSAA 2UGIA 3K9MC 4CCVA 4AKZA 2J8XB 2CFGA 1VQN3 3U97A 4RNTA 2HMLB 4I4KA 3UNLA 4ILFA 1LNIA 2H0IA 4EV5A 3I553 3CCM3 1OHOA 1MWSA 1X1XA 3S28A 1UUGB 3DGMA 1VQ63 5IW9A 3OXAA 4N6UA 1W01A 1I2FA 1TTOA 2XF3A 1NB3I 3BNDA 4EXRA 3CCJ3 1JB2A 3F40A 2HMNB 5AIGA 1JB5A 1FA3A 1W7CA 1GYBA 2D1WA 1K41A 3PGBA 4XBTA 3RGAA 8CHOA 2M7OA 2CKFB 1I3FA 4L7KA 2BMOB 3BB9A 2BMQB 3MKIA 1QMAA 3RDEA 1NU3A 5DRVA 3S29A 2C4BA 1QAKA 4WP5A 1PFPA 3F8HA 1VQ43 4N6TA 1JZDA 4ORLA 1Q40A 1RGCA 1N5HA 2XEPA 3CNXA 1B3SA 2AAEA 4EYCA 1TU5A 1YI23 1HU9A 1QVF2 1BSBA 2JQ5A 3SOAA 2OQEC 3CMA3 4K61A 1BGSA 2CH9A 1T2HA 1PYLA 1W5ZA 3FZWA 6RNTA 4GHOA 5FGOA 1OCVA 1QAFA 1G0TA 4HBRA 1IVXA 3MHEA 2RSXA 3BLZA 3NBJA 1X1WA 1G96A 1Q864 1QALA 2LYXA 1ROAA 5AIIA 4QWTA 2HMKB 5BVBA 3HI7A 4EW5A 2Y74A 3MWZA 3PZWA 2IUKA 2CWVA 3OWUA 3DM8A 1CYUA 2GEYA 1VQQA 1RGKA 2E2UA 3LYGA 2WGQA 1YJ93 3FSDA 1RLSA 2R41A 4K1UA 4RNYA 3KN4A 1STFI 3NBRA 4XBXA 1K734 1SPUA 2OCTA 1U5OA 5EVHA 2FGTA 1OHPA 3CCV3 2W03A 4N6NB 3SOYA 3PXMA 1N8QA 3ECFA 1I0VA 3LOYA 2Q07A 1GMQA 3ROBA 2KF4A 5JPPA 4JRFA 5RNTA 1FGRA 1YIT3 2F99A 1N8R4 1YGWA 5M19A 1LOVA 3EC9A 3AGNA 3KSPA 1BNEA 1ZS7A 2CX0A 4HOHA 3JUQA 2CHCA 2GBWB 1FGTA 1X1UA 3JUPA 1TP6A 2GU3A 1UUVB 1DVCA 1Q9EA 2IMJA 1M1K4 1QJGA 1AVLA 2JDIH 5CF1A 2H0HA 3QRDA 3LT8A 1ZO2A 2B24B 1IQ8A 2RNTA 1UW1A 3EN8A 3DY5A 1WQLB 3TDGA 1V74A 1ISKA 1G02A 1K28A 3PS8A 1EKMA 1UCKA 1B2SA 4FMBA 3DGLA 4PEJA 3WMDA 2XRXB 3F7SA 1F8NA 1O7NB 1O7PB 2IA7A 5IEPA 2B1XB 1K9M4 2GBXB 1WMNA 4NPBA 3NM2A 3T0UA 1MWTA 1C7HA 2H0GA 1OGXA 3KIIA 2O9UX 4HJLB 4WWUC 1JN5A 3K63A 1FZUA 4CDLA 5IG4A 1MOLA 1FYSA 2YFLB 1BSDA 1T3BA 3CPOA 5KP3A 5KP4A 2QEX3 1TIJA 3JUNA 1TFKA 3SXXA 2P09A 4EV2A 3G16A 2GEXA 5AIHA 1D6YA 1MNLA 2F56A 4MMXB 3KCHA 3VGNA 1VQL3 4OVMA 2K54A 3EQQB 1ZGXA 3GSPA 1AY7A 2P0XA 4LEHA 2HMJB 3RGRA 1RN4A 1TRPA 2I9WA 1A2VA 1JV2B 4JF8A 3X41A 1GY7A 1RNTA 3BNBA 1B2ZA 3D4AA 3EJVA 4LGQA 3U1WA 3WR2A 1HYFA 2W56A 4R9LA 3ZFZA 3CCQ3 1Q7HA 2W9QA 3B4PA 3WOFB 4R1KA 3I563 1VQ83 2R4IA 3HZPA 1N5PA 3LH4A 4R80A 3WA2X 1B2MA 1BUJA 3BU4A 2W0QA 1VQ73 1TUHA 1JRQA 1VQK3 1BNFA 3GWRA 3CC23 1FUTA 1T2IA 2YFJB 1SIHA 4WHAA 1JBTA 4LMIA 1WMPA 1OHSA 1SQWA 1LRAA 2RFRA 3JUMA 5IERA 3CNMA 5JBSA 1I0XA 3EX9A 4HM2B 3FG1A 1BSEA 4STDA 1UI8A 4BIRA 3CC73 1E3RA 3N9HA 3WODG 2XH9A 5CLKA 1DMMA 1LNHA 2CC3A 3PCRA 4KZ1A 5CF2A 1I2GA 1HZ1A 2C10A 2SBLA 3JVCA 4BL3A 2IY2A 4BL2A 3AHSA 3OV4A 1STDA 4BTXA 1M1XB 5ELJA 1PU4A 2P38A 4HM6B 1R4YA 2RBIA 3K5TA 2ML5A 3N54B 1BU4A 2A15A 2V1LA 3IMAB 3NUVA 2RCDA 1DMNA 1E3VA 4GB5A 1O7GB 1BSCA 3GAXA 7GSPA 4FMAA 5AIFA 4WYKA 5STDA 1NNVA 3G0KA 1YVBI 1EQKA 1JBSA 1RGAA 3FF2A 1N9JA 2Z7AA 4HAAA 2W04A 5AEWB 1SJWA 2BHMA 4ZM8A 1B2UA 2KF5A 3EB8A 1RMSA 3WOEB 4RNZA 3UB1A 1FGOA 1I70A 1LQGC 4K1VA 4LYLB 4HM3B 5EEOA 2E2VA 3X3ZA 1C54A 3FH1A 1ULJB 2KF6A 2Y73A 1VZZA 3NV0A 3V99A 3ZG0A 4AEQA 1IQXA 3VF1A 4CPKA 1J2BA 2XFSA 1DE3A 1BRKA 2PZVA 4EBGA 2XSHB 3NX0A 3DXOA 1NWWA 2KXGA 3B7CA 5AYRB 3CCS3 3A5EA 4N6MA 2CWTA 1O7WB 4XB5A 4OK0A 5HGRA 1BRHA 1JN5B 2FXTA 4LZIA 2RGQA 2K3DA 3DH2A 3NQZA 1UGIA 1NDOB 1YGEA 3NBBA 1BRSA 3LTCA 3K0ZA 2QIYA 3F9SA 1M904 1CEWI 2XGNA 3F7XA 3H51A 1MWUA 2Z6BA 4FCMA 4IT7A 4N3VA 4G1MB 4J8TA 3SX1A 1OF5B 4KFEA 1R4CA 3UJMA 7RNTA 1BANA 4H3UA 4O2HA 3GZXB 4XM4A 1KC84 1BNRA 3G4S3 2CFLA 4R9KA 1WMOA 3HIGA 5D82A 5DREA 1VQ93 1JKGA 1TFOA 4K90B 2BMRB 3CD63 1UI7A 5D81A 2ZHXB 1ULIB 2KRTA 3EBYA 3KFQC 3NXJA 2BIRA 3D9RA 1W6YA 1MGWA 3CME3 5EQLA 2IUJA 3K7CA 3B4OA 1RRHA 1D6UA 4IPBA 4HM4B 1BNJA 1EA2A 4BTYA 2MF7A 4FMCA 2XR8B 4HZ9B 3CXC2 1Q824 2ZA4A 3NHXA 2CG0A 3URPA 4LSOA 4O8SA 3FLJA 5GSPA 5LC7A 6GSPA 1CYVA 3HOHA 5HOHA 3IPTA 2D42A 1VQP3 1Q814 1RTUA 3STDA 4U13A 4XDVA 2HOHA 4FMDA 4HKVB 5CXOA 5AEUB 2C11A 2F5WA 1RGHA 1IVUA 1HKXA 2YX9A 4RBNA 2OWPA 1GMPA 3F14A 2ZL8A 3MG2A 3OWYA 4KVHA 1U8CB 1Z1SA 2QA43 5G2GA 3T8NA 1FW7A 3AGOA 2E2TA 3I0YA 5IEOA 4I5QA 4KT3B 3H3HA 1GD3A 1BOXA 1OUNA 2L4VA 3NM7A 5G1LA 1Q7Y4 1UUWB 3HK4A 5LC6A 4AKYA 1RGGA 5M18A 1RRLA 1B20A 1EEJA 4WYKB 5IF6A 3KKGA 1N9EA 3KZTA 3GZBA 3MYTA 1Q40B 4BTWA 3L0RA 3G713 1I2EA 5CK6A 2STDA 6STDA 3SVAA 2OTJ3 1IDPA 1W4NA 1IVVA 2UX0A 4GL6A 1QVG2 1IV9A 3D5GA 3LTDA 1US1A 3OX9A 4FR9A 4HVNA 2WOFA 1IVWA 1FUWA 2L1SA 5ELUA 1RGEA 3V98A 1UCIA 3BIRA 4L8OA 2Z77A 5G1KA 3WDGB 8RNTA 5IG0A 3JUOA 3OW22 2P0MA 1LOXA 3DZLA 3J7Yd 2F98A 2F4YA 4J5GA 4EC6A 2ML6A 1DETA 5KP1A 3PCSA 1CH0A 2GU1A 2WO0A 3V92A 2KF3A 1Q42A 1YVSA 2HMOB 2WOHA 3QK9A 3NQYA 3SYUA 1SARA 1UDII 3DGOA 5IG3A 1Y4KA 4HYZA 2OTL3 3LT9A 4HM8B 1W2B2 4KFDA 2KCDA 1RGLA 1GOUA 1IK3A 1X1YA 1ASKA 2SARA 2XGLA 4O02B 1IQYA 1DMQA 5I97A 1S723 1GD4A 3S5CA 1IV7A 3LTBA 4RZMA 4DKIA 4N6V0 3AHWA 4TX4A 4CJNA 4WFOA 1YJN3 1BRGA 2LQVA 1TRQA 1NB5I 2IYJA 5A0OB 1A2KA 1GY6A 1YNVX 1FUSA 1JKGB 1IT8A 1OH0A 5AYSC 4R4KA 1O7HB 3B8LA 4FCZA 2W6JH 3KSED 4XBYA 2INXA 1JJ22 3CC43 1GS3A 1JB4A 1BVIA 2WGOA 3ALAA 1YIJ3 3DGNA 1TJDA 3A76A 1RSNA 1BIRA 1V58A 1W6GA 3CCR3 1AVKA 3X3XA 2OOVA 2ZDJA 3CCE3 4HM1B 3EBTA 3UL5A 3D79A 3D5IA 3LTAA 4MEIA 1DVDA 1GY5A 1BNGA 3FKAA 1RJOA 1UCLA 3OWSA 3S27A 2UUGC 3CU3A 1BUQA 1W2ZA 5D83A 3CCL3 3G8ZA 4L8PA 4HZBB 2BU4A 1EG9B 7STDA 1OACA 3AMOA 4HM0B 5JPUA 1RN7A 3MSOA 2CX1A 3HIIA 1A2PA 2CFKA 2BT3A 1IYYA 1RCKA 1AQZA 3X40A 3X42A 2GXFA 3KE7A 4IIAA 4O3VA 4BU4A 3HX8A 5IENA 4FCJA 2CIUA 1JBRA 1T5YA 1OGZA 1D6ZA 2AADA 3GZYB 3IJEB 2YFIB 2F5MA 1RNBA 4MMZB 9RNTA 1BRIA 1BAOA 2XFTA 5BIRA 3N8BA 1M9GA 1AR0A 3BNCA 3Q1CA 1BNIA 2W56B 4X2OA 1UCJA 3LZAA 1IU7A 4OUQA 1I8VA 3Q90A 3DMCA 4HM5B 1IT7A 1DYUA 3DGYA 1YHQ3 3CCU3 3UL6A 3MPHA 1KQS2 4Q53A 5AI1A 2K0MA 1VQM3 2BNGA 1E97A 1WTHA 1RGFA 2CWUA 4XDWA 3RNTA 3X3YA 3Q2PA 1ROVA 1B2XA 2GSPA 3FG4A 1FGQA 3LXUX 5FW5A 1BNSA 1LOYA 3E99A 1GOVA 1MWRA 3WHOA 2OQEA 1KD14 1B21A 2MC8A 2CFWA 5TGNA 2CG1A 1W00A 2BO9B 2P05A 4HM7B 3EE1A 3SLUA 3EHCA 2FNQA 1K8A4 4GSPA 1A90A 1BRJA 2W2CA 1W02A 3F8XA 3PYJA 4N6LA 1KSIA 1GMRA 1O7MB 3MG3A 1NJI4 1JZOA 1MGRA 1I3IA 3M8CA 1GOYA 1FGMA 1LQMB
chains in the Genus database with same CATH topology
3VSYA 3FG3A 3S67A 1RKYA 5BXQA 1LXEA 2HMMB 3T8UA 3O8YA 1CQSA 1OPYA 3GRDA 3MG1A 1AV4A 1KWIA 1NO3A 2CW9A 4H61A 1JNQA 3FF0A 4X2HA 1A67A 3EF8A 4MMYB 1L5GB 3D3LA 3FGYA 4NREA 1W6CA 2XSOB 2PNCA 1ZX2A 4J9AA 3DUKA 2F86B 4MJDA 1LVNA 3NV0B 1OF5A 4KFFA 1WNHA 3EN1B 3FCSB 1VQ53 1VQO3 2OOVC 1YJW3 2CFDA 3WA3A 2CK3H 3SEDA 3GZRA 1SIIA 3BNEA 2O3OA 2QGUA 1S5AA 3AMOB 3ER7A 4NHFA 3LMLA 2W9PA 2Z76A 3G6E3 3CPW2 5IG5A 4N6OB 3K9MC 4CCVA 4AKZA 2CFGA 1VQN3 3U97A 2HMLB 4I4KA 3UNLA 4EV5A 3I553 3CCM3 1OHOA 3S28A 3DGMA 1VQ63 5IW9A 3OXAA 4N6UA 1W01A 2XF3A 1NB3I 3BNDA 4EXRA 3CCJ3 1JB2A 3F40A 2HMNB 5AIGA 1JB5A 1FA3A 1W7CA 1GYBA 2D1WA 1K41A 3PGBA 4XBTA 3RGAA 8CHOA 2M7OA 2CKFB 4L7KA 2BMOB 3BB9A 2BMQB 3MKIA 1QMAA 3RDEA 1NU3A 5DRVA 3S29A 1QAKA 4WP5A 1PFPA 3F8HA 1VQ43 4N6TA 4ORLA 1Q40A 2XEPA 1N5HA 4EYCA 3CNXA 1TU5A 1YI23 1HU9A 1QVF2 2JQ5A 3SOAA 2OQEC 3CMA3 4K61A 2CH9A 3FZWA 1W5ZA 5FGOA 1OCVA 1QAFA 4HBRA 1IVXA 3MHEA 2RSXA 3BLZA 3NBJA 1G96A 1Q864 1QALA 2LYXA 1ROAA 5AIIA 4QWTA 2HMKB 5BVBA 3HI7A 2Y74A 3MWZA 3PZWA 2IUKA 2CWVA 3OWUA 3DM8A 1CYUA 2GEYA 2E2UA 3LYGA 2WGQA 1YJ93 3FSDA 4K1UA 4RNYA 3KN4A 1STFI 3NBRA 4XBXA 1K734 1SPUA 2OCTA 1U5OA 5EVHA 2FGTA 1OHPA 3CCV3 2W03A 4N6NB 3SOYA 3PXMA 1N8QA 3ECFA 3LOYA 2Q07A 3ROBA 5JPPA 4JRFA 1FGRA 1YIT3 2F99A 1N8R4 3EC9A 3KSPA 3JUQA 2CHCA 2GBWB 1FGTA 3JUPA 1TP6A 2GU3A 1UUVB 1DVCA 2IMJA 1M1K4 1QJGA 1AVLA 2JDIH 5CF1A 3QRDA 3LT8A 1ZO2A 2B24B 1IQ8A 3EN8A 1UW1A 3DY5A 1WQLB 3TDGA 1V74A 1ISKA 1K28A 3PS8A 1EKMA 4FMBA 3DGLA 4PEJA 3WMDA 2XRXB 3F7SA 1F8NA 1O7NB 1O7PB 2IA7A 5IEPA 2B1XB 1K9M4 2GBXB 1WMNA 3NM2A 3T0UA 1C7HA 1OGXA 3KIIA 2O9UX 4HJLB 4WWUC 1JN5A 3K63A 4CDLA 5IG4A 1MOLA 2YFLB 3CPOA 5KP3A 2QEX3 5KP4A 1TIJA 3JUNA 1TFKA 3SXXA 2P09A 4EV2A 3G16A 2GEXA 5AIHA 1D6YA 1MNLA 4MMXB 3VGNA 1VQL3 4OVMA 2K54A 3EQQB 4LEHA 2P0XA 2HMJB 3RGRA 2I9WA 1A2VA 1JV2B 4JF8A 3X41A 1GY7A 3BNBA 3EJVA 3U1WA 4LGQA 2W56A 4R9LA 3CCQ3 2W9QA 3B4PA 3WOFB 4R1KA 3I563 1VQ83 2R4IA 3HZPA 1N5PA 3LH4A 4R80A 3WA2X 2W0QA 1VQ73 1TUHA 1JRQA 1VQK3 3GWRA 3CC23 2YFJB 1SIHA 4WHAA 4LMIA 1WMPA 1OHSA 1SQWA 2RFRA 3JUMA 5IERA 3CNMA 5JBSA 3EX9A 4HM2B 3FG1A 4STDA 1UI8A 3CC73 1E3RA 3N9HA 3WODG 2XH9A 5CLKA 1DMMA 1LNHA 2CC3A 3PCRA 4KZ1A 5CF2A 2SBLA 2C10A 3JVCA 4BTXA 3OV4A 1STDA 1M1XB 5ELJA 1PU4A 2P38A 4HM6B 3K5TA 2ML5A 3N54B 2A15A 2V1LA 3IMAB 3NUVA 2RCDA 1DMNA 1E3VA 4GB5A 1O7GB 3GAXA 4FMAA 5AIFA 4WYKA 5STDA 3G0KA 1YVBI 1EQKA 3FF2A 2Z7AA 1N9JA 2W04A 5AEWB 1SJWA 2BHMA 4ZM8A 3EB8A 3WOEB 4RNZA 3UB1A 1FGOA 3X3ZA 4K1VA 5EEOA 4HM3B 2E2VA 3FH1A 1ULJB 2Y73A 3NV0A 1VZZA 3V99A 4AEQA 1J2BA 1IQXA 3VF1A 2XFSA 2PZVA 4EBGA 2XSHB 3NX0A 3DXOA 1NWWA 2KXGA 3B7CA 5AYRB 3CCS3 4N6MA 2CWTA 1O7WB 4XB5A 4OK0A 5HGRA 1JN5B 2FXTA 4LZIA 2RGQA 3NQZA 1NDOB 1YGEA 3NBBA 3LTCA 3K0ZA 2QIYA 3F9SA 1M904 2XGNA 1CEWI 3F7XA 3H51A 2Z6BA 4FCMA 4IT7A 4N3VA 4G1MB 4J8TA 3SX1A 1OF5B 4KFEA 1R4CA 3UJMA 4XM4A 4H3UA 4O2HA 3GZXB 1KC84 3G4S3 2CFLA 4R9KA 1WMOA 3HIGA 5D82A 5DREA 1VQ93 1JKGA 1TFOA 4K90B 2BMRB 3CD63 1UI7A 5D81A 1ULIB 2KRTA 3EBYA 3KFQC 3NXJA 3D9RA 1W6YA 3CME3 5EQLA 2IUJA 3K7CA 3B4OA 1RRHA 1D6UA 4IPBA 4HM4B 1EA2A 4BTYA 2MF7A 4FMCA 2XR8B 4HZ9B 3CXC2 1Q824 3NHXA 2CG0A 4LSOA 4O8SA 3FLJA 5LC7A 1CYVA 3IPTA 2D42A 1VQP3 1Q814 3STDA 4U13A 4XDVA 4FMDA 4HKVB 5CXOA 5AEUB 2C11A 1IVUA 1HKXA 2YX9A 4RBNA 2OWPA 3F14A 2ZL8A 3MG2A 3OWYA 4KVHA 1U8CB 1Z1SA 2QA43 5G2GA 3T8NA 2E2TA 3I0YA 5IEOA 3H3HA 1GD3A 1OUNA 2L4VA 3NM7A 1Q7Y4 1UUWB 3HK4A 5LC6A 4AKYA 1RRLA 4WYKB 5IF6A 3KKGA 1N9EA 3KZTA 3GZBA 3MYTA 1Q40B 4BTWA 3L0RA 3G713 5CK6A 2STDA 6STDA 3SVAA 2OTJ3 1IDPA 1W4NA 1IVVA 2UX0A 4GL6A 1QVG2 1IV9A 3LTDA 1US1A 3OX9A 4FR9A 4HVNA 2WOFA 1IVWA 1FUWA 5ELUA 3V98A 4L8OA 2Z77A 3WDGB 5IG0A 3JUOA 3OW22 2P0MA 1LOXA 3DZLA 3J7Yd 2F98A 4EC6A 2ML6A 5KP1A 3PCSA 2GU1A 2WO0A 3V92A 1Q42A 2HMOB 2WOHA 3QK9A 3NQYA 3DGOA 5IG3A 1Y4KA 4HYZA 2OTL3 3LT9A 4HM8B 1W2B2 4KFDA 2KCDA 1IK3A 1ASKA 2XGLA 4O02B 1IQYA 1DMQA 5I97A 1S723 1GD4A 3S5CA 1IV7A 3LTBA 4RZMA 4N6V0 4TX4A 4WFOA 1YJN3 2LQVA 1NB5I 5A0OB 1A2KA 1GY6A 1JKGB 1IT8A 1OH0A 5AYSC 4R4KA 1O7HB 3B8LA 4FCZA 2W6JH 3KSED 4XBYA 2INXA 1JJ22 3CC43 1GS3A 1JB4A 2WGOA 3ALAA 1YIJ3 3DGNA 3A76A 1W6GA 3CCR3 1AVKA 3X3XA 2OOVA 2ZDJA 3CCE3 4HM1B 3EBTA 3UL5A 3LTAA 1DVDA 4MEIA 1GY5A 3FKAA 1RJOA 3OWSA 3S27A 3CU3A 1BUQA 1W2ZA 5D83A 3CCL3 3G8ZA 4L8PA 4HZBB 1EG9B 7STDA 1OACA 3AMOA 4HM0B 5JPUA 1RN7A 3MSOA 3HIIA 2CFKA 2BT3A 3X40A 3X42A 2GXFA 3KE7A 4IIAA 4O3VA 3HX8A 5IENA 4FCJA 2CIUA 1T5YA 1OGZA 1D6ZA 3IJEB 3GZYB 2YFIB 4MMZB 2XFTA 3N8BA 1M9GA 1AR0A 3BNCA 3Q1CA 2W56B 4X2OA 3LZAA 1IU7A 3Q90A 3DMCA 4HM5B 1IT7A 1DYUA 1YHQ3 3CCU3 3UL6A 3MPHA 1KQS2 4Q53A 5AI1A 2K0MA 1VQM3 2BNGA 1E97A 1WTHA 2CWUA 3X3YA 4XDWA 3Q2PA 1ROVA 3FG4A 3LXUX 1FGQA 5FW5A 1KD14 3E99A 2OQEA 2MC8A 2CFWA 5TGNA 2CG1A 1W00A 2BO9B 2P05A 4HM7B 3EE1A 3SLUA 3EHCA 2FNQA 1K8A4 1A90A 2W2CA 1W02A 3F8XA 3PYJA 4N6LA 1KSIA 1O7MB 3MG3A 1NJI4 3M8CA 4OUQA 1FGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSY A;  5BXQ A;  2HMM B;  3T8U A;  1CQS A;  1OPY A;  3GRD A;  3MG1 A;  3FF0 A;  4X2H A;  3EF8 A;  3FGY A;  2XSO B;  1ZX2 A;  4J9A A;  3DUK A;  2F86 B;  4MJD A;  3NV0 B;  1OF5 A;  3EN1 B;  3SED A;  3GZR A;  2QGU A;  1S5A A;  3ER7 A;  2Z76 A;  5IG5 A;  2HML B;  4I4K A;  3UNL A;  1OHO A;  3OXA A;  1W01 A;  1JB2 A;  3F40 A;  2HMN B;  5AIG A;  1JB5 A;  3RGA A;  1GYB A;  8CHO A;  1K41 A;  4XBT A;  2CKF B;  4L7K A;  2BMO B;  3BB9 A;  2BMQ B;  3MKI A;  1QMA A;  1NU3 A;  5DRV A;  4WP5 A;  3F8H A;  4ORL A;  1Q40 A;  3CNX A;  2JQ5 A;  3SOA A;  3FZW A;  1OCV A;  3MHE A;  3BLZ A;  5AII A;  5BVB A;  2HMK B;  3OWU A;  3DM8 A;  2GEY A;  3LYG A;  3FSD A;  4K1U A;  3NBR A;  4XBX A;  1U5O A;  5EVH A;  1OHP A;  3SOY A;  3ECF A;  3ROB A;  5JPP A;  2F99 A;  3EC9 A;  3KSP A;  3JUQ A;  2CHC A;  2GBW B;  3JUP A;  1TP6 A;  1UUV B;  2IMJ A;  1QJG A;  5CF1 A;  1ZO2 A;  2B24 B;  3EN8 A;  1WQL B;  1ISK A;  4PEJ A;  3WMD A;  2XRX B;  3F7S A;  1O7P B;  1O7N B;  5IEP A;  2B1X B;  2GBX B;  3NM2 A;  1C7H A;  1OGX A;  4HJL B;  4WWU C;  1JN5 A;  4CDL A;  5IG4 A;  2YFL B;  3CPO A;  5KP3 A;  5KP4 A;  3JUN A;  3G16 A;  2GEX A;  5AIH A;  3VGN A;  4OVM A;  2K54 A;  3EQQ B;  4LEH A;  2HMJ B;  3RGR A;  2I9W A;  1GY7 A;  3EJV A;  4LGQ A;  4R9L A;  3B4P A;  4R1K A;  2R4I A;  3HZP A;  1TUH A;  3GWR A;  2YFJ B;  4LMI A;  3JUM A;  1OHS A;  5IER A;  2RFR A;  3CNM A;  3EX9 A;  4HM2 B;  4STD A;  1E3R A;  5CLK A;  1DMM A;  5CF2 A;  3OV4 A;  1STD A;  4HM6 B;  2A15 A;  3NUV A;  2RCD A;  1DMN A;  1E3V A;  4GB5 A;  1O7G B;  5AIF A;  4WYK A;  5STD A;  3G0K A;  3FF2 A;  2Z7A A;  5AEW B;  1SJW A;  4K1V A;  4HM3 B;  3FH1 A;  1ULJ B;  3NV0 A;  1VZZ A;  2PZV A;  2XSH B;  3DXO A;  1NWW A;  3B7C A;  1O7W B;  4XB5 A;  5HGR A;  1JN5 B;  2RGQ A;  1NDO B;  3K0Z A;  2QIY A;  3F9S A;  3F7X A;  3H51 A;  4FCM A;  4N3V A;  4J8T A;  1OF5 B;  3UJM A;  4XM4 A;  4H3U A;  3GZX B;  4R9K A;  5D82 A;  5DRE A;  1JKG A;  2BMR B;  5D81 A;  1ULI B;  3EBY A;  3NXJ A;  3D9R A;  1W6Y A;  3K7C A;  3B4O A;  4HM4 B;  1EA2 A;  2XR8 B;  4HZ9 B;  3NHX A;  3FLJ A;  3IPT A;  3STD A;  4U13 A;  4XDV A;  4HKV B;  5CXO A;  5AEU B;  1HKX A;  2OWP A;  3F14 A;  3OWY A;  3MG2 A;  4KVH A;  1Z1S A;  5G2G A;  3T8N A;  3I0Y A;  5IEO A;  3H3H A;  1OUN A;  1UUW B;  3HK4 A;  4WYK B;  5IF6 A;  3KKG A;  3KZT A;  3MYT A;  3GZB A;  1Q40 B;  5CK6 A;  2STD A;  6STD A;  1IDP A;  2UX0 A;  3OX9 A;  4HVN A;  4L8O A;  2Z77 A;  5IG0 A;  3JUO A;  3DZL A;  2F98 A;  5KP1 A;  1Q42 A;  2HMO B;  5IG3 A;  4HM8 B;  1ASK A;  1DMQ A;  3S5C A;  4RZM A;  1A2K A;  1GY6 A;  1JKG B;  1OH0 A;  1O7H B;  3B8L A;  4XBY A;  2INX A;  1GS3 A;  1JB4 A;  3A76 A;  4HM1 B;  3EBT A;  1GY5 A;  3FKA A;  3OWS A;  3CU3 A;  1BUQ A;  5D83 A;  3G8Z A;  4L8P A;  4HZB B;  1EG9 B;  7STD A;  4HM0 B;  5JPU A;  3MSO A;  2GXF A;  3KE7 A;  4IIA A;  3HX8 A;  5IEN A;  4FCJ A;  1OGZ A;  3GZY B;  2YFI B;  1AR0 A;  4X2O A;  3LZA A;  3Q90 A;  3DMC A;  4HM5 B;  4Q53 A;  5AI1 A;  2BNG A;  1E97 A;  4XDW A;  5FW5 A;  3E99 A;  5TGN A;  1W00 A;  4HM7 B;  3EHC A;  2W2C A;  1W02 A;  3F8X A;  1O7M B;  3MG3 A;  3M8C A;  4OUQ A; 
#chains in the Genus database with same CATH topology
 3VSY A;  3FG3 A;  3S67 A;  1RKY A;  5BXQ A;  1V57 A;  1EUI C;  1BRN L;  5BU4 A;  1LXE A;  2HMM B;  1PY3 A;  3O8Y A;  1RN1 A;  1CQS A;  1OPY A;  3GRD A;  3MG1 A;  3T8U A;  1AV4 A;  1KWI A;  1NO3 A;  2CW9 A;  4H61 A;  1JNQ A;  3FF0 A;  4X2H A;  1A67 A;  3EF8 A;  4MMY B;  1L5G B;  3D3L A;  3FGY A;  1RCL A;  1LOW A;  4NRE A;  1RHL A;  1W6C A;  2XSO B;  2PNC A;  1ZX2 A;  4J9A A;  3ZG5 A;  3DUK A;  2F86 B;  4MJD A;  1LVN A;  3NV0 B;  1OF5 A;  4KFF A;  1WNH A;  3EN1 B;  3FCS B;  1VQ5 3;  1VQO 3;  5M1A A;  2OOV C;  1YJW 3;  2CFD A;  1B27 A;  1GSP A;  2CK3 H;  3SED A;  3WA3 A;  3GZR A;  1SII A;  3BNE A;  2KAA A;  2O3O A;  2QGU A;  1S5A A;  3AMO B;  3ER7 A;  4J5K A;  3LML A;  4NHF A;  2W9P A;  2Z76 A;  3G6E 3;  3CPW 2;  1UGH I;  5IG5 A;  4N6O B;  1RDS A;  3Q3F A;  1BSA A;  2UGI A;  3K9M C;  4CCV A;  4AKZ A;  2J8X B;  2CFG A;  1VQN 3;  3U97 A;  4RNT A;  2HML B;  4I4K A;  3UNL A;  4ILF A;  1LNI A;  2H0I A;  4EV5 A;  3I55 3;  3CCM 3;  1OHO A;  1MWS A;  1X1X A;  3S28 A;  1UUG B;  3DGM A;  1VQ6 3;  5IW9 A;  3OXA A;  4N6U A;  1W01 A;  1I2F A;  1TTO A;  2XF3 A;  1NB3 I;  3BND A;  4EXR A;  3CCJ 3;  1JB2 A;  3F40 A;  2HMN B;  5AIG A;  1JB5 A;  1FA3 A;  1W7C A;  1GYB A;  2D1W A;  1K41 A;  3PGB A;  4XBT A;  3RGA A;  8CHO A;  2M7O A;  2CKF B;  1I3F A;  4L7K A;  2BMO B;  3BB9 A;  2BMQ B;  3MKI A;  1QMA A;  3RDE A;  1NU3 A;  5DRV A;  3S29 A;  2C4B A;  1QAK A;  4WP5 A;  1PFP A;  3F8H A;  1VQ4 3;  4N6T A;  1JZD A;  4ORL A;  1Q40 A;  1RGC A;  1N5H A;  2XEP A;  3CNX A;  1B3S A;  2AAE A;  4EYC A;  1TU5 A;  1YI2 3;  1HU9 A;  1QVF 2;  1BSB A;  2JQ5 A;  3SOA A;  2OQE C;  3CMA 3;  4K61 A;  1BGS A;  2CH9 A;  1T2H A;  1PYL A;  1W5Z A;  3FZW A;  6RNT A;  4GHO A;  5FGO A;  1OCV A;  1QAF A;  1G0T A;  4HBR A;  1IVX A;  3MHE A;  2RSX A;  3BLZ A;  3NBJ A;  1X1W A;  1G96 A;  1Q86 4;  1QAL A;  2LYX A;  1ROA A;  5AII A;  4QWT A;  2HMK B;  5BVB A;  3HI7 A;  4EW5 A;  2Y74 A;  3MWZ A;  3PZW A;  2IUK A;  2CWV A;  3OWU A;  3DM8 A;  1CYU A;  2GEY A;  1VQQ A;  1RGK A;  2E2U A;  3LYG A;  2WGQ A;  1YJ9 3;  3FSD A;  1RLS A;  2R41 A;  4K1U A;  4RNY A;  3KN4 A;  1STF I;  3NBR A;  4XBX A;  1K73 4;  1SPU A;  2OCT A;  1U5O A;  5EVH A;  2FGT A;  1OHP A;  3CCV 3;  2W03 A;  4N6N B;  3SOY A;  3PXM A;  1N8Q A;  3ECF A;  1I0V A;  3LOY A;  2Q07 A;  1GMQ A;  3ROB A;  2KF4 A;  5JPP A;  4JRF A;  5RNT A;  1FGR A;  1YIT 3;  2F99 A;  1N8R 4;  1YGW A;  5M19 A;  1LOV A;  3EC9 A;  3AGN A;  3KSP A;  1BNE A;  1ZS7 A;  2CX0 A;  4HOH A;  3JUQ A;  2CHC A;  2GBW B;  1FGT A;  1X1U A;  3JUP A;  1TP6 A;  2GU3 A;  1UUV B;  1DVC A;  1Q9E A;  2IMJ A;  1M1K 4;  1QJG A;  1AVL A;  2JDI H;  5CF1 A;  2H0H A;  3QRD A;  3LT8 A;  1ZO2 A;  2B24 B;  1IQ8 A;  2RNT A;  1UW1 A;  3EN8 A;  3DY5 A;  1WQL B;  3TDG A;  1V74 A;  1ISK A;  1G02 A;  1K28 A;  3PS8 A;  1EKM A;  1UCK A;  1B2S A;  4FMB A;  3DGL A;  4PEJ A;  3WMD A;  2XRX B;  3F7S A;  1F8N A;  1O7N B;  1O7P B;  2IA7 A;  5IEP A;  2B1X B;  1K9M 4;  2GBX B;  1WMN A;  4NPB A;  3NM2 A;  3T0U A;  1MWT A;  1C7H A;  2H0G A;  1OGX A;  3KII A;  2O9U X;  4HJL B;  4WWU C;  1JN5 A;  3K63 A;  1FZU A;  4CDL A;  5IG4 A;  1MOL A;  1FYS A;  2YFL B;  1BSD A;  1T3B A;  3CPO A;  5KP3 A;  5KP4 A;  2QEX 3;  1TIJ A;  3JUN A;  1TFK A;  3SXX A;  2P09 A;  4EV2 A;  3G16 A;  2GEX A;  5AIH A;  1D6Y A;  1MNL A;  2F56 A;  4MMX B;  3KCH A;  3VGN A;  1VQL 3;  4OVM A;  2K54 A;  3EQQ B;  1ZGX A;  3GSP A;  1AY7 A;  2P0X A;  4LEH A;  2HMJ B;  3RGR A;  1RN4 A;  1TRP A;  2I9W A;  1A2V A;  1JV2 B;  4JF8 A;  3X41 A;  1GY7 A;  1RNT A;  3BNB A;  1B2Z A;  3D4A A;  3EJV A;  4LGQ A;  3U1W A;  3WR2 A;  1HYF A;  2W56 A;  4R9L A;  3ZFZ A;  3CCQ 3;  1Q7H A;  2W9Q A;  3B4P A;  3WOF B;  4R1K A;  3I56 3;  1VQ8 3;  2R4I A;  3HZP A;  1N5P A;  3LH4 A;  4R80 A;  3WA2 X;  1B2M A;  1BUJ A;  3BU4 A;  2W0Q A;  1VQ7 3;  1TUH A;  1JRQ A;  1VQK 3;  1BNF A;  3GWR A;  3CC2 3;  1FUT A;  1T2I A;  2YFJ B;  1SIH A;  4WHA A;  1JBT A;  4LMI A;  1WMP A;  1OHS A;  1SQW A;  1LRA A;  2RFR A;  3JUM A;  5IER A;  3CNM A;  5JBS A;  1I0X A;  3EX9 A;  4HM2 B;  3FG1 A;  1BSE A;  4STD A;  1UI8 A;  4BIR A;  3CC7 3;  1E3R A;  3N9H A;  3WOD G;  2XH9 A;  5CLK A;  1DMM A;  1LNH A;  2CC3 A;  3PCR A;  4KZ1 A;  5CF2 A;  1I2G A;  1HZ1 A;  2C10 A;  2SBL A;  3JVC A;  4BL3 A;  2IY2 A;  4BL2 A;  3AHS A;  3OV4 A;  1STD A;  4BTX A;  1M1X B;  5ELJ A;  1PU4 A;  2P38 A;  4HM6 B;  1R4Y A;  2RBI A;  3K5T A;  2ML5 A;  3N54 B;  1BU4 A;  2A15 A;  2V1L A;  3IMA B;  3NUV A;  2RCD A;  1DMN A;  1E3V A;  4GB5 A;  1O7G B;  1BSC A;  3GAX A;  7GSP A;  4FMA A;  5AIF A;  4WYK A;  5STD A;  1NNV A;  3G0K A;  1YVB I;  1EQK A;  1JBS A;  1RGA A;  3FF2 A;  1N9J A;  2Z7A A;  4HAA A;  2W04 A;  5AEW B;  1SJW A;  2BHM A;  4ZM8 A;  1B2U A;  2KF5 A;  3EB8 A;  1RMS A;  3WOE B;  4RNZ A;  3UB1 A;  1FGO A;  1I70 A;  1LQG C;  4K1V A;  4LYL B;  4HM3 B;  5EEO A;  2E2V A;  3X3Z A;  1C54 A;  3FH1 A;  1ULJ B;  2KF6 A;  2Y73 A;  1VZZ A;  3NV0 A;  3V99 A;  3ZG0 A;  4AEQ A;  1IQX A;  3VF1 A;  4CPK A;  1J2B A;  2XFS A;  1DE3 A;  1BRK A;  2PZV A;  4EBG A;  2XSH B;  3NX0 A;  3DXO A;  1NWW A;  2KXG A;  3B7C A;  5AYR B;  3CCS 3;  3A5E A;  4N6M A;  2CWT A;  1O7W B;  4XB5 A;  4OK0 A;  5HGR A;  1BRH A;  1JN5 B;  2FXT A;  4LZI A;  2RGQ A;  2K3D A;  3DH2 A;  3NQZ A;  1UGI A;  1NDO B;  1YGE A;  3NBB A;  1BRS A;  3LTC A;  3K0Z A;  2QIY A;  3F9S A;  1M90 4;  1CEW I;  2XGN A;  3F7X A;  3H51 A;  1MWU A;  2Z6B A;  4FCM A;  4IT7 A;  4N3V A;  4G1M B;  4J8T A;  3SX1 A;  1OF5 B;  4KFE A;  1R4C A;  3UJM A;  7RNT A;  1BAN A;  4H3U A;  4O2H A;  3GZX B;  4XM4 A;  1KC8 4;  1BNR A;  3G4S 3;  2CFL A;  4R9K A;  1WMO A;  3HIG A;  5D82 A;  5DRE A;  1VQ9 3;  1JKG A;  1TFO A;  4K90 B;  2BMR B;  3CD6 3;  1UI7 A;  5D81 A;  2ZHX B;  1ULI B;  2KRT A;  3EBY A;  3KFQ C;  3NXJ A;  2BIR A;  3D9R A;  1W6Y A;  1MGW A;  3CME 3;  5EQL A;  2IUJ A;  3K7C A;  3B4O A;  1RRH A;  1D6U A;  4IPB A;  4HM4 B;  1BNJ A;  1EA2 A;  4BTY A;  2MF7 A;  4FMC A;  2XR8 B;  4HZ9 B;  3CXC 2;  1Q82 4;  2ZA4 A;  3NHX A;  2CG0 A;  3URP A;  4LSO A;  4O8S A;  3FLJ A;  5GSP A;  5LC7 A;  6GSP A;  1CYV A;  3HOH A;  5HOH A;  3IPT A;  2D42 A;  1VQP 3;  1Q81 4;  1RTU A;  3STD A;  4U13 A;  4XDV A;  2HOH A;  4FMD A;  4HKV B;  5CXO A;  5AEU B;  2C11 A;  2F5W A;  1RGH A;  1IVU A;  1HKX A;  2YX9 A;  4RBN A;  2OWP A;  1GMP A;  3F14 A;  2ZL8 A;  3MG2 A;  3OWY A;  4KVH A;  1U8C B;  1Z1S A;  2QA4 3;  5G2G A;  3T8N A;  1FW7 A;  3AGO A;  2E2T A;  3I0Y A;  5IEO A;  4I5Q A;  4KT3 B;  3H3H A;  1GD3 A;  1BOX A;  1OUN A;  2L4V A;  3NM7 A;  5G1L A;  1Q7Y 4;  1UUW B;  3HK4 A;  5LC6 A;  4AKY A;  1RGG A;  5M18 A;  1RRL A;  1B20 A;  1EEJ A;  4WYK B;  5IF6 A;  3KKG A;  1N9E A;  3KZT A;  3GZB A;  3MYT A;  1Q40 B;  4BTW A;  3L0R A;  3G71 3;  1I2E A;  5CK6 A;  2STD A;  6STD A;  3SVA A;  2OTJ 3;  1IDP A;  1W4N A;  1IVV A;  2UX0 A;  4GL6 A;  1QVG 2;  1IV9 A;  3D5G A;  3LTD A;  1US1 A;  3OX9 A;  4FR9 A;  4HVN A;  2WOF A;  1IVW A;  1FUW A;  2L1S A;  5ELU A;  1RGE A;  3V98 A;  1UCI A;  3BIR A;  4L8O A;  2Z77 A;  5G1K A;  3WDG B;  8RNT A;  5IG0 A;  3JUO A;  3OW2 2;  2P0M A;  1LOX A;  3DZL A;  3J7Y d;  2F98 A;  2F4Y A;  4J5G A;  4EC6 A;  2ML6 A;  1DET A;  5KP1 A;  3PCS A;  1CH0 A;  2GU1 A;  2WO0 A;  3V92 A;  2KF3 A;  1Q42 A;  1YVS A;  2HMO B;  2WOH A;  3QK9 A;  3NQY A;  3SYU A;  1SAR A;  1UDI I;  3DGO A;  5IG3 A;  1Y4K A;  4HYZ A;  2OTL 3;  3LT9 A;  4HM8 B;  1W2B 2;  4KFD A;  2KCD A;  1RGL A;  1GOU A;  1IK3 A;  1X1Y A;  1ASK A;  2SAR A;  2XGL A;  4O02 B;  1IQY A;  1DMQ A;  5I97 A;  1S72 3;  1GD4 A;  3S5C A;  1IV7 A;  3LTB A;  4RZM A;  4DKI A;  4N6V 0;  3AHW A;  4TX4 A;  4CJN A;  4WFO A;  1YJN 3;  1BRG A;  2LQV A;  1TRQ A;  1NB5 I;  2IYJ A;  5A0O B;  1A2K A;  1GY6 A;  1YNV X;  1FUS A;  1JKG B;  1IT8 A;  1OH0 A;  5AYS C;  4R4K A;  1O7H B;  3B8L A;  4FCZ A;  2W6J H;  3KSE D;  4XBY A;  2INX A;  1JJ2 2;  3CC4 3;  1GS3 A;  1JB4 A;  1BVI A;  2WGO A;  3ALA A;  1YIJ 3;  3DGN A;  1TJD A;  3A76 A;  1RSN A;  1BIR A;  1V58 A;  1W6G A;  3CCR 3;  1AVK A;  3X3X A;  2OOV A;  2ZDJ A;  3CCE 3;  4HM1 B;  3EBT A;  3UL5 A;  3D79 A;  3D5I A;  3LTA A;  4MEI A;  1DVD A;  1GY5 A;  1BNG A;  3FKA A;  1RJO A;  1UCL A;  3OWS A;  3S27 A;  2UUG C;  3CU3 A;  1BUQ A;  1W2Z A;  5D83 A;  3CCL 3;  3G8Z A;  4L8P A;  4HZB B;  2BU4 A;  1EG9 B;  7STD A;  1OAC A;  3AMO A;  4HM0 B;  5JPU A;  1RN7 A;  3MSO A;  2CX1 A;  3HII A;  1A2P A;  2CFK A;  2BT3 A;  1IYY A;  1RCK A;  1AQZ A;  3X40 A;  3X42 A;  2GXF A;  3KE7 A;  4IIA A;  4O3V A;  4BU4 A;  3HX8 A;  5IEN A;  4FCJ A;  2CIU A;  1JBR A;  1T5Y A;  1OGZ A;  1D6Z A;  2AAD A;  3GZY B;  3IJE B;  2YFI B;  2F5M A;  1RNB A;  4MMZ B;  9RNT A;  1BRI A;  1BAO A;  2XFT A;  5BIR A;  3N8B A;  1M9G A;  1AR0 A;  3BNC A;  3Q1C A;  1BNI A;  2W56 B;  4X2O A;  1UCJ A;  3LZA A;  1IU7 A;  4OUQ A;  1I8V A;  3Q90 A;  3DMC A;  4HM5 B;  1IT7 A;  1DYU A;  3DGY A;  1YHQ 3;  3CCU 3;  3UL6 A;  3MPH A;  1KQS 2;  4Q53 A;  5AI1 A;  2K0M A;  1VQM 3;  2BNG A;  1E97 A;  1WTH A;  1RGF A;  2CWU A;  4XDW A;  3RNT A;  3X3Y A;  3Q2P A;  1ROV A;  1B2X A;  2GSP A;  3FG4 A;  1FGQ A;  3LXU X;  5FW5 A;  1BNS A;  1LOY A;  3E99 A;  1GOV A;  1MWR A;  3WHO A;  2OQE A;  1KD1 4;  1B21 A;  2MC8 A;  2CFW A;  5TGN A;  2CG1 A;  1W00 A;  2BO9 B;  2P05 A;  4HM7 B;  3EE1 A;  3SLU A;  3EHC A;  2FNQ A;  1K8A 4;  4GSP A;  1A90 A;  1BRJ A;  2W2C A;  1W02 A;  3F8X A;  3PYJ A;  4N6L A;  1KSI A;  1GMR A;  1O7M B;  3MG3 A;  1NJI 4;  1JZO A;  1MGR A;  1I3I A;  3M8C A;  1GOY A;  1FGM A;  1LQM B; 
#chains in the Genus database with same CATH homology
 3VSY A;  3FG3 A;  3S67 A;  1RKY A;  5BXQ A;  1LXE A;  2HMM B;  3T8U A;  3O8Y A;  1CQS A;  1OPY A;  3GRD A;  3MG1 A;  1AV4 A;  1KWI A;  1NO3 A;  2CW9 A;  4H61 A;  1JNQ A;  3FF0 A;  4X2H A;  1A67 A;  3EF8 A;  4MMY B;  1L5G B;  3D3L A;  3FGY A;  4NRE A;  1W6C A;  2XSO B;  2PNC A;  1ZX2 A;  4J9A A;  3DUK A;  2F86 B;  4MJD A;  1LVN A;  3NV0 B;  1OF5 A;  4KFF A;  1WNH A;  3EN1 B;  3FCS B;  1VQ5 3;  1VQO 3;  2OOV C;  1YJW 3;  2CFD A;  3WA3 A;  2CK3 H;  3SED A;  3GZR A;  1SII A;  3BNE A;  2O3O A;  2QGU A;  1S5A A;  3AMO B;  3ER7 A;  4NHF A;  3LML A;  2W9P A;  2Z76 A;  3G6E 3;  3CPW 2;  5IG5 A;  4N6O B;  3K9M C;  4CCV A;  4AKZ A;  2CFG A;  1VQN 3;  3U97 A;  2HML B;  4I4K A;  3UNL A;  4EV5 A;  3I55 3;  3CCM 3;  1OHO A;  3S28 A;  3DGM A;  1VQ6 3;  5IW9 A;  3OXA A;  4N6U A;  1W01 A;  2XF3 A;  1NB3 I;  3BND A;  4EXR A;  3CCJ 3;  1JB2 A;  3F40 A;  2HMN B;  5AIG A;  1JB5 A;  1FA3 A;  1W7C A;  1GYB A;  2D1W A;  1K41 A;  3PGB A;  4XBT A;  3RGA A;  8CHO A;  2M7O A;  2CKF B;  4L7K A;  2BMO B;  3BB9 A;  2BMQ B;  3MKI A;  1QMA A;  3RDE A;  1NU3 A;  5DRV A;  3S29 A;  1QAK A;  4WP5 A;  1PFP A;  3F8H A;  1VQ4 3;  4N6T A;  4ORL A;  1Q40 A;  2XEP A;  1N5H A;  4EYC A;  3CNX A;  1TU5 A;  1YI2 3;  1HU9 A;  1QVF 2;  2JQ5 A;  3SOA A;  2OQE C;  3CMA 3;  4K61 A;  2CH9 A;  3FZW A;  1W5Z A;  5FGO A;  1OCV A;  1QAF A;  4HBR A;  1IVX A;  3MHE A;  2RSX A;  3BLZ A;  3NBJ A;  1G96 A;  1Q86 4;  1QAL A;  2LYX A;  1ROA A;  5AII A;  4QWT A;  2HMK B;  5BVB A;  3HI7 A;  2Y74 A;  3MWZ A;  3PZW A;  2IUK A;  2CWV A;  3OWU A;  3DM8 A;  1CYU A;  2GEY A;  2E2U A;  3LYG A;  2WGQ A;  1YJ9 3;  3FSD A;  4K1U A;  4RNY A;  3KN4 A;  1STF I;  3NBR A;  4XBX A;  1K73 4;  1SPU A;  2OCT A;  1U5O A;  5EVH A;  2FGT A;  1OHP A;  3CCV 3;  2W03 A;  4N6N B;  3SOY A;  3PXM A;  1N8Q A;  3ECF A;  3LOY A;  2Q07 A;  3ROB A;  5JPP A;  4JRF A;  1FGR A;  1YIT 3;  2F99 A;  1N8R 4;  3EC9 A;  3KSP A;  3JUQ A;  2CHC A;  2GBW B;  1FGT A;  3JUP A;  1TP6 A;  2GU3 A;  1UUV B;  1DVC A;  2IMJ A;  1M1K 4;  1QJG A;  1AVL A;  2JDI H;  5CF1 A;  3QRD A;  3LT8 A;  1ZO2 A;  2B24 B;  1IQ8 A;  3EN8 A;  1UW1 A;  3DY5 A;  1WQL B;  3TDG A;  1V74 A;  1ISK A;  1K28 A;  3PS8 A;  1EKM A;  4FMB A;  3DGL A;  4PEJ A;  3WMD A;  2XRX B;  3F7S A;  1F8N A;  1O7N B;  1O7P B;  2IA7 A;  5IEP A;  2B1X B;  1K9M 4;  2GBX B;  1WMN A;  3NM2 A;  3T0U A;  1C7H A;  1OGX A;  3KII A;  2O9U X;  4HJL B;  4WWU C;  1JN5 A;  3K63 A;  4CDL A;  5IG4 A;  1MOL A;  2YFL B;  3CPO A;  5KP3 A;  2QEX 3;  5KP4 A;  1TIJ A;  3JUN A;  1TFK A;  3SXX A;  2P09 A;  4EV2 A;  3G16 A;  2GEX A;  5AIH A;  1D6Y A;  1MNL A;  4MMX B;  3VGN A;  1VQL 3;  4OVM A;  2K54 A;  3EQQ B;  4LEH A;  2P0X A;  2HMJ B;  3RGR A;  2I9W A;  1A2V A;  1JV2 B;  4JF8 A;  3X41 A;  1GY7 A;  3BNB A;  3EJV A;  3U1W A;  4LGQ A;  2W56 A;  4R9L A;  3CCQ 3;  2W9Q A;  3B4P A;  3WOF B;  4R1K A;  3I56 3;  1VQ8 3;  2R4I A;  3HZP A;  1N5P A;  3LH4 A;  4R80 A;  3WA2 X;  2W0Q A;  1VQ7 3;  1TUH A;  1JRQ A;  1VQK 3;  3GWR A;  3CC2 3;  2YFJ B;  1SIH A;  4WHA A;  4LMI A;  1WMP A;  1OHS A;  1SQW A;  2RFR A;  3JUM A;  5IER A;  3CNM A;  5JBS A;  3EX9 A;  4HM2 B;  3FG1 A;  4STD A;  1UI8 A;  3CC7 3;  1E3R A;  3N9H A;  3WOD G;  2XH9 A;  5CLK A;  1DMM A;  1LNH A;  2CC3 A;  3PCR A;  4KZ1 A;  5CF2 A;  2SBL A;  2C10 A;  3JVC A;  4BTX A;  3OV4 A;  1STD A;  1M1X B;  5ELJ A;  1PU4 A;  2P38 A;  4HM6 B;  3K5T A;  2ML5 A;  3N54 B;  2A15 A;  2V1L A;  3IMA B;  3NUV A;  2RCD A;  1DMN A;  1E3V A;  4GB5 A;  1O7G B;  3GAX A;  4FMA A;  5AIF A;  4WYK A;  5STD A;  3G0K A;  1YVB I;  1EQK A;  3FF2 A;  2Z7A A;  1N9J A;  2W04 A;  5AEW B;  1SJW A;  2BHM A;  4ZM8 A;  3EB8 A;  3WOE B;  4RNZ A;  3UB1 A;  1FGO A;  3X3Z A;  4K1V A;  5EEO A;  4HM3 B;  2E2V A;  3FH1 A;  1ULJ B;  2Y73 A;  3NV0 A;  1VZZ A;  3V99 A;  4AEQ A;  1J2B A;  1IQX A;  3VF1 A;  2XFS A;  2PZV A;  4EBG A;  2XSH B;  3NX0 A;  3DXO A;  1NWW A;  2KXG A;  3B7C A;  5AYR B;  3CCS 3;  4N6M A;  2CWT A;  1O7W B;  4XB5 A;  4OK0 A;  5HGR A;  1JN5 B;  2FXT A;  4LZI A;  2RGQ A;  3NQZ A;  1NDO B;  1YGE A;  3NBB A;  3LTC A;  3K0Z A;  2QIY A;  3F9S A;  1M90 4;  2XGN A;  1CEW I;  3F7X A;  3H51 A;  2Z6B A;  4FCM A;  4IT7 A;  4N3V A;  4G1M B;  4J8T A;  3SX1 A;  1OF5 B;  4KFE A;  1R4C A;  3UJM A;  4XM4 A;  4H3U A;  4O2H A;  3GZX B;  1KC8 4;  3G4S 3;  2CFL A;  4R9K A;  1WMO A;  3HIG A;  5D82 A;  5DRE A;  1VQ9 3;  1JKG A;  1TFO A;  4K90 B;  2BMR B;  3CD6 3;  1UI7 A;  5D81 A;  1ULI B;  2KRT A;  3EBY A;  3KFQ C;  3NXJ A;  3D9R A;  1W6Y A;  3CME 3;  5EQL A;  2IUJ A;  3K7C A;  3B4O A;  1RRH A;  1D6U A;  4IPB A;  4HM4 B;  1EA2 A;  4BTY A;  2MF7 A;  4FMC A;  2XR8 B;  4HZ9 B;  3CXC 2;  1Q82 4;  3NHX A;  2CG0 A;  4LSO A;  4O8S A;  3FLJ A;  5LC7 A;  1CYV A;  3IPT A;  2D42 A;  1VQP 3;  1Q81 4;  3STD A;  4U13 A;  4XDV A;  4FMD A;  4HKV B;  5CXO A;  5AEU B;  2C11 A;  1IVU A;  1HKX A;  2YX9 A;  4RBN A;  2OWP A;  3F14 A;  2ZL8 A;  3MG2 A;  3OWY A;  4KVH A;  1U8C B;  1Z1S A;  2QA4 3;  5G2G A;  3T8N A;  2E2T A;  3I0Y A;  5IEO A;  3H3H A;  1GD3 A;  1OUN A;  2L4V A;  3NM7 A;  1Q7Y 4;  1UUW B;  3HK4 A;  5LC6 A;  4AKY A;  1RRL A;  4WYK B;  5IF6 A;  3KKG A;  1N9E A;  3KZT A;  3GZB A;  3MYT A;  1Q40 B;  4BTW A;  3L0R A;  3G71 3;  5CK6 A;  2STD A;  6STD A;  3SVA A;  2OTJ 3;  1IDP A;  1W4N A;  1IVV A;  2UX0 A;  4GL6 A;  1QVG 2;  1IV9 A;  3LTD A;  1US1 A;  3OX9 A;  4FR9 A;  4HVN A;  2WOF A;  1IVW A;  1FUW A;  5ELU A;  3V98 A;  4L8O A;  2Z77 A;  3WDG B;  5IG0 A;  3JUO A;  3OW2 2;  2P0M A;  1LOX A;  3DZL A;  3J7Y d;  2F98 A;  4EC6 A;  2ML6 A;  5KP1 A;  3PCS A;  2GU1 A;  2WO0 A;  3V92 A;  1Q42 A;  2HMO B;  2WOH A;  3QK9 A;  3NQY A;  3DGO A;  5IG3 A;  1Y4K A;  4HYZ A;  2OTL 3;  3LT9 A;  4HM8 B;  1W2B 2;  4KFD A;  2KCD A;  1IK3 A;  1ASK A;  2XGL A;  4O02 B;  1IQY A;  1DMQ A;  5I97 A;  1S72 3;  1GD4 A;  3S5C A;  1IV7 A;  3LTB A;  4RZM A;  4N6V 0;  4TX4 A;  4WFO A;  1YJN 3;  2LQV A;  1NB5 I;  5A0O B;  1A2K A;  1GY6 A;  1JKG B;  1IT8 A;  1OH0 A;  5AYS C;  4R4K A;  1O7H B;  3B8L A;  4FCZ A;  2W6J H;  3KSE D;  4XBY A;  2INX A;  1JJ2 2;  3CC4 3;  1GS3 A;  1JB4 A;  2WGO A;  3ALA A;  1YIJ 3;  3DGN A;  3A76 A;  1W6G A;  3CCR 3;  1AVK A;  3X3X A;  2OOV A;  2ZDJ A;  3CCE 3;  4HM1 B;  3EBT A;  3UL5 A;  3LTA A;  1DVD A;  4MEI A;  1GY5 A;  3FKA A;  1RJO A;  3OWS A;  3S27 A;  3CU3 A;  1BUQ A;  1W2Z A;  5D83 A;  3CCL 3;  3G8Z A;  4L8P A;  4HZB B;  1EG9 B;  7STD A;  1OAC A;  3AMO A;  4HM0 B;  5JPU A;  1RN7 A;  3MSO A;  3HII A;  2CFK A;  2BT3 A;  3X40 A;  3X42 A;  2GXF A;  3KE7 A;  4IIA A;  4O3V A;  3HX8 A;  5IEN A;  4FCJ A;  2CIU A;  1T5Y A;  1OGZ A;  1D6Z A;  3IJE B;  3GZY B;  2YFI B;  4MMZ B;  2XFT A;  3N8B A;  1M9G A;  1AR0 A;  3BNC A;  3Q1C A;  2W56 B;  4X2O A;  3LZA A;  1IU7 A;  3Q90 A;  3DMC A;  4HM5 B;  1IT7 A;  1DYU A;  1YHQ 3;  3CCU 3;  3UL6 A;  3MPH A;  1KQS 2;  4Q53 A;  5AI1 A;  2K0M A;  1VQM 3;  2BNG A;  1E97 A;  1WTH A;  2CWU A;  3X3Y A;  4XDW A;  3Q2P A;  1ROV A;  3FG4 A;  3LXU X;  1FGQ A;  5FW5 A;  1KD1 4;  3E99 A;  2OQE A;  2MC8 A;  2CFW A;  5TGN A;  2CG1 A;  1W00 A;  2BO9 B;  2P05 A;  4HM7 B;  3EE1 A;  3SLU A;  3EHC A;  2FNQ A;  1K8A 4;  1A90 A;  2W2C A;  1W02 A;  3F8X A;  3PYJ A;  4N6L A;  1KSI A;  1O7M B;  3MG3 A;  1NJI 4;  3M8C A;  4OUQ A;  1FGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...