4HM5B

Naphthalene 1,2-dioxygenase bound to indene
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to indene
rcsb
source organism Pseudomonas sp. c18
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm5B00
3BLZA 1JB4A 2B24B 2GEYA 5IERA 2UX0A 1NWWA 3FH1A 3B8LA 1E3VA 3FZWA 4HM0B 4MJDA 1OHOA 1TUHA 5AEWB 5KP3A 5AIGA 4HZBB 1OCVA 3KZTA 3H51A 3JUOA 5IG4A 1S5AA 1ASKA 1Q40B 3MG1A 1NDOB 1O7MB 2Z76A 3OXAA 2OWPA 1A2KA 1VZZA 2XR8B 3VSYA 2Z77A 4XBTA 1UUVB 1IDPA 2QIYA 1OH0A 4R9KA 5CK6A 1C7HA 3OWYA 3UNLA 2BMRB 5IG3A 3EQQB 4OUQA 4OVMA 4HM6B 3MG2A 1OF5B 4HM3B 3EHCA 1EG9B 3RGAA 4STDA 3SOAA 1JKGB 1NU3A 3F7SA 3NM2A 1OHPA 1ULIB 4J9AA 5IENA 2RCDA 4HM7B 3DM8A 3LZAA 4XM4A 1TP6A 3K0ZA 3OV4A 2BMQB 3NBRA 1JN5A 3EX9A 1Q42A 4PEJA 4KVHA 5JPPA 3K7CA 1E3RA 2HMKB 4I4KA 1ZX2A 3T8NA 4WWUC 1W02A 3DUKA 3HK4A 3UJMA 1CQSA 3FF2A 4HZ9B 3EBTA 4XB5A 2Z7AA 8CHOA 4HM1B 1O7GB 1GS3A 4H3UA 3NHXA 3GZXB 1QMAA 3FF0A 1OF5A 1OHSA 5HGRA 1QJGA 3WMDA 2PZVA 2YFJB 2IMJA 1UUWB 1U5OA 2XSOB 1JKGA 4XDVA 5IG5A 3STDA 4WP5A 2GEXA 3EBYA 3Q90A 3H3HA 1O7HB 2JQ5A 3DMCA 4XBYA 4XBXA 3DXOA 5BVBA 5AI1A 3MSOA 2HMLB 3SOYA 6STDA 5DREA 1JB2A 3CNXA 4HVNA 1O7WB 1BUQA 5IEOA 1DMQA 5JPUA 4X2OA 3GWRA 5IF6A 5FW5A 5IEPA 5G2GA 3GZYB 2INXA 3ER7A 4HJLB 2CHCA 5CF2A 3E99A 5IG0A 2BNGA 2HMMB 3NUVA 2STDA 5DRVA 3I0YA 2XSHB 3EN8A 4N3VA 3OWUA 1OGXA 4LGQA 3B7CA 4K1VA 1WQLB 3G0KA 1ISKA 4XDWA 3JUNA 4R1KA 4HKVB 5KP1A 3SEDA 3EF8A 2HMJB 1HKXA 5CXOA 3FGYA 3B4OA 1Q40A 4FCJA 2I9WA 3EC9A 3OX9A 5AIHA 3GZBA 5STDA 3JUQA 1GY5A 2GBXB 3NXJA 3JUPA 5AIIA 4L7KA 1OUNA 3FLJA 1OGZA 2A15A 4LMIA 5D81A 4RZMA 5D83A 4ORLA 4HM2B 4HM4B 2K54A 4FCMA 2W2CA 1GY7A 3FKAA 2YFLB 1K41A 2XRXB 3JUMA 4L8PA 5AIFA 1Z1SA 2CKFB 3ECFA 2HMNB 7STDA 2YFIB 3CU3A 4L8OA 1W00A 4J8TA 3B4PA 3EJVA 3MHEA 3NV0B 3F8XA 4CDLA 4GB5A 3KE7A 3CNMA 1E97A 3FSDA 3G16A 1GYBA 4Q53A 2F98A 1JN5B 5BXQA 3IPTA 2GXFA 3MKIA 1STDA 1OPYA 3EN1B 4IIAA 3G8ZA 2RGQA 3VGNA 1AR0A 2F86B 3KKGA 3DZLA 3F40A 4R9LA 5EVHA 2F99A 5CF1A 2BMOB 2R4IA 4WYKB 2HMOB 3MYTA 3KSPA 5AEUB 3D9RA 4U13A 3MG3A 5D82A 3T8UA 1W01A 3F8HA 1ULJB 5KP4A 2QGUA 1DMNA 1W6YA 1ZO2A 4HM8B 3A76A 1O7PB 3NV0A 4LEHA 1O7NB 3F7XA 3GZRA 3BB9A 3GRDA 3ROBA 2B1XB 3OWSA 5TGNA 4X2HA 1SJWA 1JB5A 3HX8A 3CPOA 1EA2A 3HZPA 4K1UA 3S5CA 5CLKA 1DMMA 2GBWB 3F9SA 3RGRA 4HM5B 2RFRA 3F14A 1GY6A 3LYGA 4WYKA 3M8CA
chains in the Genus database with same CATH superfamily
3BLZA 1JB4A 2B24B 2XGNA 1IYYA 2BO9B 3V98A 1BRHA 2GEYA 5IERA 1M904 2UX0A 1NWWA 3FH1A 2ZHXB 1M1XB 6GSPA 3AGOA 3B8LA 5EEOA 2QA43 1TIJA 3ZG5A 1E3VA 3FZWA 1I2FA 3NX0A 1Q814 1Q9EA 2K3DA 3NBBA 4HM0B 4NHFA 1BGSA 3QRDA 1B2MA 1UCLA 1MNLA 1OHOA 1TUHA 4MJDA 4MMXB 5KP3A 5AEWB 1MWRA 2W0QA 1CH0A 1DYUA 4HZBB 1W7CA 5AIGA 1BANA 1OCVA 3KZTA 3H51A 1VQ53 1VQ73 3JUOA 1M1K4 5IG4A 1S5AA 2IUKA 3CCM3 1ASKA 4N6V0 1Q40B 3MG1A 1NDOB 2XGLA 1O7MB 3QK9A 2Q07A 2CW9A 1I3IA 2Z76A 1FUWA 3OXAA 1RMSA 3SXXA 2OWPA 3S28A 3IMAB 1MGRA 1A2KA 1MGWA 1V74A 1VZZA 2XR8B 3VSYA 2H0HA 2FNQA 1NB3I 2RSXA 2WOFA 2Z77A 3KCHA 3LH4A 4R80A 5BIRA 4XBTA 1IVVA 3HIGA 4N6MA 2XF3A 1UUVB 4LYLB 4FMDA 3LT9A 1B2XA 1IDPA 2QIYA 5FGOA 4EBGA 4JRFA 1OH0A 1UW1A 3D5IA 2W04A 4R9KA 1T2IA 1BRJA 2CFWA 2KAAA 3SX1A 1FGTA 3CCU3 5CK6A 4EXRA 1C7HA 3LTBA 2PNCA 1SIIA 3DGLA 1STFI 3OWYA 1W6GA 1UCKA 3AGNA 3PZWA 4BU4A 2RNTA 2BMRB 3UNLA 5IG3A 3G713 3EQQB 4OUQA 4OVMA 1ROVA 1D6YA 1BOXA 4HM6B 1YJ93 3MG2A 2FGTA 1JBTA 3CC73 1OF5B 1IT7A 4WFOA 4JF8A 2UUGC 3ZFZA 3CPW2 1Q824 4HM3B 1SARA 3EHCA 1EG9B 3U97A 3RGAA 4STDA 4NPBA 3AHWA 1US1A 3SOAA 1JKGB 4N6UA 1WMNA 1NU3A 1VQQA 3F7SA 4KFEA 3CCQ3 3NM2A 1RDSA 1OHPA 1ULIB 4J9AA 1LVNA 3BIRA 1JZOA 1N9JA 2P0MA 5IENA 1N5PA 2RCDA 4RNTA 3N54B 1AV4A 5M1AA 2E2TA 4HM7B 1RGFA 3DM8A 5EQLA 3LZAA 4K61A 4XM4A 4EV2A 1TP6A 3K0ZA 3OV4A 1I70A 2MC8A 4AKZA 1B21A 1RGLA 1YIT3 5G1LA 2D42A 3KFQC 1BUJA 2XFTA 2L1SA 4KT3B 2BMQB 1GOYA 3EE1A 3LTCA 5G1KA 3X3XA 3NBRA 1JN5A 1AY7A 4G1MB 3EX9A 2ZA4A 5JBSA 2CWTA 3X3ZA 1Q42A 4PEJA 4KVHA 5JPPA 1YVBI 1SPUA 2O9UX 1JZDA 1Q7Y4 2OCTA 1A2PA 3K7CA 1I0VA 1E3RA 2HMKB 2YX9A 4I4KA 3JVCA 1GSPA 3UL5A 1ZX2A 1ZGXA 3T8NA 1UUGB 3HOHA 4WWUC 3WOEB 5M18A 1QVF2 1LQMB 1I3FA 1MWUA 1W02A 3DUKA 3HK4A 3UJMA 1YJW3 1FGRA 3PYJA 1BNRA 1CQSA 3Q2PA 3KIIA 1V57A 1FYSA 1B2ZA 2E2UA 3FF2A 4HZ9B 3SYUA 2CFGA 3EBTA 4EV5A 4XB5A 2CIUA 2Z7AA 8CHOA 4HM1B 3I563 1O7GB 1GS3A 4I5QA 3LMLA 1JV2B 4MMZB 4H3UA 4HOHA 1S723 2OOVA 3AMOB 2CG1A 3NHXA 2RBIA 3GZXB 1C54A 2F5MA 1SIHA 1QVG2 1V58A 1QMAA 3ZG0A 8RNTA 4RBNA 1GMPA 3FF0A 1OF5A 3SVAA 3CCL3 1OHSA 5HGRA 1LOXA 2XFSA 1IVWA 1QJGA 1IV9A 1LOWA 1M9GA 2PZVA 3WMDA 2CC3A 2YFJB 4N6NB 1KWIA 2IMJA 3WR2A 3IJEB 2K0MA 3K9MC 3N9HA 1BRNL 1B3SA 1X1XA 1UUWB 3PCSA 6RNTA 2KF3A 1U5OA 3PXMA 1JJ22 2XSOB 1JKGA 2FXTA 1NB5I 1X1YA 4XDVA 1MWTA 3DY5A 3X40A 3STDA 5IG5A 1RKYA 4WP5A 1HYFA 2GEXA 1RN1A 1WTHA 2LQVA 2XEPA 3J7Yd 2D1WA 1BAOA 3EBYA 4K90B 4TX4A 3Q90A 3H3HA 1O7HB 2JQ5A 4DKIA 1UCIA 1UGHI 3DMCA 4XBYA 3URPA 1LNIA 4XBXA 1BIRA 2C11A 5AYRB 5GSPA 2GU3A 2V1LA 3BNEA 3ALAA 1FZUA 3BNCA 3DXOA 4KFDA 5BVBA 1CYUA 5AI1A 3MSOA 1KD14 2HMLB 3HI7A 3CMA3 3SOYA 4CJNA 1EEJA 6STDA 2WOHA 5DREA 1JB2A 3CNXA 3O8YA 4NREA 1EQKA 5RNTA 3L0RA 3FG1A 4HVNA 1K9M4 1O7WB 1BUQA 4FMAA 5ELUA 4EYCA 5IEOA 1DMQA 5JPUA 3DGMA 1A67A 3NM7A 2CX0A 3GWRA 1B20A 3DGNA 4X2OA 2CWVA 2M7OA 4BTYA 5IF6A 1VQ83 1R4CA 5FW5A 5IEPA 1TRPA 3NBJA 5G2GA 1OACA 1QAFA 3GZYB 4ZM8A 2INXA 2HOHA 3ER7A 2F5WA 3VF1A 1LNHA 1Y4KA 3LXUX 4HJLB 1FW7A 5ELJA 2C10A 1VQ93 2L4VA 1W4NA 2CHCA 1AQZA 1FGMA 3CCS3 5CF2A 3E99A 2MF7A 5AYSC 5IG0A 3AMOA 1RN4A 2BNGA 1BSBA 1UI7A 4ILFA 1YIJ3 4RNZA 1LXEA 2HMMB 3NUVA 2STDA 2CX1A 2W56B 2IYJA 4QWTA 5DRVA 4AEQA 3I0YA 2CH9A 4FMCA 4HYZA 2XSHB 4CPKA 3EN8A 3GAXA 3NQYA 1UGIA 4N3VA 3OWUA 1K28A 3WA3A 3CCR3 1A90A 4AKYA 2IUJA 1BRIA 4J5GA 1B2UA 3TDGA 1OGXA 4LGQA 1DVDA 1HZ1A 1BRKA 1ZS7A 2SBLA 3B7CA 1NNVA 1RRHA 3BNBA 3UB1A 3CC43 2SARA 4K1VA 1WMOA 1WQLB 3G0KA 1ISKA 3RNTA 4XDWA 3D5GA 3JUNA 2XH9A 1BSCA 4R1KA 3D3LA 3V99A 4HKVB 2WO0A 5KP1A 1HU9A 2P05A 3EF8A 3SEDA 2HMJB 4N6OB 1HKXA 1BVIA 5CXOA 2F4YA 4EW5A 1BSAA 3FGYA 1YNVX 3B4OA 1Q40A 1MOLA 4GHOA 3OW22 1I8VA 3KN4A 4FCJA 1NO3A 2I9WA 3EC9A 3OX9A 5AIHA 2GSPA 3LTAA 1PU4A 3GZBA 1BSDA 3G6E3 2CG0A 5STDA 3JUQA 2R41A 1GY5A 1N9EA 1YGWA 2OQEC 3CXC2 1LOVA 1GOVA 2GBXB 2H0IA 3NXJA 2CK3H 1ROAA 1RTUA 2ML6A 3JUPA 5AIIA 4L7KA 1OUNA 3CCE3 3FLJA 3V92A 1OGZA 4N6TA 1GMQA 1BU4A 1RGEA 2A15A 3K63A 4LMIA 1FUTA 5D81A 4BTWA 4RZMA 2WGOA 5D83A 4ORLA 4HM2B 1N5HA 2K54A 4FCMA 4HM4B 1PYLA 3MWZA 1I2EA 1GY7A 2W2CA 5M19A 1RGCA 3FKAA 1I0XA 1N8R4 2YFLB 1K41A 3BNDA 2XRXB 3JUMA 4HBRA 4L8PA 4LZIA 2CWUA 5AIFA 1Z1SA 1IQXA 1RRLA 1TFKA 3CCV3 5LC6A 1B2SA 2IY2A 1D6UA 1EKMA 2CKFB 3ECFA 2KXGA 1RCLA 4BL2A 3CC23 2W03A 4FMBA 1G96A 3I553 2HMNB 1WMPA 1IK3A 3X3YA 1IVUA 4KFFA 7STDA 2YFIB 3CU3A 4BL3A 1RJOA 3WA2X 2BU4A 1LQGC 4L8OA 1IVXA 3CD63 1RNTA 1X1UA 1W00A 1BRGA 2ZL8A 1W2B2 3SLUA 1K734 1GMRA 1PFPA 1NJI4 2KF5A 4CCVA 3AHSA 1W6CA 1Q864 4J8TA 3B4PA 1EUIC 3S27A 3EJVA 1UCJA 3MHEA 5I97A 1VQ43 2H0GA 3NV0B 1FGOA 3F8XA 2KRTA 1R4YA 2P09A 1G02A 4BTXA 3GSPA 5BU4A 1A2VA 3FG4A 4CDLA 5A0OB 4GB5A 3KE7A 4GSPA 3CNMA 1E97A 3FSDA 5LC7A 1FGQA 1DE3A 3G16A 1GYBA 1TFOA 1KSIA 1KQS2 4Q53A 2UGIA 2F98A 1L5GB 1JN5B 5BXQA 1BSEA 3IPTA 2GXFA 3MKIA 1Q7HA 1CYVA 3EB8A 4O3VA 1STDA 1JBRA 2CFDA 4O02B 2OTJ3 3PCRA 1RGHA 1BNGA 1OPYA 1G0TA 2Y74A 4J5KA 3S29A 1QAKA 3PGBA 1TU5A 3EN1B 4IIAA 1T5YA 3MPHA 3PS8A 1QALA 4RNYA 3G8ZA 2RGQA 1YVSA 3BU4A 1GD3A 1I2GA 1VQP3 4O2HA 2WGQA 3VGNA 3K5TA 1IQ8A 1T2HA 4WHAA 1AR0A 1TTOA 2F86B 1RGAA 1VQK3 3KKGA 3Q3FA 2ML5A 3DZLA 3DGYA 2O3OA 3F40A 4OK0A 4R9LA 2BT3A 3CME3 5EVHA 3NQZA 2CFLA 1AVLA 2F99A 2F56A 1MWSA 2GU1A 1JBSA 1DETA 5CF1A 3FCSB 1RHLA 3S67A 3UL6A 2CFKA 2BMOB 2R4IA 4WYKB 2HMOB 3WDGB 3MYTA 1WNHA 1LRAA 2E2VA 1PY3A 3KSPA 4O8SA 1YJN3 1T3BA 5AEUB 1KC84 1W5ZA 3D9RA 4U13A 3MG3A 1RN7A 3D4AA 3U1WA 1D6ZA 5IW9A 1RSNA 5D82A 3T8UA 1W01A 3F8HA 4R4KA 2BIRA 1ULJB 5KP4A 1F8NA 1UI8A 4BIRA 2QGUA 1GD4A 4LSOA 1BNJA 1DMNA 4KZ1A 1W6YA 1ZO2A 1BNIA 4HM8B 1RGKA 4IPBA 2W6JH 2J8XB 3A76A 5HOHA 1O7PB 1B27A 1RGGA 3NV0A 3LTDA 4LEHA 7RNTA 4HAAA 4FCZA 1BRSA 1O7NB 3F7XA 2KF6A 1DVCA 3KSED 3T0UA 4EC6A 1IU7A 2Y73A 1YI23 3GZRA 2AADA 3BB9A 3GRDA 3ROBA 2OOVC 2ZDJA 1LOYA 1JNQA 2B1XB 3X41A 3OWSA 5TGNA 3RDEA 4X2HA 2W9PA 1YHQ3 1FA3A 4N6LA 3D79A 1SJWA 3N8BA 1JB5A 3HX8A 1U8CB 1RCKA 3CPOA 3WODG 1VQM3 1RNBA 1EA2A 3HZPA 2KF4A 3A5EA 1FUSA 4K1UA 1TRQA 1VQO3 3G4S3 3S5CA 1X1WA 5CLKA 3Q1CA 1SQWA 1IV7A 1UDII 1YGEA 2P0XA 1VQL3 1VQN3 4MMYB 1DMMA 1J2BA 2W9QA 3FG3A 2GBWB 7GSPA 1GOUA 2JDIH 2IA7A 1BNSA 3DGOA 1JRQA 3F9SA 3WHOA 4IT7A 1VQ63 2LYXA 1CEWI 2W56A 9RNTA 1N8QA 4MEIA 2BHMA 1W2ZA 4GL6A 3RGRA 2KCDA 1TJDA 1AVKA 4H61A 3CCJ3 2P38A 3LT8A 2AAEA 4HM5B 3LOYA 2RFRA 3F14A 1RLSA 1BNEA 3HIIA 1GY6A 2OQEA 1IT8A 3X42A 3LYGA 4WYKA 2QEX3 3WOFB 3M8CA 2C4BA 1K8A4 3DH2A 2OTL3 2Z6BA 1BNFA 4FR9A 1IQYA
chains in the Genus database with same CATH topology
3BLZA 1JB4A 2B24B 2XGNA 2BO9B 3V98A 2GEYA 5IERA 1M904 2UX0A 1NWWA 3FH1A 1M1XB 3B8LA 5EEOA 2QA43 1TIJA 1E3VA 3FZWA 3NX0A 1Q814 3NBBA 4HM0B 4NHFA 3QRDA 1MNLA 4MJDA 1OHOA 1TUHA 4MMXB 5KP3A 5AEWB 2W0QA 1DYUA 4HZBB 1W7CA 5AIGA 1OCVA 3KZTA 3H51A 1VQ53 1VQ73 3JUOA 1M1K4 5IG4A 1S5AA 2IUKA 3CCM3 1ASKA 4N6V0 1Q40B 3MG1A 1NDOB 2XGLA 1O7MB 3QK9A 2Q07A 2CW9A 1FUWA 2Z76A 3OXAA 3SXXA 2OWPA 3S28A 3IMAB 1A2KA 1V74A 1VZZA 2XR8B 3VSYA 2FNQA 1NB3I 2RSXA 2WOFA 2Z77A 3LH4A 4R80A 4XBTA 1IVVA 3HIGA 4N6MA 2XF3A 1UUVB 4FMDA 3LT9A 1IDPA 2QIYA 5FGOA 4EBGA 4JRFA 1OH0A 1UW1A 2W04A 4R9KA 2CFWA 3SX1A 1FGTA 3CCU3 5CK6A 4EXRA 1C7HA 3LTBA 2PNCA 1SIIA 3DGLA 1STFI 3OWYA 1W6GA 3PZWA 3UNLA 2BMRB 5IG3A 3G713 3EQQB 4OUQA 4OVMA 1ROVA 1D6YA 4HM6B 1YJ93 3MG2A 2FGTA 3CC73 1OF5B 1IT7A 4WFOA 4JF8A 3CPW2 1Q824 4HM3B 3EHCA 1EG9B 3U97A 3RGAA 4STDA 1US1A 3SOAA 1JKGB 4N6UA 1WMNA 1NU3A 3F7SA 4KFEA 3CCQ3 3NM2A 1OHPA 1ULIB 4J9AA 1LVNA 1N9JA 2P0MA 5IENA 1N5PA 2RCDA 3N54B 1AV4A 2E2TA 4HM7B 3DM8A 5EQLA 3LZAA 4K61A 4XM4A 4EV2A 1TP6A 3K0ZA 3OV4A 2MC8A 4AKZA 1YIT3 2D42A 3KFQC 2XFTA 2BMQB 3EE1A 3LTCA 3X3XA 3NBRA 1JN5A 4G1MB 3EX9A 5JBSA 2CWTA 3X3ZA 1Q42A 4PEJA 4KVHA 5JPPA 1YVBI 1SPUA 2O9UX 1Q7Y4 2OCTA 3K7CA 1E3RA 2HMKB 2YX9A 4I4KA 3JVCA 3UL5A 1ZX2A 3T8NA 4WWUC 3WOEB 1QVF2 1W02A 3DUKA 3HK4A 3UJMA 1YJW3 1FGRA 3PYJA 1CQSA 3Q2PA 3KIIA 2E2UA 3FF2A 4HZ9B 4EV5A 2CFGA 3EBTA 4XB5A 2CIUA 2Z7AA 8CHOA 4HM1B 3I563 1O7GB 1GS3A 3LMLA 1JV2B 4MMZB 4H3UA 1S723 2OOVA 3AMOB 2CG1A 3NHXA 3GZXB 1SIHA 1QVG2 1QMAA 4RBNA 3FF0A 1OF5A 3SVAA 3CCL3 1OHSA 5HGRA 1LOXA 2XFSA 1IVWA 1QJGA 1IV9A 1M9GA 3WMDA 2PZVA 2CC3A 2YFJB 4N6NB 1KWIA 2IMJA 3IJEB 2K0MA 3K9MC 3N9HA 1UUWB 3PCSA 1U5OA 3PXMA 1JJ22 2XSOB 1JKGA 2FXTA 1NB5I 4XDVA 3DY5A 3X40A 3STDA 5IG5A 1RKYA 4WP5A 2GEXA 2LQVA 1WTHA 2XEPA 3J7Yd 2D1WA 3EBYA 4K90B 4TX4A 3Q90A 3H3HA 1O7HB 2JQ5A 3DMCA 4XBYA 4XBXA 2C11A 5AYRB 2GU3A 2V1LA 3BNEA 3ALAA 3BNCA 3DXOA 4KFDA 5BVBA 1CYUA 5AI1A 3MSOA 1KD14 2HMLB 3HI7A 3CMA3 3SOYA 6STDA 2WOHA 5DREA 1JB2A 3CNXA 3O8YA 4NREA 1EQKA 3L0RA 3FG1A 4HVNA 1K9M4 1O7WB 1BUQA 4FMAA 5ELUA 4EYCA 5IEOA 1DMQA 5JPUA 3DGMA 1A67A 3NM7A 4X2OA 3GWRA 3DGNA 2CWVA 2M7OA 4BTYA 5IF6A 1VQ83 1R4CA 5FW5A 5IEPA 3NBJA 5G2GA 1OACA 1QAFA 3GZYB 4ZM8A 2INXA 3ER7A 3VF1A 1LNHA 1Y4KA 4HJLB 5ELJA 2C10A 1VQ93 2L4VA 1W4NA 2CHCA 1FGMA 3CCS3 5CF2A 3E99A 2MF7A 5AYSC 5IG0A 3AMOA 2BNGA 1UI7A 1YIJ3 4RNZA 1LXEA 2HMMB 3NUVA 2STDA 2W56B 4QWTA 5DRVA 4AEQA 3I0YA 2CH9A 4FMCA 4HYZA 2XSHB 3EN8A 3GAXA 3NQYA 4N3VA 3CCR3 3OWUA 1K28A 3WA3A 1A90A 4AKYA 2IUJA 3TDGA 1OGXA 4LGQA 1DVDA 3UB1A 2SBLA 3B7CA 3BNBA 3CC43 1RRHA 4K1VA 1WMOA 1WQLB 3G0KA 1ISKA 4XDWA 3JUNA 2XH9A 4R1KA 3D3LA 3V99A 4HKVB 2WO0A 5KP1A 1HU9A 2P05A 3EF8A 3SEDA 2HMJB 4N6OB 1HKXA 5CXOA 3FGYA 3B4OA 1Q40A 1MOLA 3OW22 3KN4A 4FCJA 1NO3A 2I9WA 3EC9A 3OX9A 5AIHA 3LTAA 1PU4A 3GZBA 3G6E3 2CG0A 5STDA 3JUQA 1GY5A 1N9EA 2OQEC 3CXC2 2GBXB 3NXJA 2CK3H 1ROAA 2ML6A 3JUPA 5AIIA 4L7KA 1OUNA 3CCE3 3FLJA 3V92A 1OGZA 4N6TA 2A15A 3K63A 4LMIA 5D81A 4BTWA 4RZMA 2WGOA 5D83A 4ORLA 4HM2B 1N5HA 2K54A 4FCMA 4HM4B 3MWZA 2W2CA 1GY7A 3FKAA 1N8R4 2YFLB 1K41A 3BNDA 2XRXB 3JUMA 4HBRA 4L8PA 4LZIA 2CWUA 5AIFA 1Z1SA 1IQXA 1RRLA 1TFKA 3CCV3 5LC6A 1D6UA 1EKMA 2CKFB 3ECFA 2KXGA 3CC23 2W03A 4FMBA 1G96A 3I553 2HMNB 1WMPA 1IK3A 3X3YA 1IVUA 4KFFA 7STDA 2YFIB 3CU3A 1RJOA 3WA2X 4L8OA 3CD63 1IVXA 1W2B2 1W00A 2ZL8A 3SLUA 1K734 1PFPA 1NJI4 4CCVA 1W6CA 1Q864 4J8TA 3B4PA 3S27A 3EJVA 3MHEA 5I97A 1VQ43 3NV0B 1FGOA 3F8XA 2KRTA 2P09A 4BTXA 1A2VA 3FG4A 4CDLA 5A0OB 4GB5A 3KE7A 3CNMA 1E97A 3FSDA 5LC7A 1FGQA 3G16A 1GYBA 1TFOA 1KSIA 1KQS2 4Q53A 1L5GB 2F98A 1JN5B 5BXQA 3IPTA 2GXFA 3MKIA 1CYVA 3EB8A 4O3VA 1STDA 2CFDA 4O02B 2OTJ3 3PCRA 1OPYA 2Y74A 3S29A 1QAKA 3PGBA 1TU5A 3EN1B 4IIAA 1T5YA 3MPHA 3PS8A 1QALA 4RNYA 3G8ZA 2RGQA 1GD3A 1VQP3 4O2HA 2WGQA 3VGNA 3K5TA 1IQ8A 4WHAA 1AR0A 2F86B 1VQK3 3KKGA 2ML5A 3DZLA 2O3OA 3F40A 4OK0A 4R9LA 2BT3A 3CME3 5EVHA 3NQZA 2CFLA 1AVLA 2F99A 2GU1A 5CF1A 3FCSB 3S67A 3UL6A 2CFKA 2BMOB 2R4IA 4WYKB 2HMOB 3WDGB 3MYTA 1WNHA 4O8SA 2E2VA 3KSPA 1YJN3 5AEUB 1KC84 1W5ZA 3D9RA 4U13A 3MG3A 1RN7A 3U1WA 5IW9A 1D6ZA 5D82A 3T8UA 1W01A 3F8HA 4R4KA 1ULJB 5KP4A 1F8NA 1UI8A 2QGUA 1GD4A 4LSOA 1DMNA 4KZ1A 1W6YA 1ZO2A 4HM8B 4IPBA 2W6JH 3A76A 1O7PB 3NV0A 3LTDA 4LEHA 4FCZA 1O7NB 3F7XA 1DVCA 3KSED 3T0UA 4EC6A 1IU7A 2Y73A 1YI23 3GZRA 3BB9A 3GRDA 3ROBA 2OOVC 2ZDJA 2B1XB 1JNQA 3X41A 3OWSA 5TGNA 3RDEA 4X2HA 2W9PA 1YHQ3 1FA3A 4N6LA 1SJWA 3N8BA 1JB5A 3HX8A 1U8CB 3WODG 3CPOA 1VQM3 1EA2A 3HZPA 4K1UA 1VQO3 3G4S3 3S5CA 5CLKA 3Q1CA 1SQWA 1IV7A 2P0XA 1YGEA 1VQL3 1VQN3 4MMYB 1DMMA 1J2BA 2W9QA 3FG3A 2GBWB 2JDIH 2IA7A 3DGOA 1JRQA 3F9SA 4IT7A 1VQ63 2LYXA 1CEWI 2W56A 1N8QA 4MEIA 2BHMA 1W2ZA 4GL6A 3RGRA 2KCDA 1AVKA 4H61A 3CCJ3 2P38A 3LT8A 4HM5B 3LOYA 2RFRA 3F14A 3HIIA 1GY6A 2OQEA 1IT8A 3X42A 3LYGA 4WYKA 2QEX3 3WOFB 3M8CA 1K8A4 3LXUX 2OTL3 2Z6BA 4FR9A 1IQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLZ A;  1JB4 A;  2B24 B;  2GEY A;  5IER A;  2UX0 A;  1NWW A;  3FH1 A;  3B8L A;  1E3V A;  3FZW A;  4HM0 B;  4MJD A;  1OHO A;  1TUH A;  5AEW B;  5KP3 A;  5AIG A;  4HZB B;  1OCV A;  3KZT A;  3H51 A;  3JUO A;  5IG4 A;  1S5A A;  1ASK A;  1Q40 B;  3MG1 A;  1NDO B;  1O7M B;  2Z76 A;  3OXA A;  2OWP A;  1A2K A;  1VZZ A;  2XR8 B;  3VSY A;  2Z77 A;  4XBT A;  1UUV B;  1IDP A;  2QIY A;  1OH0 A;  4R9K A;  5CK6 A;  1C7H A;  3OWY A;  3UNL A;  2BMR B;  5IG3 A;  3EQQ B;  4OUQ A;  4OVM A;  4HM6 B;  3MG2 A;  1OF5 B;  4HM3 B;  3EHC A;  1EG9 B;  3RGA A;  4STD A;  3SOA A;  1JKG B;  1NU3 A;  3F7S A;  3NM2 A;  1OHP A;  1ULI B;  4J9A A;  5IEN A;  2RCD A;  4HM7 B;  3DM8 A;  3LZA A;  4XM4 A;  1TP6 A;  3K0Z A;  3OV4 A;  2BMQ B;  3NBR A;  1JN5 A;  3EX9 A;  1Q42 A;  4PEJ A;  4KVH A;  5JPP A;  3K7C A;  1E3R A;  2HMK B;  4I4K A;  1ZX2 A;  3T8N A;  4WWU C;  1W02 A;  3DUK A;  3HK4 A;  3UJM A;  1CQS A;  3FF2 A;  4HZ9 B;  3EBT A;  4XB5 A;  2Z7A A;  8CHO A;  4HM1 B;  1O7G B;  1GS3 A;  4H3U A;  3NHX A;  3GZX B;  1QMA A;  3FF0 A;  1OF5 A;  1OHS A;  5HGR A;  1QJG A;  3WMD A;  2PZV A;  2YFJ B;  2IMJ A;  1UUW B;  1U5O A;  2XSO B;  1JKG A;  4XDV A;  5IG5 A;  3STD A;  4WP5 A;  2GEX A;  3EBY A;  3Q90 A;  3H3H A;  1O7H B;  2JQ5 A;  3DMC A;  4XBY A;  4XBX A;  3DXO A;  5BVB A;  5AI1 A;  3MSO A;  2HML B;  3SOY A;  6STD A;  5DRE A;  1JB2 A;  3CNX A;  4HVN A;  1O7W B;  1BUQ A;  5IEO A;  1DMQ A;  5JPU A;  4X2O A;  3GWR A;  5IF6 A;  5FW5 A;  5IEP A;  5G2G A;  3GZY B;  2INX A;  3ER7 A;  4HJL B;  2CHC A;  5CF2 A;  3E99 A;  5IG0 A;  2BNG A;  2HMM B;  3NUV A;  2STD A;  5DRV A;  3I0Y A;  2XSH B;  3EN8 A;  4N3V A;  3OWU A;  1OGX A;  4LGQ A;  3B7C A;  4K1V A;  1WQL B;  3G0K A;  1ISK A;  4XDW A;  3JUN A;  4R1K A;  4HKV B;  5KP1 A;  3SED A;  3EF8 A;  2HMJ B;  1HKX A;  5CXO A;  3FGY A;  3B4O A;  1Q40 A;  4FCJ A;  2I9W A;  3EC9 A;  3OX9 A;  5AIH A;  3GZB A;  5STD A;  3JUQ A;  1GY5 A;  2GBX B;  3NXJ A;  3JUP A;  5AII A;  4L7K A;  1OUN A;  3FLJ A;  1OGZ A;  2A15 A;  4LMI A;  5D81 A;  4RZM A;  5D83 A;  4ORL A;  4HM2 B;  4HM4 B;  2K54 A;  4FCM A;  2W2C A;  1GY7 A;  3FKA A;  2YFL B;  1K41 A;  2XRX B;  3JUM A;  4L8P A;  5AIF A;  1Z1S A;  2CKF B;  3ECF A;  2HMN B;  7STD A;  2YFI B;  3CU3 A;  4L8O A;  1W00 A;  4J8T A;  3B4P A;  3EJV A;  3MHE A;  3NV0 B;  3F8X A;  4CDL A;  4GB5 A;  3KE7 A;  3CNM A;  1E97 A;  3FSD A;  3G16 A;  1GYB A;  4Q53 A;  2F98 A;  1JN5 B;  5BXQ A;  3IPT A;  2GXF A;  3MKI A;  1STD A;  1OPY A;  3EN1 B;  4IIA A;  3G8Z A;  2RGQ A;  3VGN A;  1AR0 A;  2F86 B;  3KKG A;  3DZL A;  3F40 A;  4R9L A;  5EVH A;  2F99 A;  5CF1 A;  2BMO B;  2R4I A;  4WYK B;  2HMO B;  3MYT A;  3KSP A;  5AEU B;  3D9R A;  4U13 A;  3MG3 A;  5D82 A;  3T8U A;  1W01 A;  3F8H A;  1ULJ B;  5KP4 A;  2QGU A;  1DMN A;  1W6Y A;  1ZO2 A;  4HM8 B;  3A76 A;  1O7P B;  3NV0 A;  4LEH A;  1O7N B;  3F7X A;  3GZR A;  3BB9 A;  3GRD A;  3ROB A;  2B1X B;  3OWS A;  5TGN A;  4X2H A;  1SJW A;  1JB5 A;  3HX8 A;  3CPO A;  1EA2 A;  3HZP A;  4K1U A;  3S5C A;  5CLK A;  1DMM A;  2GBW B;  3F9S A;  3RGR A;  4HM5 B;  2RFR A;  3F14 A;  1GY6 A;  3LYG A;  4WYK A;  3M8C A; 
#chains in the Genus database with same CATH topology
 3BLZ A;  1JB4 A;  2B24 B;  2XGN A;  1IYY A;  2BO9 B;  3V98 A;  1BRH A;  2GEY A;  5IER A;  1M90 4;  2UX0 A;  1NWW A;  3FH1 A;  2ZHX B;  1M1X B;  6GSP A;  3AGO A;  3B8L A;  5EEO A;  2QA4 3;  1TIJ A;  3ZG5 A;  1E3V A;  3FZW A;  1I2F A;  3NX0 A;  1Q81 4;  1Q9E A;  2K3D A;  3NBB A;  4HM0 B;  4NHF A;  1BGS A;  3QRD A;  1B2M A;  1UCL A;  1MNL A;  1OHO A;  1TUH A;  4MJD A;  4MMX B;  5KP3 A;  5AEW B;  1MWR A;  2W0Q A;  1CH0 A;  1DYU A;  4HZB B;  1W7C A;  5AIG A;  1BAN A;  1OCV A;  3KZT A;  3H51 A;  1VQ5 3;  1VQ7 3;  3JUO A;  1M1K 4;  5IG4 A;  1S5A A;  2IUK A;  3CCM 3;  1ASK A;  4N6V 0;  1Q40 B;  3MG1 A;  1NDO B;  2XGL A;  1O7M B;  3QK9 A;  2Q07 A;  2CW9 A;  1I3I A;  2Z76 A;  1FUW A;  3OXA A;  1RMS A;  3SXX A;  2OWP A;  3S28 A;  3IMA B;  1MGR A;  1A2K A;  1MGW A;  1V74 A;  1VZZ A;  2XR8 B;  3VSY A;  2H0H A;  2FNQ A;  1NB3 I;  2RSX A;  2WOF A;  2Z77 A;  3KCH A;  3LH4 A;  4R80 A;  5BIR A;  4XBT A;  1IVV A;  3HIG A;  4N6M A;  2XF3 A;  1UUV B;  4LYL B;  4FMD A;  3LT9 A;  1B2X A;  1IDP A;  2QIY A;  5FGO A;  4EBG A;  4JRF A;  1OH0 A;  1UW1 A;  3D5I A;  2W04 A;  4R9K A;  1T2I A;  1BRJ A;  2CFW A;  2KAA A;  3SX1 A;  1FGT A;  3CCU 3;  5CK6 A;  4EXR A;  1C7H A;  3LTB A;  2PNC A;  1SII A;  3DGL A;  1STF I;  3OWY A;  1W6G A;  1UCK A;  3AGN A;  3PZW A;  4BU4 A;  2RNT A;  2BMR B;  3UNL A;  5IG3 A;  3G71 3;  3EQQ B;  4OUQ A;  4OVM A;  1ROV A;  1D6Y A;  1BOX A;  4HM6 B;  1YJ9 3;  3MG2 A;  2FGT A;  1JBT A;  3CC7 3;  1OF5 B;  1IT7 A;  4WFO A;  4JF8 A;  2UUG C;  3ZFZ A;  3CPW 2;  1Q82 4;  4HM3 B;  1SAR A;  3EHC A;  1EG9 B;  3U97 A;  3RGA A;  4STD A;  4NPB A;  3AHW A;  1US1 A;  3SOA A;  1JKG B;  4N6U A;  1WMN A;  1NU3 A;  1VQQ A;  3F7S A;  4KFE A;  3CCQ 3;  3NM2 A;  1RDS A;  1OHP A;  1ULI B;  4J9A A;  1LVN A;  3BIR A;  1JZO A;  1N9J A;  2P0M A;  5IEN A;  1N5P A;  2RCD A;  4RNT A;  3N54 B;  1AV4 A;  5M1A A;  2E2T A;  4HM7 B;  1RGF A;  3DM8 A;  5EQL A;  3LZA A;  4K61 A;  4XM4 A;  4EV2 A;  1TP6 A;  3K0Z A;  3OV4 A;  1I70 A;  2MC8 A;  4AKZ A;  1B21 A;  1RGL A;  1YIT 3;  5G1L A;  2D42 A;  3KFQ C;  1BUJ A;  2XFT A;  2L1S A;  4KT3 B;  2BMQ B;  1GOY A;  3EE1 A;  3LTC A;  5G1K A;  3X3X A;  3NBR A;  1JN5 A;  1AY7 A;  4G1M B;  3EX9 A;  2ZA4 A;  5JBS A;  2CWT A;  3X3Z A;  1Q42 A;  4PEJ A;  4KVH A;  5JPP A;  1YVB I;  1SPU A;  2O9U X;  1JZD A;  1Q7Y 4;  2OCT A;  1A2P A;  3K7C A;  1I0V A;  1E3R A;  2HMK B;  2YX9 A;  4I4K A;  3JVC A;  1GSP A;  3UL5 A;  1ZX2 A;  1ZGX A;  3T8N A;  1UUG B;  3HOH A;  4WWU C;  3WOE B;  5M18 A;  1QVF 2;  1LQM B;  1I3F A;  1MWU A;  1W02 A;  3DUK A;  3HK4 A;  3UJM A;  1YJW 3;  1FGR A;  3PYJ A;  1BNR A;  1CQS A;  3Q2P A;  3KII A;  1V57 A;  1FYS A;  1B2Z A;  2E2U A;  3FF2 A;  4HZ9 B;  3SYU A;  2CFG A;  3EBT A;  4EV5 A;  4XB5 A;  2CIU A;  2Z7A A;  8CHO A;  4HM1 B;  3I56 3;  1O7G B;  1GS3 A;  4I5Q A;  3LML A;  1JV2 B;  4MMZ B;  4H3U A;  4HOH A;  1S72 3;  2OOV A;  3AMO B;  2CG1 A;  3NHX A;  2RBI A;  3GZX B;  1C54 A;  2F5M A;  1SIH A;  1QVG 2;  1V58 A;  1QMA A;  3ZG0 A;  8RNT A;  4RBN A;  1GMP A;  3FF0 A;  1OF5 A;  3SVA A;  3CCL 3;  1OHS A;  5HGR A;  1LOX A;  2XFS A;  1IVW A;  1QJG A;  1IV9 A;  1LOW A;  1M9G A;  2PZV A;  3WMD A;  2CC3 A;  2YFJ B;  4N6N B;  1KWI A;  2IMJ A;  3WR2 A;  3IJE B;  2K0M A;  3K9M C;  3N9H A;  1BRN L;  1B3S A;  1X1X A;  1UUW B;  3PCS A;  6RNT A;  2KF3 A;  1U5O A;  3PXM A;  1JJ2 2;  2XSO B;  1JKG A;  2FXT A;  1NB5 I;  1X1Y A;  4XDV A;  1MWT A;  3DY5 A;  3X40 A;  3STD A;  5IG5 A;  1RKY A;  4WP5 A;  1HYF A;  2GEX A;  1RN1 A;  1WTH A;  2LQV A;  2XEP A;  3J7Y d;  2D1W A;  1BAO A;  3EBY A;  4K90 B;  4TX4 A;  3Q90 A;  3H3H A;  1O7H B;  2JQ5 A;  4DKI A;  1UCI A;  1UGH I;  3DMC A;  4XBY A;  3URP A;  1LNI A;  4XBX A;  1BIR A;  2C11 A;  5AYR B;  5GSP A;  2GU3 A;  2V1L A;  3BNE A;  3ALA A;  1FZU A;  3BNC A;  3DXO A;  4KFD A;  5BVB A;  1CYU A;  5AI1 A;  3MSO A;  1KD1 4;  2HML B;  3HI7 A;  3CMA 3;  3SOY A;  4CJN A;  1EEJ A;  6STD A;  2WOH A;  5DRE A;  1JB2 A;  3CNX A;  3O8Y A;  4NRE A;  1EQK A;  5RNT A;  3L0R A;  3FG1 A;  4HVN A;  1K9M 4;  1O7W B;  1BUQ A;  4FMA A;  5ELU A;  4EYC A;  5IEO A;  1DMQ A;  5JPU A;  3DGM A;  1A67 A;  3NM7 A;  2CX0 A;  3GWR A;  1B20 A;  3DGN A;  4X2O A;  2CWV A;  2M7O A;  4BTY A;  5IF6 A;  1VQ8 3;  1R4C A;  5FW5 A;  5IEP A;  1TRP A;  3NBJ A;  5G2G A;  1OAC A;  1QAF A;  3GZY B;  4ZM8 A;  2INX A;  2HOH A;  3ER7 A;  2F5W A;  3VF1 A;  1LNH A;  1Y4K A;  3LXU X;  4HJL B;  1FW7 A;  5ELJ A;  2C10 A;  1VQ9 3;  2L4V A;  1W4N A;  2CHC A;  1AQZ A;  1FGM A;  3CCS 3;  5CF2 A;  3E99 A;  2MF7 A;  5AYS C;  5IG0 A;  3AMO A;  1RN4 A;  2BNG A;  1BSB A;  1UI7 A;  4ILF A;  1YIJ 3;  4RNZ A;  1LXE A;  2HMM B;  3NUV A;  2STD A;  2CX1 A;  2W56 B;  2IYJ A;  4QWT A;  5DRV A;  4AEQ A;  3I0Y A;  2CH9 A;  4FMC A;  4HYZ A;  2XSH B;  4CPK A;  3EN8 A;  3GAX A;  3NQY A;  1UGI A;  4N3V A;  3OWU A;  1K28 A;  3WA3 A;  3CCR 3;  1A90 A;  4AKY A;  2IUJ A;  1BRI A;  4J5G A;  1B2U A;  3TDG A;  1OGX A;  4LGQ A;  1DVD A;  1HZ1 A;  1BRK A;  1ZS7 A;  2SBL A;  3B7C A;  1NNV A;  1RRH A;  3BNB A;  3UB1 A;  3CC4 3;  2SAR A;  4K1V A;  1WMO A;  1WQL B;  3G0K A;  1ISK A;  3RNT A;  4XDW A;  3D5G A;  3JUN A;  2XH9 A;  1BSC A;  4R1K A;  3D3L A;  3V99 A;  4HKV B;  2WO0 A;  5KP1 A;  1HU9 A;  2P05 A;  3EF8 A;  3SED A;  2HMJ B;  4N6O B;  1HKX A;  1BVI A;  5CXO A;  2F4Y A;  4EW5 A;  1BSA A;  3FGY A;  1YNV X;  3B4O A;  1Q40 A;  1MOL A;  4GHO A;  3OW2 2;  1I8V A;  3KN4 A;  4FCJ A;  1NO3 A;  2I9W A;  3EC9 A;  3OX9 A;  5AIH A;  2GSP A;  3LTA A;  1PU4 A;  3GZB A;  1BSD A;  3G6E 3;  2CG0 A;  5STD A;  3JUQ A;  2R41 A;  1GY5 A;  1N9E A;  1YGW A;  2OQE C;  3CXC 2;  1LOV A;  1GOV A;  2GBX B;  2H0I A;  3NXJ A;  2CK3 H;  1ROA A;  1RTU A;  2ML6 A;  3JUP A;  5AII A;  4L7K A;  1OUN A;  3CCE 3;  3FLJ A;  3V92 A;  1OGZ A;  4N6T A;  1GMQ A;  1BU4 A;  1RGE A;  2A15 A;  3K63 A;  4LMI A;  1FUT A;  5D81 A;  4BTW A;  4RZM A;  2WGO A;  5D83 A;  4ORL A;  4HM2 B;  1N5H A;  2K54 A;  4FCM A;  4HM4 B;  1PYL A;  3MWZ A;  1I2E A;  1GY7 A;  2W2C A;  5M19 A;  1RGC A;  3FKA A;  1I0X A;  1N8R 4;  2YFL B;  1K41 A;  3BND A;  2XRX B;  3JUM A;  4HBR A;  4L8P A;  4LZI A;  2CWU A;  5AIF A;  1Z1S A;  1IQX A;  1RRL A;  1TFK A;  3CCV 3;  5LC6 A;  1B2S A;  2IY2 A;  1D6U A;  1EKM A;  2CKF B;  3ECF A;  2KXG A;  1RCL A;  4BL2 A;  3CC2 3;  2W03 A;  4FMB A;  1G96 A;  3I55 3;  2HMN B;  1WMP A;  1IK3 A;  3X3Y A;  1IVU A;  4KFF A;  7STD A;  2YFI B;  3CU3 A;  4BL3 A;  1RJO A;  3WA2 X;  2BU4 A;  1LQG C;  4L8O A;  1IVX A;  3CD6 3;  1RNT A;  1X1U A;  1W00 A;  1BRG A;  2ZL8 A;  1W2B 2;  3SLU A;  1K73 4;  1GMR A;  1PFP A;  1NJI 4;  2KF5 A;  4CCV A;  3AHS A;  1W6C A;  1Q86 4;  4J8T A;  3B4P A;  1EUI C;  3S27 A;  3EJV A;  1UCJ A;  3MHE A;  5I97 A;  1VQ4 3;  2H0G A;  3NV0 B;  1FGO A;  3F8X A;  2KRT A;  1R4Y A;  2P09 A;  1G02 A;  4BTX A;  3GSP A;  5BU4 A;  1A2V A;  3FG4 A;  4CDL A;  5A0O B;  4GB5 A;  3KE7 A;  4GSP A;  3CNM A;  1E97 A;  3FSD A;  5LC7 A;  1FGQ A;  1DE3 A;  3G16 A;  1GYB A;  1TFO A;  1KSI A;  1KQS 2;  4Q53 A;  2UGI A;  2F98 A;  1L5G B;  1JN5 B;  5BXQ A;  1BSE A;  3IPT A;  2GXF A;  3MKI A;  1Q7H A;  1CYV A;  3EB8 A;  4O3V A;  1STD A;  1JBR A;  2CFD A;  4O02 B;  2OTJ 3;  3PCR A;  1RGH A;  1BNG A;  1OPY A;  1G0T A;  2Y74 A;  4J5K A;  3S29 A;  1QAK A;  3PGB A;  1TU5 A;  3EN1 B;  4IIA A;  1T5Y A;  3MPH A;  3PS8 A;  1QAL A;  4RNY A;  3G8Z A;  2RGQ A;  1YVS A;  3BU4 A;  1GD3 A;  1I2G A;  1VQP 3;  4O2H A;  2WGQ A;  3VGN A;  3K5T A;  1IQ8 A;  1T2H A;  4WHA A;  1AR0 A;  1TTO A;  2F86 B;  1RGA A;  1VQK 3;  3KKG A;  3Q3F A;  2ML5 A;  3DZL A;  3DGY A;  2O3O A;  3F40 A;  4OK0 A;  4R9L A;  2BT3 A;  3CME 3;  5EVH A;  3NQZ A;  2CFL A;  1AVL A;  2F99 A;  2F56 A;  1MWS A;  2GU1 A;  1JBS A;  1DET A;  5CF1 A;  3FCS B;  1RHL A;  3S67 A;  3UL6 A;  2CFK A;  2BMO B;  2R4I A;  4WYK B;  2HMO B;  3WDG B;  3MYT A;  1WNH A;  1LRA A;  2E2V A;  1PY3 A;  3KSP A;  4O8S A;  1YJN 3;  1T3B A;  5AEU B;  1KC8 4;  1W5Z A;  3D9R A;  4U13 A;  3MG3 A;  1RN7 A;  3D4A A;  3U1W A;  1D6Z A;  5IW9 A;  1RSN A;  5D82 A;  3T8U A;  1W01 A;  3F8H A;  4R4K A;  2BIR A;  1ULJ B;  5KP4 A;  1F8N A;  1UI8 A;  4BIR A;  2QGU A;  1GD4 A;  4LSO A;  1BNJ A;  1DMN A;  4KZ1 A;  1W6Y A;  1ZO2 A;  1BNI A;  4HM8 B;  1RGK A;  4IPB A;  2W6J H;  2J8X B;  3A76 A;  5HOH A;  1O7P B;  1B27 A;  1RGG A;  3NV0 A;  3LTD A;  4LEH A;  7RNT A;  4HAA A;  4FCZ A;  1BRS A;  1O7N B;  3F7X A;  2KF6 A;  1DVC A;  3KSE D;  3T0U A;  4EC6 A;  1IU7 A;  2Y73 A;  1YI2 3;  3GZR A;  2AAD A;  3BB9 A;  3GRD A;  3ROB A;  2OOV C;  2ZDJ A;  1LOY A;  1JNQ A;  2B1X B;  3X41 A;  3OWS A;  5TGN A;  3RDE A;  4X2H A;  2W9P A;  1YHQ 3;  1FA3 A;  4N6L A;  3D79 A;  1SJW A;  3N8B A;  1JB5 A;  3HX8 A;  1U8C B;  1RCK A;  3CPO A;  3WOD G;  1VQM 3;  1RNB A;  1EA2 A;  3HZP A;  2KF4 A;  3A5E A;  1FUS A;  4K1U A;  1TRQ A;  1VQO 3;  3G4S 3;  3S5C A;  1X1W A;  5CLK A;  3Q1C A;  1SQW A;  1IV7 A;  1UDI I;  1YGE A;  2P0X A;  1VQL 3;  1VQN 3;  4MMY B;  1DMM A;  1J2B A;  2W9Q A;  3FG3 A;  2GBW B;  7GSP A;  1GOU A;  2JDI H;  2IA7 A;  1BNS A;  3DGO A;  1JRQ A;  3F9S A;  3WHO A;  4IT7 A;  1VQ6 3;  2LYX A;  1CEW I;  2W56 A;  9RNT A;  1N8Q A;  4MEI A;  2BHM A;  1W2Z A;  4GL6 A;  3RGR A;  2KCD A;  1TJD A;  1AVK A;  4H61 A;  3CCJ 3;  2P38 A;  3LT8 A;  2AAE A;  4HM5 B;  3LOY A;  2RFR A;  3F14 A;  1RLS A;  1BNE A;  3HII A;  1GY6 A;  2OQE A;  1IT8 A;  3X42 A;  3LYG A;  4WYK A;  2QEX 3;  3WOF B;  3M8C A;  2C4B A;  1K8A 4;  3DH2 A;  2OTL 3;  2Z6B A;  1BNF A;  4FR9 A;  1IQY A; 
#chains in the Genus database with same CATH homology
 3BLZ A;  1JB4 A;  2B24 B;  2XGN A;  2BO9 B;  3V98 A;  2GEY A;  5IER A;  1M90 4;  2UX0 A;  1NWW A;  3FH1 A;  1M1X B;  3B8L A;  5EEO A;  2QA4 3;  1TIJ A;  1E3V A;  3FZW A;  3NX0 A;  1Q81 4;  3NBB A;  4HM0 B;  4NHF A;  3QRD A;  1MNL A;  4MJD A;  1OHO A;  1TUH A;  4MMX B;  5KP3 A;  5AEW B;  2W0Q A;  1DYU A;  4HZB B;  1W7C A;  5AIG A;  1OCV A;  3KZT A;  3H51 A;  1VQ5 3;  1VQ7 3;  3JUO A;  1M1K 4;  5IG4 A;  1S5A A;  2IUK A;  3CCM 3;  1ASK A;  4N6V 0;  1Q40 B;  3MG1 A;  1NDO B;  2XGL A;  1O7M B;  3QK9 A;  2Q07 A;  2CW9 A;  1FUW A;  2Z76 A;  3OXA A;  3SXX A;  2OWP A;  3S28 A;  3IMA B;  1A2K A;  1V74 A;  1VZZ A;  2XR8 B;  3VSY A;  2FNQ A;  1NB3 I;  2RSX A;  2WOF A;  2Z77 A;  3LH4 A;  4R80 A;  4XBT A;  1IVV A;  3HIG A;  4N6M A;  2XF3 A;  1UUV B;  4FMD A;  3LT9 A;  1IDP A;  2QIY A;  5FGO A;  4EBG A;  4JRF A;  1OH0 A;  1UW1 A;  2W04 A;  4R9K A;  2CFW A;  3SX1 A;  1FGT A;  3CCU 3;  5CK6 A;  4EXR A;  1C7H A;  3LTB A;  2PNC A;  1SII A;  3DGL A;  1STF I;  3OWY A;  1W6G A;  3PZW A;  3UNL A;  2BMR B;  5IG3 A;  3G71 3;  3EQQ B;  4OUQ A;  4OVM A;  1ROV A;  1D6Y A;  4HM6 B;  1YJ9 3;  3MG2 A;  2FGT A;  3CC7 3;  1OF5 B;  1IT7 A;  4WFO A;  4JF8 A;  3CPW 2;  1Q82 4;  4HM3 B;  3EHC A;  1EG9 B;  3U97 A;  3RGA A;  4STD A;  1US1 A;  3SOA A;  1JKG B;  4N6U A;  1WMN A;  1NU3 A;  3F7S A;  4KFE A;  3CCQ 3;  3NM2 A;  1OHP A;  1ULI B;  4J9A A;  1LVN A;  1N9J A;  2P0M A;  5IEN A;  1N5P A;  2RCD A;  3N54 B;  1AV4 A;  2E2T A;  4HM7 B;  3DM8 A;  5EQL A;  3LZA A;  4K61 A;  4XM4 A;  4EV2 A;  1TP6 A;  3K0Z A;  3OV4 A;  2MC8 A;  4AKZ A;  1YIT 3;  2D42 A;  3KFQ C;  2XFT A;  2BMQ B;  3EE1 A;  3LTC A;  3X3X A;  3NBR A;  1JN5 A;  4G1M B;  3EX9 A;  5JBS A;  2CWT A;  3X3Z A;  1Q42 A;  4PEJ A;  4KVH A;  5JPP A;  1YVB I;  1SPU A;  2O9U X;  1Q7Y 4;  2OCT A;  3K7C A;  1E3R A;  2HMK B;  2YX9 A;  4I4K A;  3JVC A;  3UL5 A;  1ZX2 A;  3T8N A;  4WWU C;  3WOE B;  1QVF 2;  1W02 A;  3DUK A;  3HK4 A;  3UJM A;  1YJW 3;  1FGR A;  3PYJ A;  1CQS A;  3Q2P A;  3KII A;  2E2U A;  3FF2 A;  4HZ9 B;  4EV5 A;  2CFG A;  3EBT A;  4XB5 A;  2CIU A;  2Z7A A;  8CHO A;  4HM1 B;  3I56 3;  1O7G B;  1GS3 A;  3LML A;  1JV2 B;  4MMZ B;  4H3U A;  1S72 3;  2OOV A;  3AMO B;  2CG1 A;  3NHX A;  3GZX B;  1SIH A;  1QVG 2;  1QMA A;  4RBN A;  3FF0 A;  1OF5 A;  3SVA A;  3CCL 3;  1OHS A;  5HGR A;  1LOX A;  2XFS A;  1IVW A;  1QJG A;  1IV9 A;  1M9G A;  3WMD A;  2PZV A;  2CC3 A;  2YFJ B;  4N6N B;  1KWI A;  2IMJ A;  3IJE B;  2K0M A;  3K9M C;  3N9H A;  1UUW B;  3PCS A;  1U5O A;  3PXM A;  1JJ2 2;  2XSO B;  1JKG A;  2FXT A;  1NB5 I;  4XDV A;  3DY5 A;  3X40 A;  3STD A;  5IG5 A;  1RKY A;  4WP5 A;  2GEX A;  2LQV A;  1WTH A;  2XEP A;  3J7Y d;  2D1W A;  3EBY A;  4K90 B;  4TX4 A;  3Q90 A;  3H3H A;  1O7H B;  2JQ5 A;  3DMC A;  4XBY A;  4XBX A;  2C11 A;  5AYR B;  2GU3 A;  2V1L A;  3BNE A;  3ALA A;  3BNC A;  3DXO A;  4KFD A;  5BVB A;  1CYU A;  5AI1 A;  3MSO A;  1KD1 4;  2HML B;  3HI7 A;  3CMA 3;  3SOY A;  6STD A;  2WOH A;  5DRE A;  1JB2 A;  3CNX A;  3O8Y A;  4NRE A;  1EQK A;  3L0R A;  3FG1 A;  4HVN A;  1K9M 4;  1O7W B;  1BUQ A;  4FMA A;  5ELU A;  4EYC A;  5IEO A;  1DMQ A;  5JPU A;  3DGM A;  1A67 A;  3NM7 A;  4X2O A;  3GWR A;  3DGN A;  2CWV A;  2M7O A;  4BTY A;  5IF6 A;  1VQ8 3;  1R4C A;  5FW5 A;  5IEP A;  3NBJ A;  5G2G A;  1OAC A;  1QAF A;  3GZY B;  4ZM8 A;  2INX A;  3ER7 A;  3VF1 A;  1LNH A;  1Y4K A;  4HJL B;  5ELJ A;  2C10 A;  1VQ9 3;  2L4V A;  1W4N A;  2CHC A;  1FGM A;  3CCS 3;  5CF2 A;  3E99 A;  2MF7 A;  5AYS C;  5IG0 A;  3AMO A;  2BNG A;  1UI7 A;  1YIJ 3;  4RNZ A;  1LXE A;  2HMM B;  3NUV A;  2STD A;  2W56 B;  4QWT A;  5DRV A;  4AEQ A;  3I0Y A;  2CH9 A;  4FMC A;  4HYZ A;  2XSH B;  3EN8 A;  3GAX A;  3NQY A;  4N3V A;  3CCR 3;  3OWU A;  1K28 A;  3WA3 A;  1A90 A;  4AKY A;  2IUJ A;  3TDG A;  1OGX A;  4LGQ A;  1DVD A;  3UB1 A;  2SBL A;  3B7C A;  3BNB A;  3CC4 3;  1RRH A;  4K1V A;  1WMO A;  1WQL B;  3G0K A;  1ISK A;  4XDW A;  3JUN A;  2XH9 A;  4R1K A;  3D3L A;  3V99 A;  4HKV B;  2WO0 A;  5KP1 A;  1HU9 A;  2P05 A;  3EF8 A;  3SED A;  2HMJ B;  4N6O B;  1HKX A;  5CXO A;  3FGY A;  3B4O A;  1Q40 A;  1MOL A;  3OW2 2;  3KN4 A;  4FCJ A;  1NO3 A;  2I9W A;  3EC9 A;  3OX9 A;  5AIH A;  3LTA A;  1PU4 A;  3GZB A;  3G6E 3;  2CG0 A;  5STD A;  3JUQ A;  1GY5 A;  1N9E A;  2OQE C;  3CXC 2;  2GBX B;  3NXJ A;  2CK3 H;  1ROA A;  2ML6 A;  3JUP A;  5AII A;  4L7K A;  1OUN A;  3CCE 3;  3FLJ A;  3V92 A;  1OGZ A;  4N6T A;  2A15 A;  3K63 A;  4LMI A;  5D81 A;  4BTW A;  4RZM A;  2WGO A;  5D83 A;  4ORL A;  4HM2 B;  1N5H A;  2K54 A;  4FCM A;  4HM4 B;  3MWZ A;  2W2C A;  1GY7 A;  3FKA A;  1N8R 4;  2YFL B;  1K41 A;  3BND A;  2XRX B;  3JUM A;  4HBR A;  4L8P A;  4LZI A;  2CWU A;  5AIF A;  1Z1S A;  1IQX A;  1RRL A;  1TFK A;  3CCV 3;  5LC6 A;  1D6U A;  1EKM A;  2CKF B;  3ECF A;  2KXG A;  3CC2 3;  2W03 A;  4FMB A;  1G96 A;  3I55 3;  2HMN B;  1WMP A;  1IK3 A;  3X3Y A;  1IVU A;  4KFF A;  7STD A;  2YFI B;  3CU3 A;  1RJO A;  3WA2 X;  4L8O A;  3CD6 3;  1IVX A;  1W2B 2;  1W00 A;  2ZL8 A;  3SLU A;  1K73 4;  1PFP A;  1NJI 4;  4CCV A;  1W6C A;  1Q86 4;  4J8T A;  3B4P A;  3S27 A;  3EJV A;  3MHE A;  5I97 A;  1VQ4 3;  3NV0 B;  1FGO A;  3F8X A;  2KRT A;  2P09 A;  4BTX A;  1A2V A;  3FG4 A;  4CDL A;  5A0O B;  4GB5 A;  3KE7 A;  3CNM A;  1E97 A;  3FSD A;  5LC7 A;  1FGQ A;  3G16 A;  1GYB A;  1TFO A;  1KSI A;  1KQS 2;  4Q53 A;  1L5G B;  2F98 A;  1JN5 B;  5BXQ A;  3IPT A;  2GXF A;  3MKI A;  1CYV A;  3EB8 A;  4O3V A;  1STD A;  2CFD A;  4O02 B;  2OTJ 3;  3PCR A;  1OPY A;  2Y74 A;  3S29 A;  1QAK A;  3PGB A;  1TU5 A;  3EN1 B;  4IIA A;  1T5Y A;  3MPH A;  3PS8 A;  1QAL A;  4RNY A;  3G8Z A;  2RGQ A;  1GD3 A;  1VQP 3;  4O2H A;  2WGQ A;  3VGN A;  3K5T A;  1IQ8 A;  4WHA A;  1AR0 A;  2F86 B;  1VQK 3;  3KKG A;  2ML5 A;  3DZL A;  2O3O A;  3F40 A;  4OK0 A;  4R9L A;  2BT3 A;  3CME 3;  5EVH A;  3NQZ A;  2CFL A;  1AVL A;  2F99 A;  2GU1 A;  5CF1 A;  3FCS B;  3S67 A;  3UL6 A;  2CFK A;  2BMO B;  2R4I A;  4WYK B;  2HMO B;  3WDG B;  3MYT A;  1WNH A;  4O8S A;  2E2V A;  3KSP A;  1YJN 3;  5AEU B;  1KC8 4;  1W5Z A;  3D9R A;  4U13 A;  3MG3 A;  1RN7 A;  3U1W A;  5IW9 A;  1D6Z A;  5D82 A;  3T8U A;  1W01 A;  3F8H A;  4R4K A;  1ULJ B;  5KP4 A;  1F8N A;  1UI8 A;  2QGU A;  1GD4 A;  4LSO A;  1DMN A;  4KZ1 A;  1W6Y A;  1ZO2 A;  4HM8 B;  4IPB A;  2W6J H;  3A76 A;  1O7P B;  3NV0 A;  3LTD A;  4LEH A;  4FCZ A;  1O7N B;  3F7X A;  1DVC A;  3KSE D;  3T0U A;  4EC6 A;  1IU7 A;  2Y73 A;  1YI2 3;  3GZR A;  3BB9 A;  3GRD A;  3ROB A;  2OOV C;  2ZDJ A;  2B1X B;  1JNQ A;  3X41 A;  3OWS A;  5TGN A;  3RDE A;  4X2H A;  2W9P A;  1YHQ 3;  1FA3 A;  4N6L A;  1SJW A;  3N8B A;  1JB5 A;  3HX8 A;  1U8C B;  3WOD G;  3CPO A;  1VQM 3;  1EA2 A;  3HZP A;  4K1U A;  1VQO 3;  3G4S 3;  3S5C A;  5CLK A;  3Q1C A;  1SQW A;  1IV7 A;  2P0X A;  1YGE A;  1VQL 3;  1VQN 3;  4MMY B;  1DMM A;  1J2B A;  2W9Q A;  3FG3 A;  2GBW B;  2JDI H;  2IA7 A;  3DGO A;  1JRQ A;  3F9S A;  4IT7 A;  1VQ6 3;  2LYX A;  1CEW I;  2W56 A;  1N8Q A;  4MEI A;  2BHM A;  1W2Z A;  4GL6 A;  3RGR A;  2KCD A;  1AVK A;  4H61 A;  3CCJ 3;  2P38 A;  3LT8 A;  4HM5 B;  3LOY A;  2RFR A;  3F14 A;  3HII A;  1GY6 A;  2OQE A;  1IT8 A;  3X42 A;  3LYG A;  4WYK A;  2QEX 3;  3WOF B;  3M8C A;  1K8A 4;  3LXU X;  2OTL 3;  2Z6B A;  4FR9 A;  1IQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...