4HM5B

Naphthalene 1,2-dioxygenase bound to indene
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to indene
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm5B00
1GY6A 2CHCA 3CNXA 3GZBA 1UUVB 1NU3A 3FLJA 2Z7AA 3F40A 2HMOB 1NWWA 8CHOA 1OH0A 4KVHA 1DMQA 3NUVA 3OX9A 3KZTA 1E3RA 3EF8A 1DMNA 1ULJB 4HM0B 1JKGB 3UNLA 1O7PB 3B4OA 1Q40B 1Q42A 1QJGA 3JUQA 3LZAA 5AIIA 3M8CA 4HVNA 5IEPA 2RGQA 3FGYA 4XDWA 1CQSA 5D83A 3G8ZA 3HZPA 5BVBA 4XM4A 3B4PA 4OVMA 5AEWB 3OWUA 2K54A 4R9LA 3OV4A 2GBWB 3DMCA 1JB5A 4L7KA 3B8LA 1E97A 5AIFA 4WYKA 2HMLB 4R1KA 5G2GA 5BXQA 3NXJA 5EVHA 2XSOB 2GXFA 3D9RA 3EN1B 3T8NA 2YFIB 3FH1A 2XR8B 6STDA 3Q90A 3GZYB 1WQLB 5TGNA 3GZXB 3MG2A 3F7SA 3T8UA 2I9WA 2RFRA 1O7WB 1OGXA 3OWSA 4HJLB 1AR0A 5KP4A 4HM6B 5IG5A 2GBXB 5AIGA 1VZZA 2GEYA 4HM7B 4WYKB 3F8HA 1ZO2A 2HMKB 3SEDA 4R9KA 3CPOA 3EC9A 5IENA 1OGZA 4GB5A 3MG1A 5DREA 2IMJA 1O7NB 3FZWA 3ECFA 4L8PA 5STDA 4RZMA 2B24B 1GY5A 3ER7A 1JN5A 2XRXB 2A15A 1OHSA 4HM8B 3SOYA 1K41A 3DM8A 3FF0A 3BLZA 2BMRB 1ULIB 1W01A 3E99A 4HKVB 5HGRA 3DUKA 3KSPA 1O7MB 1JB4A 3NV0A 2QGUA 1O7HB 4LGQA 4U13A 2BNGA 4XBXA 3NM2A 3GWRA 1OF5A 1UUWB 1JB2A 1OUNA 4HZBB 1STDA 4K1UA 1C7HA 5D82A 5FW5A 5AEUB 4ORLA 1IDPA 2Z76A 3B7CA 3FKAA 4LEHA 2STDA 3UJMA 4FCMA 2YFJB 2INXA 3F8XA 5AI1A 2Z77A 5CXOA 1SJWA 4HM4B 1U5OA 3NV0B 3FSDA 1EA2A 4HM1B 3FF2A 3NBRA 2HMMB 3DXOA 3LYGA 1ZX2A 4HM3B 3EJVA 1TUHA 1OF5B 2RCDA 4H3UA 3G0KA 3K0ZA 1OPYA 3JUPA 3H51A 2B1XB 5IERA 5IF6A 3F14A 3GRDA 1HKXA 4CDLA 3EN8A 4X2OA 3WMDA 2QIYA 5D81A 3BB9A 2F99A 3EBYA 3F7XA 1A2KA 2F98A 4STDA 4L8OA 2BMOB 1Q40A 3HK4A 5AIHA 5CF2A 2HMNB 3VGNA 3VSYA 3MHEA 1GYBA 3EHCA 2R4IA 3JUMA 2HMJB 4OUQA 1OHPA 4I4KA 3EX9A 3ROBA 1GS3A 4XDVA 3MYTA 3HX8A 1S5AA 3OWYA 4WWUC 3OXAA 5DRVA 5KP1A 5CK6A 4J8TA 3I0YA 3G16A 5CLKA 3K7CA 4LMIA 2XSHB 1TP6A 3DZLA 1JN5B 1W6YA 1DMMA 3SOAA 3CNMA 4X2HA 2PZVA 5IG3A 3IPTA 3F9SA 5IEOA 3H3HA 2BMQB 3CU3A 3GZRA 4HM2B 4HZ9B 2CKFB 1QMAA 2F86B 1W02A 3MG3A 3JUNA 4N3VA 3EQQB 4K1VA 1EG9B 4MJDA 1ISKA 4WP5A 3KKGA 4HM5B 3MSOA 5IG4A 4J9AA 1OHOA 3JUOA 5JPPA 1NDOB 4PEJA 3A76A 4XBTA 1O7GB 2UX0A 2JQ5A 1W00A 1GY7A 2OWPA 1BUQA 3EBTA 3S5CA 3NHXA 5CF1A 5JPUA 2W2CA 5KP3A 4FCJA 5IG0A 4IIAA 4XB5A 1Z1SA 2GEXA 3KE7A 4Q53A 1JKGA 3STDA 7STDA 3RGAA 1E3VA 4XBYA 2YFLB 3MKIA 3RGRA 1ASKA 1OCVA
chains in the Genus database with same CATH superfamily
1RGKA 1K734 1W7CA 4H61A 1BRNL 1GY6A 2CHCA 3S29A 3CNXA 3GZBA 3G713 2E2VA 2QEX3 3CCU3 1NJI4 1UUVB 3WA2X 1NB5I 1NU3A 2W9QA 3FLJA 1GMQA 2WGQA 2Z7AA 2HMOB 3BNBA 3F40A 1NWWA 2CFLA 2RSXA 2IUJA 1OH0A 8CHOA 2CW9A 4KVHA 4QWTA 3S28A 4EYCA 1DMQA 3X3ZA 3NUVA 3OX9A 1BNIA 3KZTA 1E3RA 2E2UA 1JNQA 3SVAA 3QK9A 1AVKA 3CME3 1B27A 3EF8A 1BNEA 1DMNA 4R4KA 5ELUA 1WTHA 2KF5A 4IT7A 1EEJA 2V1LA 4FMBA 3WDGB 1VQ63 1BSCA 1ULJB 1SIIA 4HM0B 4BTWA 3QRDA 1IVVA 1QALA 1EKMA 2H0GA 4ZM8A 1HZ1A 1X1XA 9RNTA 1NNVA 1VQM3 1UGIA 3D5GA 3NBJA 4KFEA 1SPUA 1JKGB 3UNLA 1O7PB 3KCHA 3B4OA 1Q40B 1Q42A 1QJGA 3JUQA 4CCVA 1TRQA 2M7OA 1RCKA 3BNEA 3LZAA 3X42A 3CPW2 5AIIA 1T3BA 3M8CA 1QAKA 2IY2A 4HVNA 1RNBA 3D3LA 5IEPA 2RGQA 1RN7A 3PGBA 4K90B 1HU9A 2ZL8A 3HIIA 1FZUA 2W56A 3FGYA 4XDWA 3T0UA 1CQSA 1M1XB 1LOVA 1ZS7A 1RNTA 1TFOA 1B21A 5D83A 3G8ZA 3HZPA 1KC84 5BVBA 1JZOA 4XM4A 3B4PA 1I2GA 2P0XA 2IA7A 3CC73 2FGTA 4OVMA 5AEWB 1BNGA 3OWUA 2K54A 2XFTA 3FG1A 1AVLA 1N9JA 2QA43 4R9LA 3OV4A 1V58A 1LQMB 4O3VA 3EB8A 1L5GB 1YIJ3 2GBWB 1PFPA 3DMCA 4EC6A 2ZDJA 2LYXA 4HYZA 1JB5A 5A0OB 1YJ93 4L7KA 3CD63 4EV5A 1NO3A 1IVWA 3B8LA 1TU5A 2CK3H 3KN4A 3CMA3 5EEOA 1E97A 1BNFA 1FGMA 1I2FA 1W6GA 2CIUA 2H0IA 4WYKA 5AIFA 1UW1A 2HMLB 1TRPA 1IU7A 4R1KA 5G2GA 1RMSA 5BXQA 1DVCA 2CFGA 3KIIA 2XSOB 3NXJA 5EVHA 3CCV3 1FUWA 1G96A 1LOWA 3DGNA 1EQKA 1G0TA 2GXFA 3D9RA 1QVG2 4AKZA 3EN1B 3T8NA 2YFIB 2XFSA 3FH1A 3V92A 1YVBI 2CWTA 2ZA4A 1RDSA 1KSIA 1GOYA 2XR8B 2L1SA 4BL2A 6STDA 1D6UA 2K0MA 1BAOA 3Q90A 1GOUA 3GZYB 4K61A 1WQLB 5TGNA 5G1LA 3GZXB 3MG2A 1PY3A 3LTAA 3F7SA 3URPA 3T8UA 2KF6A 4KT3B 5RNTA 2I9WA 2OOVA 1UI8A 3D5IA 3TDGA 2RFRA 4CJNA 2P05A 2C10A 1KWIA 2BU4A 3WHOA 1LRAA 1O7WB 2BIRA 1FGOA 1OGXA 1DETA 3DGYA 3WOFB 3X3XA 3OWSA 4R80A 1FGTA 2WOHA 2ML6A 2Q07A 4HJLB 3PYJA 1RN4A 3NBBA 4RNYA 1CH0A 1FGRA 2PNCA 1AR0A 1RGHA 4HM6B 3SXXA 5IG5A 5KP4A 2F4YA 1MGRA 1UGHI 2GBXB 3WOEB 7RNTA 2MF7A 3AHSA 4FMCA 1BRKA 1BSEA 5AIGA 1JBTA 1VZZA 2GEYA 4HM7B 4WYKB 3CC23 3F8HA 4EW5A 1RKYA 1GD4A 1MWSA 3LTBA 3CCJ3 1ZO2A 1ROAA 2HMKB 3SEDA 6RNTA 1MWTA 1X1YA 4R9KA 3HIGA 1KD14 3CPOA 7GSPA 4N6OB 3EC9A 5IENA 1AY7A 1BGSA 1OGZA 2WGOA 4GB5A 3MG1A 3CCS3 5DREA 2IMJA 1K28A 1O7NB 2P09A 1RHLA 2ZHXB 3FZWA 3RDEA 2CC3A 1JRQA 4N6LA 3ECFA 4BU4A 1W6CA 2OOVC 2O9UX 4L8PA 5EQLA 5G1KA 5STDA 1IT7A 1VQK3 4RZMA 3PXMA 1BRIA 1RTUA 2GU1A 1DVDA 2XGLA 1AQZA 2B24B 1YJN3 1GY5A 1J2BA 1TJDA 1M904 4O02B 3ER7A 1JN5A 4FCZA 4BIRA 2XRXB 3HOHA 5ELJA 4CPKA 1UDII 2A15A 4WFOA 1OHSA 4HM8B 4OK0A 1K41A 3DM8A 3SOYA 1W2ZA 3FF0A 4JF8A 2D42A 4KFDA 1IYYA 1Q9EA 1A2PA 4LZIA 1VQ73 1YGWA 3BLZA 1BUJA 2W03A 1RRLA 2BMRB 3NM7A 1ULIB 1RLSA 1W01A 3DGLA 5LC7A 1BSAA 2W0QA 1A90A 3E99A 4HKVB 3ZG0A 5HGRA 1I3FA 3KSED 3DUKA 2P0MA 3KSPA 3RNTA 1LOXA 4MMZB 1O7MB 1JB4A 3NV0A 1IV9A 1F8NA 2J8XB 2QGUA 3ALAA 1O7HB 3WODG 1A2VA 1LQGC 2F5MA 4LGQA 3WR2A 4U13A 1MOLA 3CCE3 2BNGA 4XBXA 4RBNA 3NM2A 3GWRA 1IK3A 3IJEB 1OF5A 1UUWB 3CCQ3 1JB2A 1OUNA 4HZBB 1VQL3 1BSBA 1JJ22 2SBLA 1UCKA 1MGWA 4HBRA 3SYUA 1STDA 1UCJA 2FXTA 4RNZA 4K1UA 1GSPA 1C7HA 1RGLA 2AAEA 4J5GA 5D82A 1KQS2 3AGNA 1BOXA 1I0VA 5FW5A 1T2IA 1FA3A 5AEUB 3MPHA 1OACA 2CFWA 4ORLA 1RGCA 3N54B 1DYUA 1IDPA 2E2TA 2Z76A 3B7CA 3FKAA 1VQ53 4TX4A 4LEHA 1IVXA 1C54A 1T5YA 2STDA 3UJMA 2GSPA 4FCMA 1BIRA 1SIHA 3N9HA 1FUTA 3HI7A 1DE3A 2YFJB 1FUSA 1RJOA 1SARA 2INXA 3X41A 5M18A 3F8XA 4N6UA 5AI1A 2F5WA 2D1WA 2Z77A 2K3DA 5CXOA 4JRFA 1K8A4 3Q2PA 1V57A 1SJWA 2W56B 3LH4A 4HM4B 4O8SA 3CCR3 1U5OA 1BVIA 2RBIA 3V99A 3NV0B 3FSDA 2OQEA 2W04A 1EA2A 3LXUX 1STFI 3FF2A 4HM1B 3NBRA 1I2EA 2XF3A 1R4CA 2HMMB 3DXOA 1ZX2A 1IT8A 3LYGA 4HM3B 1M1K4 2F56A 3EJVA 4RNTA 1TUHA 1BANA 1BRHA 1OF5B 4HZ9B 1W2B2 1V74A 2RCDA 3CCL3 4NHFA 3BNCA 5AYSC 1ROVA 1LXEA 3U1WA 3DH2A 4H3UA 1UUGB 4MMYB 2W9PA 3G0KA 1IVUA 3BNDA 4GL6A 3K0ZA 1OPYA 3U97A 1PU4A 3JUPA 3H51A 3ZFZA 3S27A 2B1XB 1RGAA 1FW7A 3NX0A 5IERA 4IPBA 5IF6A 1D6YA 1CYUA 1LNIA 4N6TA 3F14A 1ZGXA 3GRDA 1B2MA 2UGIA 1HKXA 1U8CB 1GD3A 4CDLA 6GSPA 3JVCA 3EN8A 4KZ1A 1YNVX 3EE1A 4X2OA 5HOHA 3BIRA 3WMDA 3I563 2CX0A 1CEWI 2QIYA 4EBGA 5D81A 4LSOA 1B20A 1UCLA 3BB9A 3V98A 2F99A 3EBYA 1PYLA 3F7XA 3G4S3 1A2KA 1AV4A 2F98A 4MEIA 4STDA 1MNLA 5BU4A 2OQEC 1YHQ3 2H0HA 2HOHA 1IQXA 3PCRA 4L8OA 4GSPA 1TTOA 2BMOB 2JDIH 8RNTA 1VQ93 2OTL3 1D6ZA 1BU4A 2CWVA 1Q40A 1WMNA 4EV2A 3HK4A 5AIHA 2Z6BA 1N5HA 3DGOA 5BIRA 5CF2A 2HMNB 1RGGA 1W4NA 4J5KA 1SQWA 4N6V0 3VGNA 3VSYA 4MMXB 3MHEA 3SLUA 2KXGA 3D79A 3K63A 1GYBA 3AMOA 1I70A 3LTCA 1QAFA 1MWUA 2P38A 1N5PA 3EHCA 2R4IA 4NREA 3BU4A 3N8BA 3Q3FA 1N9EA 1RGFA 3JUMA 2HMJB 1I0XA 1IQ8A 2KRTA 4OUQA 1JBRA 1OHPA 4I4KA 4AEQA 4AKYA 3UL5A 1W5ZA 3EX9A 1JBSA 3FG3A 3UB1A 3CCM3 2R41A 1IQYA 3ROBA 1GS3A 4XDVA 3CC43 5LC6A 3MYTA 2ML5A 2IUKA 4HOHA 3HX8A 2C4BA 1S5AA 2LQVA 3OWYA 1BNRA 3MWZA 4BL3A 3FG4A 4WWUC 3OXAA 1WMPA 5DRVA 5KP1A 4N6NB 3NQYA 5CK6A 4J8TA 1I3IA 1VQQA 1VQ43 3SX1A 3LT8A 1S723 3NQZA 1TIJA 3I0YA 3G16A 3PS8A 3PCSA 1YIT3 3S67A 4BTXA 2AADA 5CLKA 1Q824 3K7CA 1Q7Y4 2XH9A 4LMIA 4GHOA 2BT3A 5M19A 3I553 3L0RA 3AGOA 1JZDA 2CG0A 2KF4A 3X3YA 2XSHB 1TFKA 1T2HA 1TP6A 2BHMA 3DZLA 5FGOA 1JN5B 4WHAA 1W6YA 3AMOB 1YJW3 1DMMA 3SOAA 1LVNA 3CNMA 4HAAA 1YVSA 1BNSA 3CXC2 4X2HA 1EUIC 2PZVA 1GOVA 3LTDA 1CYVA 1WMOA 4KFFA 5IG3A 2YX9A 3IPTA 1RGEA 2CWUA 2C11A 1BRSA 2WOFA 3F9SA 3UL6A 3O8YA 5AYRB 2KAAA 4FR9A 5IEOA 3H3HA 2L4VA 1N8R4 2BMQB 3CU3A 3GZRA 1YGEA 2IYJA 4FMDA 2CKFB 1QMAA 4HM2B 1I8VA 2F86B 1W02A 3OW22 1Q864 3MG3A 3JUNA 1B2SA 1UI7A 3K9MC 1B2ZA 1M9GA 4N3VA 1BRJA 2KF3A 3IMAB 2RNTA 1UCIA 3DGMA 3EQQB 4K1VA 3GSPA 4ILFA 3PZWA 3AHWA 3LMLA 1LOYA 1EG9B 4MJDA 2FNQA 1ISKA 4WP5A 3KKGA 4HM5B 5IW9A 3MSOA 5IG4A 2Y74A 4J9AA 3G6E3 1OHOA 1YI23 3JUOA 2CFKA 1HYFA 1RCLA 3DY5A 5JPPA 1NDOB 4DKIA 2XGNA 2CG1A 2CH9A 1RRHA 5M1AA 1A67A 2XEPA 1IV7A 4PEJA 1X1UA 2GU3A 1QVF2 3WA3A 3A76A 3K5TA 5GSPA 4NPBA 1JV2B 4XBTA 1O7GB 1X1WA 2UX0A 2CX1A 2JQ5A 4O2HA 1LNHA 1WNHA 1FGQA 2OCTA 4I5QA 1W00A 1GMRA 1GY7A 1BNJA 5I97A 3FCSB 1K9M4 2OWPA 3GAXA 1BUQA 3EBTA 3S5CA 2CFDA 3D4AA 3LOYA 1R4YA 3NHXA 1VQP3 2OTJ3 2SARA 5CF1A 5JPUA 1Y4KA 1B2UA 2W2CA 5KP3A 1B3SA 1BSDA 1B2XA 2BO9B 3X40A 4FCJA 5IG0A 4IIAA 2WO0A 1MWRA 4XB5A 1Z1SA 3VF1A 1NB3I 1BRGA 2GEXA 3KE7A 4FMAA 4Q53A 1RN1A 2MC8A 1VQO3 1JKGA 3LT9A 4G1MB 4BTYA 3STDA 4LYLB 7STDA 3RGAA 1GMPA 1Q814 1US1A 1E3VA 3A5EA 4EXRA 4XBYA 1Q7HA 2UUGC 2YFLB 3MKIA 2Y73A 1FYSA 3ZG5A 3J7Yd 5JBSA 1VQN3 1VQ83 3KFQC 1N8QA 3Q1CA 4N6MA 1RSNA 1G02A 3RGRA 2W6JH 1ASKA 1OCVA 2KCDA 2O3OA
chains in the Genus database with same CATH topology
1K734 1W7CA 4H61A 1GY6A 2CHCA 3S29A 3CNXA 3GZBA 3G713 2E2VA 2QEX3 3CCU3 1NJI4 1UUVB 3WA2X 1NB5I 1NU3A 2W9QA 3FLJA 2WGQA 2Z7AA 3F40A 2HMOB 3BNBA 1NWWA 2CFLA 2RSXA 2IUJA 1OH0A 8CHOA 2CW9A 4KVHA 4QWTA 3S28A 4EYCA 1DMQA 3X3ZA 3NUVA 3OX9A 3KZTA 1E3RA 2E2UA 1JNQA 3SVAA 3QK9A 1AVKA 3CME3 3EF8A 1DMNA 4R4KA 5ELUA 1WTHA 1VQ63 4IT7A 2V1LA 4FMBA 3WDGB 1ULJB 1SIIA 4HM0B 4BTWA 3QRDA 1IVVA 1QALA 1EKMA 4ZM8A 1VQM3 3NBJA 4KFEA 1SPUA 1JKGB 3UNLA 1O7PB 4CCVA 3B4OA 1Q40B 1Q42A 1QJGA 3JUQA 1IK3A 2M7OA 3CPW2 3BNEA 3LZAA 3X42A 5AIIA 3M8CA 4HVNA 1QAKA 3D3LA 5IEPA 2RGQA 1RN7A 3PGBA 4K90B 1HU9A 2ZL8A 3HIIA 2W56A 3FGYA 4XDWA 3T0UA 1CQSA 1M1XB 1TFOA 5D83A 3G8ZA 3HZPA 1KC84 5BVBA 4XM4A 3B4PA 2P0XA 2IA7A 3CC73 2FGTA 4OVMA 5AEWB 3OWUA 2K54A 2XFTA 3FG1A 1AVLA 1N9JA 2QA43 4R9LA 3OV4A 4O3VA 3EB8A 1L5GB 1YIJ3 2GBWB 1PFPA 3DMCA 4EC6A 2ZDJA 2LYXA 4HYZA 1JB5A 5A0OB 1YJ93 4L7KA 3CD63 4EV5A 1NO3A 1IVWA 3B8LA 1TU5A 2CK3H 3KN4A 3CMA3 5EEOA 1E97A 1FGMA 1W6GA 2CIUA 4WYKA 5AIFA 1UW1A 2HMLB 1IU7A 4R1KA 5G2GA 5BXQA 1DVCA 2CFGA 3KIIA 2XSOB 3NXJA 5EVHA 3CCV3 1FUWA 1G96A 3DGNA 1EQKA 2GXFA 3D9RA 1QVG2 4AKZA 3EN1B 3T8NA 2YFIB 2XFSA 3FH1A 3V92A 1YVBI 2CWTA 2XR8B 1KSIA 6STDA 1D6UA 2K0MA 3Q90A 3GZYB 4K61A 1WQLB 5TGNA 3GZXB 3MG2A 3LTAA 3F7SA 3T8UA 2I9WA 2OOVA 1UI8A 3TDGA 2RFRA 2P05A 2C10A 1KWIA 1O7WB 1FGOA 1OGXA 3WOFB 3X3XA 3OWSA 4R80A 1FGTA 2WOHA 2ML6A 2Q07A 4HJLB 3PYJA 3NBBA 4RNYA 1FGRA 2PNCA 1AR0A 5KP4A 4HM6B 3SXXA 5IG5A 3WOEB 2GBXB 2MF7A 4FMCA 5AIGA 1VZZA 2GEYA 4HM7B 4WYKB 3CC23 3F8HA 1RKYA 1GD4A 3LTBA 3CCJ3 1ZO2A 1ROAA 2HMKB 3SEDA 4R9KA 3HIGA 1KD14 3CPOA 4N6OB 3EC9A 5IENA 1OGZA 2WGOA 4GB5A 3MG1A 3CCS3 5DREA 2IMJA 1K28A 1O7NB 2P09A 3FZWA 3RDEA 2CC3A 1JRQA 4N6LA 3ECFA 1W6CA 2OOVC 2O9UX 4L8PA 5EQLA 5STDA 1IT7A 1VQK3 4RZMA 3PXMA 1DVDA 2GU1A 2XGLA 2B24B 1YJN3 1GY5A 1J2BA 1M904 4O02B 3ER7A 1JN5A 4FCZA 2XRXB 5ELJA 2A15A 4WFOA 1OHSA 4HM8B 4OK0A 1K41A 3DM8A 3SOYA 1W2ZA 3FF0A 4JF8A 2D42A 4KFDA 4LZIA 1VQ73 3BLZA 2W03A 1RRLA 2BMRB 3NM7A 1ULIB 1W01A 3DGLA 5LC7A 2W0QA 1A90A 3E99A 4HKVB 5HGRA 3KSED 3DUKA 2P0MA 3KSPA 1LOXA 4MMZB 1O7MB 1JB4A 3NV0A 1IV9A 1F8NA 2QGUA 3ALAA 3WODG 1O7HB 1A2VA 4LGQA 4U13A 1MOLA 3CCE3 2BNGA 4XBXA 4RBNA 3NM2A 3GWRA 3IJEB 1OF5A 1UUWB 3CCQ3 1JB2A 1OUNA 4HZBB 1VQL3 1JJ22 2SBLA 4HBRA 1STDA 4RNZA 2FXTA 4K1UA 1C7HA 5D82A 1KQS2 5FW5A 1FA3A 5AEUB 3MPHA 1OACA 2CFWA 4ORLA 3N54B 1DYUA 1IDPA 2E2TA 2Z76A 3B7CA 3FKAA 1VQ53 4TX4A 4LEHA 1IVXA 1T5YA 2STDA 3UJMA 4FCMA 1SIHA 3N9HA 3HI7A 2YFJB 1RJOA 2INXA 3X41A 3F8XA 4N6UA 5AI1A 2D1WA 2Z77A 5CXOA 1K8A4 4JRFA 3Q2PA 1SJWA 2W56B 3LH4A 4HM4B 4O8SA 3CCR3 1U5OA 3V99A 3NV0B 3FSDA 2OQEA 2W04A 1EA2A 3LXUX 1STFI 3FF2A 4HM1B 3NBRA 2XF3A 1R4CA 2HMMB 3DXOA 1ZX2A 1IT8A 3LYGA 4HM3B 1M1K4 3EJVA 1TUHA 1OF5B 1W2B2 1V74A 2RCDA 3CCL3 4NHFA 3BNCA 5AYSC 1ROVA 1LXEA 3U1WA 4H3UA 4MMYB 2W9PA 3G0KA 1IVUA 3BNDA 4GL6A 3K0ZA 1OPYA 3U97A 1PU4A 3JUPA 3H51A 3S27A 2B1XB 3NX0A 5IERA 4IPBA 5IF6A 1D6YA 1CYUA 4N6TA 3F14A 3GRDA 1HKXA 1U8CB 1GD3A 4CDLA 3JVCA 3EN8A 4KZ1A 3EE1A 4X2OA 3WMDA 3I563 1CEWI 2QIYA 4EBGA 5D81A 4LSOA 3BB9A 3V98A 2F99A 3EBYA 3F7XA 3G4S3 1A2KA 1AV4A 2F98A 4MEIA 4STDA 1MNLA 1YHQ3 2OQEC 1IQXA 3PCRA 4L8OA 2BMOB 2JDIH 1VQ93 2OTL3 1D6ZA 2CWVA 1Q40A 1WMNA 4EV2A 3HK4A 5AIHA 2Z6BA 1N5HA 3DGOA 5CF2A 2HMNB 1W4NA 3VGNA 1SQWA 4N6V0 3VSYA 4MMXB 3MHEA 3SLUA 2KXGA 3K63A 1GYBA 3AMOA 3LTCA 1QAFA 2P38A 1N5PA 3EHCA 2R4IA 4NREA 3N8BA 1N9EA 3JUMA 2HMJB 1IQ8A 2KRTA 4OUQA 1OHPA 4I4KA 4AEQA 4AKYA 3UL5A 1W5ZA 3EX9A 3FG3A 3UB1A 3CCM3 1IQYA 3ROBA 1GS3A 4XDVA 3CC43 5LC6A 3MYTA 2ML5A 2IUKA 3HX8A 2LQVA 1S5AA 3OWYA 3MWZA 3FG4A 4WWUC 3OXAA 1WMPA 5DRVA 5KP1A 4N6NB 3NQYA 5CK6A 4J8TA 1VQ43 3SX1A 3LT8A 1S723 3NQZA 1TIJA 3I0YA 3G16A 3PS8A 3PCSA 1YIT3 3S67A 4BTXA 5CLKA 1Q824 3K7CA 1Q7Y4 2XH9A 4LMIA 2BT3A 3I553 3L0RA 2CG0A 3X3YA 2XSHB 1TFKA 1TP6A 2BHMA 3DZLA 5FGOA 1JN5B 4WHAA 1W6YA 3AMOB 1YJW3 1DMMA 3SOAA 1LVNA 3CNMA 3CXC2 4X2HA 2PZVA 3LTDA 1CYVA 1WMOA 4KFFA 5IG3A 2YX9A 3IPTA 2CWUA 2C11A 2WOFA 3F9SA 3UL6A 3O8YA 5AYRB 4FR9A 5IEOA 3H3HA 2L4VA 1N8R4 2BMQB 3CU3A 3GZRA 1YGEA 4FMDA 4HM2B 2CKFB 1QMAA 4HZ9B 2F86B 2CG1A 1W02A 3OW22 1Q864 3MG3A 3JUNA 1UI7A 3K9MC 1M9GA 4N3VA 3IMAB 3DGMA 3EQQB 4K1VA 3PZWA 3LMLA 1EG9B 4MJDA 2FNQA 1ISKA 4WP5A 3KKGA 4HM5B 5IW9A 3MSOA 5IG4A 2Y74A 4J9AA 3G6E3 1OHOA 1YI23 3JUOA 2CFKA 3DY5A 5JPPA 1NDOB 2XGNA 2CH9A 1RRHA 1A67A 2XEPA 1IV7A 4PEJA 2GU3A 1QVF2 3WA3A 3A76A 3K5TA 1JV2B 4XBTA 1O7GB 2UX0A 2JQ5A 4O2HA 1LNHA 1WNHA 1FGQA 2OCTA 1W00A 1GY7A 5I97A 3FCSB 1K9M4 2OWPA 3GAXA 1BUQA 3EBTA 3S5CA 2CFDA 3LOYA 3NHXA 1VQP3 2OTJ3 5CF1A 5JPUA 1Y4KA 2W2CA 5KP3A 2BO9B 3X40A 4FCJA 5IG0A 4IIAA 2WO0A 4XB5A 1Z1SA 3VF1A 1NB3I 2GEXA 3KE7A 4FMAA 4Q53A 2MC8A 1VQO3 1JKGA 3LT9A 4G1MB 4BTYA 3STDA 7STDA 3RGAA 1Q814 1US1A 1E3VA 4EXRA 4XBYA 2YFLB 3MKIA 2Y73A 3J7Yd 5JBSA 1VQN3 1VQ83 3KFQC 1N8QA 3Q1CA 4N6MA 3RGRA 2W6JH 1ASKA 1OCVA 2KCDA 2O3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY6 A;  2CHC A;  3CNX A;  3GZB A;  1UUV B;  1NU3 A;  3FLJ A;  2Z7A A;  3F40 A;  2HMO B;  1NWW A;  8CHO A;  1OH0 A;  4KVH A;  1DMQ A;  3NUV A;  3OX9 A;  3KZT A;  1E3R A;  3EF8 A;  1DMN A;  1ULJ B;  4HM0 B;  1JKG B;  3UNL A;  1O7P B;  3B4O A;  1Q40 B;  1Q42 A;  1QJG A;  3JUQ A;  3LZA A;  5AII A;  3M8C A;  4HVN A;  5IEP A;  2RGQ A;  3FGY A;  4XDW A;  1CQS A;  5D83 A;  3G8Z A;  3HZP A;  5BVB A;  4XM4 A;  3B4P A;  4OVM A;  5AEW B;  3OWU A;  2K54 A;  4R9L A;  3OV4 A;  2GBW B;  3DMC A;  1JB5 A;  4L7K A;  3B8L A;  1E97 A;  5AIF A;  4WYK A;  2HML B;  4R1K A;  5G2G A;  5BXQ A;  3NXJ A;  5EVH A;  2XSO B;  2GXF A;  3D9R A;  3EN1 B;  3T8N A;  2YFI B;  3FH1 A;  2XR8 B;  6STD A;  3Q90 A;  3GZY B;  1WQL B;  5TGN A;  3GZX B;  3MG2 A;  3F7S A;  3T8U A;  2I9W A;  2RFR A;  1O7W B;  1OGX A;  3OWS A;  4HJL B;  1AR0 A;  5KP4 A;  4HM6 B;  5IG5 A;  2GBX B;  5AIG A;  1VZZ A;  2GEY A;  4HM7 B;  4WYK B;  3F8H A;  1ZO2 A;  2HMK B;  3SED A;  4R9K A;  3CPO A;  3EC9 A;  5IEN A;  1OGZ A;  4GB5 A;  3MG1 A;  5DRE A;  2IMJ A;  1O7N B;  3FZW A;  3ECF A;  4L8P A;  5STD A;  4RZM A;  2B24 B;  1GY5 A;  3ER7 A;  1JN5 A;  2XRX B;  2A15 A;  1OHS A;  4HM8 B;  3SOY A;  1K41 A;  3DM8 A;  3FF0 A;  3BLZ A;  2BMR B;  1ULI B;  1W01 A;  3E99 A;  4HKV B;  5HGR A;  3DUK A;  3KSP A;  1O7M B;  1JB4 A;  3NV0 A;  2QGU A;  1O7H B;  4LGQ A;  4U13 A;  2BNG A;  4XBX A;  3NM2 A;  3GWR A;  1OF5 A;  1UUW B;  1JB2 A;  1OUN A;  4HZB B;  1STD A;  4K1U A;  1C7H A;  5D82 A;  5FW5 A;  5AEU B;  4ORL A;  1IDP A;  2Z76 A;  3B7C A;  3FKA A;  4LEH A;  2STD A;  3UJM A;  4FCM A;  2YFJ B;  2INX A;  3F8X A;  5AI1 A;  2Z77 A;  5CXO A;  1SJW A;  4HM4 B;  1U5O A;  3NV0 B;  3FSD A;  1EA2 A;  4HM1 B;  3FF2 A;  3NBR A;  2HMM B;  3DXO A;  3LYG A;  1ZX2 A;  4HM3 B;  3EJV A;  1TUH A;  1OF5 B;  2RCD A;  4H3U A;  3G0K A;  3K0Z A;  1OPY A;  3JUP A;  3H51 A;  2B1X B;  5IER A;  5IF6 A;  3F14 A;  3GRD A;  1HKX A;  4CDL A;  3EN8 A;  4X2O A;  3WMD A;  2QIY A;  5D81 A;  3BB9 A;  2F99 A;  3EBY A;  3F7X A;  1A2K A;  2F98 A;  4STD A;  4L8O A;  2BMO B;  1Q40 A;  3HK4 A;  5AIH A;  5CF2 A;  2HMN B;  3VGN A;  3VSY A;  3MHE A;  1GYB A;  3EHC A;  2R4I A;  3JUM A;  2HMJ B;  4OUQ A;  1OHP A;  4I4K A;  3EX9 A;  3ROB A;  1GS3 A;  4XDV A;  3MYT A;  3HX8 A;  1S5A A;  3OWY A;  4WWU C;  3OXA A;  5DRV A;  5KP1 A;  5CK6 A;  4J8T A;  3I0Y A;  3G16 A;  5CLK A;  3K7C A;  4LMI A;  2XSH B;  1TP6 A;  3DZL A;  1JN5 B;  1W6Y A;  1DMM A;  3SOA A;  3CNM A;  4X2H A;  2PZV A;  5IG3 A;  3IPT A;  3F9S A;  5IEO A;  3H3H A;  2BMQ B;  3CU3 A;  3GZR A;  4HM2 B;  4HZ9 B;  2CKF B;  1QMA A;  2F86 B;  1W02 A;  3MG3 A;  3JUN A;  4N3V A;  3EQQ B;  4K1V A;  1EG9 B;  4MJD A;  1ISK A;  4WP5 A;  3KKG A;  4HM5 B;  3MSO A;  5IG4 A;  4J9A A;  1OHO A;  3JUO A;  5JPP A;  1NDO B;  4PEJ A;  3A76 A;  4XBT A;  1O7G B;  2UX0 A;  2JQ5 A;  1W00 A;  1GY7 A;  2OWP A;  1BUQ A;  3EBT A;  3S5C A;  3NHX A;  5CF1 A;  5JPU A;  2W2C A;  5KP3 A;  4FCJ A;  5IG0 A;  4IIA A;  4XB5 A;  1Z1S A;  2GEX A;  3KE7 A;  4Q53 A;  1JKG A;  3STD A;  7STD A;  3RGA A;  1E3V A;  4XBY A;  2YFL B;  3MKI A;  3RGR A;  1ASK A;  1OCV A; 
#chains in the Genus database with same CATH topology
 1RGK A;  1K73 4;  1W7C A;  4H61 A;  1BRN L;  1GY6 A;  2CHC A;  3S29 A;  3CNX A;  3GZB A;  3G71 3;  2E2V A;  2QEX 3;  3CCU 3;  1NJI 4;  1UUV B;  3WA2 X;  1NB5 I;  1NU3 A;  2W9Q A;  3FLJ A;  1GMQ A;  2WGQ A;  2Z7A A;  2HMO B;  3BNB A;  3F40 A;  1NWW A;  2CFL A;  2RSX A;  2IUJ A;  1OH0 A;  8CHO A;  2CW9 A;  4KVH A;  4QWT A;  3S28 A;  4EYC A;  1DMQ A;  3X3Z A;  3NUV A;  3OX9 A;  1BNI A;  3KZT A;  1E3R A;  2E2U A;  1JNQ A;  3SVA A;  3QK9 A;  1AVK A;  3CME 3;  1B27 A;  3EF8 A;  1BNE A;  1DMN A;  4R4K A;  5ELU A;  1WTH A;  2KF5 A;  4IT7 A;  1EEJ A;  2V1L A;  4FMB A;  3WDG B;  1VQ6 3;  1BSC A;  1ULJ B;  1SII A;  4HM0 B;  4BTW A;  3QRD A;  1IVV A;  1QAL A;  1EKM A;  2H0G A;  4ZM8 A;  1HZ1 A;  1X1X A;  9RNT A;  1NNV A;  1VQM 3;  1UGI A;  3D5G A;  3NBJ A;  4KFE A;  1SPU A;  1JKG B;  3UNL A;  1O7P B;  3KCH A;  3B4O A;  1Q40 B;  1Q42 A;  1QJG A;  3JUQ A;  4CCV A;  1TRQ A;  2M7O A;  1RCK A;  3BNE A;  3LZA A;  3X42 A;  3CPW 2;  5AII A;  1T3B A;  3M8C A;  1QAK A;  2IY2 A;  4HVN A;  1RNB A;  3D3L A;  5IEP A;  2RGQ A;  1RN7 A;  3PGB A;  4K90 B;  1HU9 A;  2ZL8 A;  3HII A;  1FZU A;  2W56 A;  3FGY A;  4XDW A;  3T0U A;  1CQS A;  1M1X B;  1LOV A;  1ZS7 A;  1RNT A;  1TFO A;  1B21 A;  5D83 A;  3G8Z A;  3HZP A;  1KC8 4;  5BVB A;  1JZO A;  4XM4 A;  3B4P A;  1I2G A;  2P0X A;  2IA7 A;  3CC7 3;  2FGT A;  4OVM A;  5AEW B;  1BNG A;  3OWU A;  2K54 A;  2XFT A;  3FG1 A;  1AVL A;  1N9J A;  2QA4 3;  4R9L A;  3OV4 A;  1V58 A;  1LQM B;  4O3V A;  3EB8 A;  1L5G B;  1YIJ 3;  2GBW B;  1PFP A;  3DMC A;  4EC6 A;  2ZDJ A;  2LYX A;  4HYZ A;  1JB5 A;  5A0O B;  1YJ9 3;  4L7K A;  3CD6 3;  4EV5 A;  1NO3 A;  1IVW A;  3B8L A;  1TU5 A;  2CK3 H;  3KN4 A;  3CMA 3;  5EEO A;  1E97 A;  1BNF A;  1FGM A;  1I2F A;  1W6G A;  2CIU A;  2H0I A;  4WYK A;  5AIF A;  1UW1 A;  2HML B;  1TRP A;  1IU7 A;  4R1K A;  5G2G A;  1RMS A;  5BXQ A;  1DVC A;  2CFG A;  3KII A;  2XSO B;  3NXJ A;  5EVH A;  3CCV 3;  1FUW A;  1G96 A;  1LOW A;  3DGN A;  1EQK A;  1G0T A;  2GXF A;  3D9R A;  1QVG 2;  4AKZ A;  3EN1 B;  3T8N A;  2YFI B;  2XFS A;  3FH1 A;  3V92 A;  1YVB I;  2CWT A;  2ZA4 A;  1RDS A;  1KSI A;  1GOY A;  2XR8 B;  2L1S A;  4BL2 A;  6STD A;  1D6U A;  2K0M A;  1BAO A;  3Q90 A;  1GOU A;  3GZY B;  4K61 A;  1WQL B;  5TGN A;  5G1L A;  3GZX B;  3MG2 A;  1PY3 A;  3LTA A;  3F7S A;  3URP A;  3T8U A;  2KF6 A;  4KT3 B;  5RNT A;  2I9W A;  2OOV A;  1UI8 A;  3D5I A;  3TDG A;  2RFR A;  4CJN A;  2P05 A;  2C10 A;  1KWI A;  2BU4 A;  3WHO A;  1LRA A;  1O7W B;  2BIR A;  1FGO A;  1OGX A;  1DET A;  3DGY A;  3WOF B;  3X3X A;  3OWS A;  4R80 A;  1FGT A;  2WOH A;  2ML6 A;  2Q07 A;  4HJL B;  3PYJ A;  1RN4 A;  3NBB A;  4RNY A;  1CH0 A;  1FGR A;  2PNC A;  1AR0 A;  1RGH A;  4HM6 B;  3SXX A;  5IG5 A;  5KP4 A;  2F4Y A;  1MGR A;  1UGH I;  2GBX B;  3WOE B;  7RNT A;  2MF7 A;  3AHS A;  4FMC A;  1BRK A;  1BSE A;  5AIG A;  1JBT A;  1VZZ A;  2GEY A;  4HM7 B;  4WYK B;  3CC2 3;  3F8H A;  4EW5 A;  1RKY A;  1GD4 A;  1MWS A;  3LTB A;  3CCJ 3;  1ZO2 A;  1ROA A;  2HMK B;  3SED A;  6RNT A;  1MWT A;  1X1Y A;  4R9K A;  3HIG A;  1KD1 4;  3CPO A;  7GSP A;  4N6O B;  3EC9 A;  5IEN A;  1AY7 A;  1BGS A;  1OGZ A;  2WGO A;  4GB5 A;  3MG1 A;  3CCS 3;  5DRE A;  2IMJ A;  1K28 A;  1O7N B;  2P09 A;  1RHL A;  2ZHX B;  3FZW A;  3RDE A;  2CC3 A;  1JRQ A;  4N6L A;  3ECF A;  4BU4 A;  1W6C A;  2OOV C;  2O9U X;  4L8P A;  5EQL A;  5G1K A;  5STD A;  1IT7 A;  1VQK 3;  4RZM A;  3PXM A;  1BRI A;  1RTU A;  2GU1 A;  1DVD A;  2XGL A;  1AQZ A;  2B24 B;  1YJN 3;  1GY5 A;  1J2B A;  1TJD A;  1M90 4;  4O02 B;  3ER7 A;  1JN5 A;  4FCZ A;  4BIR A;  2XRX B;  3HOH A;  5ELJ A;  4CPK A;  1UDI I;  2A15 A;  4WFO A;  1OHS A;  4HM8 B;  4OK0 A;  1K41 A;  3DM8 A;  3SOY A;  1W2Z A;  3FF0 A;  4JF8 A;  2D42 A;  4KFD A;  1IYY A;  1Q9E A;  1A2P A;  4LZI A;  1VQ7 3;  1YGW A;  3BLZ A;  1BUJ A;  2W03 A;  1RRL A;  2BMR B;  3NM7 A;  1ULI B;  1RLS A;  1W01 A;  3DGL A;  5LC7 A;  1BSA A;  2W0Q A;  1A90 A;  3E99 A;  4HKV B;  3ZG0 A;  5HGR A;  1I3F A;  3KSE D;  3DUK A;  2P0M A;  3KSP A;  3RNT A;  1LOX A;  4MMZ B;  1O7M B;  1JB4 A;  3NV0 A;  1IV9 A;  1F8N A;  2J8X B;  2QGU A;  3ALA A;  1O7H B;  3WOD G;  1A2V A;  1LQG C;  2F5M A;  4LGQ A;  3WR2 A;  4U13 A;  1MOL A;  3CCE 3;  2BNG A;  4XBX A;  4RBN A;  3NM2 A;  3GWR A;  1IK3 A;  3IJE B;  1OF5 A;  1UUW B;  3CCQ 3;  1JB2 A;  1OUN A;  4HZB B;  1VQL 3;  1BSB A;  1JJ2 2;  2SBL A;  1UCK A;  1MGW A;  4HBR A;  3SYU A;  1STD A;  1UCJ A;  2FXT A;  4RNZ A;  4K1U A;  1GSP A;  1C7H A;  1RGL A;  2AAE A;  4J5G A;  5D82 A;  1KQS 2;  3AGN A;  1BOX A;  1I0V A;  5FW5 A;  1T2I A;  1FA3 A;  5AEU B;  3MPH A;  1OAC A;  2CFW A;  4ORL A;  1RGC A;  3N54 B;  1DYU A;  1IDP A;  2E2T A;  2Z76 A;  3B7C A;  3FKA A;  1VQ5 3;  4TX4 A;  4LEH A;  1IVX A;  1C54 A;  1T5Y A;  2STD A;  3UJM A;  2GSP A;  4FCM A;  1BIR A;  1SIH A;  3N9H A;  1FUT A;  3HI7 A;  1DE3 A;  2YFJ B;  1FUS A;  1RJO A;  1SAR A;  2INX A;  3X41 A;  5M18 A;  3F8X A;  4N6U A;  5AI1 A;  2F5W A;  2D1W A;  2Z77 A;  2K3D A;  5CXO A;  4JRF A;  1K8A 4;  3Q2P A;  1V57 A;  1SJW A;  2W56 B;  3LH4 A;  4HM4 B;  4O8S A;  3CCR 3;  1U5O A;  1BVI A;  2RBI A;  3V99 A;  3NV0 B;  3FSD A;  2OQE A;  2W04 A;  1EA2 A;  3LXU X;  1STF I;  3FF2 A;  4HM1 B;  3NBR A;  1I2E A;  2XF3 A;  1R4C A;  2HMM B;  3DXO A;  1ZX2 A;  1IT8 A;  3LYG A;  4HM3 B;  1M1K 4;  2F56 A;  3EJV A;  4RNT A;  1TUH A;  1BAN A;  1BRH A;  1OF5 B;  4HZ9 B;  1W2B 2;  1V74 A;  2RCD A;  3CCL 3;  4NHF A;  3BNC A;  5AYS C;  1ROV A;  1LXE A;  3U1W A;  3DH2 A;  4H3U A;  1UUG B;  4MMY B;  2W9P A;  3G0K A;  1IVU A;  3BND A;  4GL6 A;  3K0Z A;  1OPY A;  3U97 A;  1PU4 A;  3JUP A;  3H51 A;  3ZFZ A;  3S27 A;  2B1X B;  1RGA A;  1FW7 A;  3NX0 A;  5IER A;  4IPB A;  5IF6 A;  1D6Y A;  1CYU A;  1LNI A;  4N6T A;  3F14 A;  1ZGX A;  3GRD A;  1B2M A;  2UGI A;  1HKX A;  1U8C B;  1GD3 A;  4CDL A;  6GSP A;  3JVC A;  3EN8 A;  4KZ1 A;  1YNV X;  3EE1 A;  4X2O A;  5HOH A;  3BIR A;  3WMD A;  3I56 3;  2CX0 A;  1CEW I;  2QIY A;  4EBG A;  5D81 A;  4LSO A;  1B20 A;  1UCL A;  3BB9 A;  3V98 A;  2F99 A;  3EBY A;  1PYL A;  3F7X A;  3G4S 3;  1A2K A;  1AV4 A;  2F98 A;  4MEI A;  4STD A;  1MNL A;  5BU4 A;  2OQE C;  1YHQ 3;  2H0H A;  2HOH A;  1IQX A;  3PCR A;  4L8O A;  4GSP A;  1TTO A;  2BMO B;  2JDI H;  8RNT A;  1VQ9 3;  2OTL 3;  1D6Z A;  1BU4 A;  2CWV A;  1Q40 A;  1WMN A;  4EV2 A;  3HK4 A;  5AIH A;  2Z6B A;  1N5H A;  3DGO A;  5BIR A;  5CF2 A;  2HMN B;  1RGG A;  1W4N A;  4J5K A;  1SQW A;  4N6V 0;  3VGN A;  3VSY A;  4MMX B;  3MHE A;  3SLU A;  2KXG A;  3D79 A;  3K63 A;  1GYB A;  3AMO A;  1I70 A;  3LTC A;  1QAF A;  1MWU A;  2P38 A;  1N5P A;  3EHC A;  2R4I A;  4NRE A;  3BU4 A;  3N8B A;  3Q3F A;  1N9E A;  1RGF A;  3JUM A;  2HMJ B;  1I0X A;  1IQ8 A;  2KRT A;  4OUQ A;  1JBR A;  1OHP A;  4I4K A;  4AEQ A;  4AKY A;  3UL5 A;  1W5Z A;  3EX9 A;  1JBS A;  3FG3 A;  3UB1 A;  3CCM 3;  2R41 A;  1IQY A;  3ROB A;  1GS3 A;  4XDV A;  3CC4 3;  5LC6 A;  3MYT A;  2ML5 A;  2IUK A;  4HOH A;  3HX8 A;  2C4B A;  1S5A A;  2LQV A;  3OWY A;  1BNR A;  3MWZ A;  4BL3 A;  3FG4 A;  4WWU C;  3OXA A;  1WMP A;  5DRV A;  5KP1 A;  4N6N B;  3NQY A;  5CK6 A;  4J8T A;  1I3I A;  1VQQ A;  1VQ4 3;  3SX1 A;  3LT8 A;  1S72 3;  3NQZ A;  1TIJ A;  3I0Y A;  3G16 A;  3PS8 A;  3PCS A;  1YIT 3;  3S67 A;  4BTX A;  2AAD A;  5CLK A;  1Q82 4;  3K7C A;  1Q7Y 4;  2XH9 A;  4LMI A;  4GHO A;  2BT3 A;  5M19 A;  3I55 3;  3L0R A;  3AGO A;  1JZD A;  2CG0 A;  2KF4 A;  3X3Y A;  2XSH B;  1TFK A;  1T2H A;  1TP6 A;  2BHM A;  3DZL A;  5FGO A;  1JN5 B;  4WHA A;  1W6Y A;  3AMO B;  1YJW 3;  1DMM A;  3SOA A;  1LVN A;  3CNM A;  4HAA A;  1YVS A;  1BNS A;  3CXC 2;  4X2H A;  1EUI C;  2PZV A;  1GOV A;  3LTD A;  1CYV A;  1WMO A;  4KFF A;  5IG3 A;  2YX9 A;  3IPT A;  1RGE A;  2CWU A;  2C11 A;  1BRS A;  2WOF A;  3F9S A;  3UL6 A;  3O8Y A;  5AYR B;  2KAA A;  4FR9 A;  5IEO A;  3H3H A;  2L4V A;  1N8R 4;  2BMQ B;  3CU3 A;  3GZR A;  1YGE A;  2IYJ A;  4FMD A;  2CKF B;  1QMA A;  4HM2 B;  1I8V A;  2F86 B;  1W02 A;  3OW2 2;  1Q86 4;  3MG3 A;  3JUN A;  1B2S A;  1UI7 A;  3K9M C;  1B2Z A;  1M9G A;  4N3V A;  1BRJ A;  2KF3 A;  3IMA B;  2RNT A;  1UCI A;  3DGM A;  3EQQ B;  4K1V A;  3GSP A;  4ILF A;  3PZW A;  3AHW A;  3LML A;  1LOY A;  1EG9 B;  4MJD A;  2FNQ A;  1ISK A;  4WP5 A;  3KKG A;  4HM5 B;  5IW9 A;  3MSO A;  5IG4 A;  2Y74 A;  4J9A A;  3G6E 3;  1OHO A;  1YI2 3;  3JUO A;  2CFK A;  1HYF A;  1RCL A;  3DY5 A;  5JPP A;  1NDO B;  4DKI A;  2XGN A;  2CG1 A;  2CH9 A;  1RRH A;  5M1A A;  1A67 A;  2XEP A;  1IV7 A;  4PEJ A;  1X1U A;  2GU3 A;  1QVF 2;  3WA3 A;  3A76 A;  3K5T A;  5GSP A;  4NPB A;  1JV2 B;  4XBT A;  1O7G B;  1X1W A;  2UX0 A;  2CX1 A;  2JQ5 A;  4O2H A;  1LNH A;  1WNH A;  1FGQ A;  2OCT A;  4I5Q A;  1W00 A;  1GMR A;  1GY7 A;  1BNJ A;  5I97 A;  3FCS B;  1K9M 4;  2OWP A;  3GAX A;  1BUQ A;  3EBT A;  3S5C A;  2CFD A;  3D4A A;  3LOY A;  1R4Y A;  3NHX A;  1VQP 3;  2OTJ 3;  2SAR A;  5CF1 A;  5JPU A;  1Y4K A;  1B2U A;  2W2C A;  5KP3 A;  1B3S A;  1BSD A;  1B2X A;  2BO9 B;  3X40 A;  4FCJ A;  5IG0 A;  4IIA A;  2WO0 A;  1MWR A;  4XB5 A;  1Z1S A;  3VF1 A;  1NB3 I;  1BRG A;  2GEX A;  3KE7 A;  4FMA A;  4Q53 A;  1RN1 A;  2MC8 A;  1VQO 3;  1JKG A;  3LT9 A;  4G1M B;  4BTY A;  3STD A;  4LYL B;  7STD A;  3RGA A;  1GMP A;  1Q81 4;  1US1 A;  1E3V A;  3A5E A;  4EXR A;  4XBY A;  1Q7H A;  2UUG C;  2YFL B;  3MKI A;  2Y73 A;  1FYS A;  3ZG5 A;  3J7Y d;  5JBS A;  1VQN 3;  1VQ8 3;  3KFQ C;  1N8Q A;  3Q1C A;  4N6M A;  1RSN A;  1G02 A;  3RGR A;  2W6J H;  1ASK A;  1OCV A;  2KCD A;  2O3O A; 
#chains in the Genus database with same CATH homology
 1K73 4;  1W7C A;  4H61 A;  1GY6 A;  2CHC A;  3S29 A;  3CNX A;  3GZB A;  3G71 3;  2E2V A;  2QEX 3;  3CCU 3;  1NJI 4;  1UUV B;  3WA2 X;  1NB5 I;  1NU3 A;  2W9Q A;  3FLJ A;  2WGQ A;  2Z7A A;  3F40 A;  2HMO B;  3BNB A;  1NWW A;  2CFL A;  2RSX A;  2IUJ A;  1OH0 A;  8CHO A;  2CW9 A;  4KVH A;  4QWT A;  3S28 A;  4EYC A;  1DMQ A;  3X3Z A;  3NUV A;  3OX9 A;  3KZT A;  1E3R A;  2E2U A;  1JNQ A;  3SVA A;  3QK9 A;  1AVK A;  3CME 3;  3EF8 A;  1DMN A;  4R4K A;  5ELU A;  1WTH A;  1VQ6 3;  4IT7 A;  2V1L A;  4FMB A;  3WDG B;  1ULJ B;  1SII A;  4HM0 B;  4BTW A;  3QRD A;  1IVV A;  1QAL A;  1EKM A;  4ZM8 A;  1VQM 3;  3NBJ A;  4KFE A;  1SPU A;  1JKG B;  3UNL A;  1O7P B;  4CCV A;  3B4O A;  1Q40 B;  1Q42 A;  1QJG A;  3JUQ A;  1IK3 A;  2M7O A;  3CPW 2;  3BNE A;  3LZA A;  3X42 A;  5AII A;  3M8C A;  4HVN A;  1QAK A;  3D3L A;  5IEP A;  2RGQ A;  1RN7 A;  3PGB A;  4K90 B;  1HU9 A;  2ZL8 A;  3HII A;  2W56 A;  3FGY A;  4XDW A;  3T0U A;  1CQS A;  1M1X B;  1TFO A;  5D83 A;  3G8Z A;  3HZP A;  1KC8 4;  5BVB A;  4XM4 A;  3B4P A;  2P0X A;  2IA7 A;  3CC7 3;  2FGT A;  4OVM A;  5AEW B;  3OWU A;  2K54 A;  2XFT A;  3FG1 A;  1AVL A;  1N9J A;  2QA4 3;  4R9L A;  3OV4 A;  4O3V A;  3EB8 A;  1L5G B;  1YIJ 3;  2GBW B;  1PFP A;  3DMC A;  4EC6 A;  2ZDJ A;  2LYX A;  4HYZ A;  1JB5 A;  5A0O B;  1YJ9 3;  4L7K A;  3CD6 3;  4EV5 A;  1NO3 A;  1IVW A;  3B8L A;  1TU5 A;  2CK3 H;  3KN4 A;  3CMA 3;  5EEO A;  1E97 A;  1FGM A;  1W6G A;  2CIU A;  4WYK A;  5AIF A;  1UW1 A;  2HML B;  1IU7 A;  4R1K A;  5G2G A;  5BXQ A;  1DVC A;  2CFG A;  3KII A;  2XSO B;  3NXJ A;  5EVH A;  3CCV 3;  1FUW A;  1G96 A;  3DGN A;  1EQK A;  2GXF A;  3D9R A;  1QVG 2;  4AKZ A;  3EN1 B;  3T8N A;  2YFI B;  2XFS A;  3FH1 A;  3V92 A;  1YVB I;  2CWT A;  2XR8 B;  1KSI A;  6STD A;  1D6U A;  2K0M A;  3Q90 A;  3GZY B;  4K61 A;  1WQL B;  5TGN A;  3GZX B;  3MG2 A;  3LTA A;  3F7S A;  3T8U A;  2I9W A;  2OOV A;  1UI8 A;  3TDG A;  2RFR A;  2P05 A;  2C10 A;  1KWI A;  1O7W B;  1FGO A;  1OGX A;  3WOF B;  3X3X A;  3OWS A;  4R80 A;  1FGT A;  2WOH A;  2ML6 A;  2Q07 A;  4HJL B;  3PYJ A;  3NBB A;  4RNY A;  1FGR A;  2PNC A;  1AR0 A;  5KP4 A;  4HM6 B;  3SXX A;  5IG5 A;  3WOE B;  2GBX B;  2MF7 A;  4FMC A;  5AIG A;  1VZZ A;  2GEY A;  4HM7 B;  4WYK B;  3CC2 3;  3F8H A;  1RKY A;  1GD4 A;  3LTB A;  3CCJ 3;  1ZO2 A;  1ROA A;  2HMK B;  3SED A;  4R9K A;  3HIG A;  1KD1 4;  3CPO A;  4N6O B;  3EC9 A;  5IEN A;  1OGZ A;  2WGO A;  4GB5 A;  3MG1 A;  3CCS 3;  5DRE A;  2IMJ A;  1K28 A;  1O7N B;  2P09 A;  3FZW A;  3RDE A;  2CC3 A;  1JRQ A;  4N6L A;  3ECF A;  1W6C A;  2OOV C;  2O9U X;  4L8P A;  5EQL A;  5STD A;  1IT7 A;  1VQK 3;  4RZM A;  3PXM A;  1DVD A;  2GU1 A;  2XGL A;  2B24 B;  1YJN 3;  1GY5 A;  1J2B A;  1M90 4;  4O02 B;  3ER7 A;  1JN5 A;  4FCZ A;  2XRX B;  5ELJ A;  2A15 A;  4WFO A;  1OHS A;  4HM8 B;  4OK0 A;  1K41 A;  3DM8 A;  3SOY A;  1W2Z A;  3FF0 A;  4JF8 A;  2D42 A;  4KFD A;  4LZI A;  1VQ7 3;  3BLZ A;  2W03 A;  1RRL A;  2BMR B;  3NM7 A;  1ULI B;  1W01 A;  3DGL A;  5LC7 A;  2W0Q A;  1A90 A;  3E99 A;  4HKV B;  5HGR A;  3KSE D;  3DUK A;  2P0M A;  3KSP A;  1LOX A;  4MMZ B;  1O7M B;  1JB4 A;  3NV0 A;  1IV9 A;  1F8N A;  2QGU A;  3ALA A;  3WOD G;  1O7H B;  1A2V A;  4LGQ A;  4U13 A;  1MOL A;  3CCE 3;  2BNG A;  4XBX A;  4RBN A;  3NM2 A;  3GWR A;  3IJE B;  1OF5 A;  1UUW B;  3CCQ 3;  1JB2 A;  1OUN A;  4HZB B;  1VQL 3;  1JJ2 2;  2SBL A;  4HBR A;  1STD A;  4RNZ A;  2FXT A;  4K1U A;  1C7H A;  5D82 A;  1KQS 2;  5FW5 A;  1FA3 A;  5AEU B;  3MPH A;  1OAC A;  2CFW A;  4ORL A;  3N54 B;  1DYU A;  1IDP A;  2E2T A;  2Z76 A;  3B7C A;  3FKA A;  1VQ5 3;  4TX4 A;  4LEH A;  1IVX A;  1T5Y A;  2STD A;  3UJM A;  4FCM A;  1SIH A;  3N9H A;  3HI7 A;  2YFJ B;  1RJO A;  2INX A;  3X41 A;  3F8X A;  4N6U A;  5AI1 A;  2D1W A;  2Z77 A;  5CXO A;  1K8A 4;  4JRF A;  3Q2P A;  1SJW A;  2W56 B;  3LH4 A;  4HM4 B;  4O8S A;  3CCR 3;  1U5O A;  3V99 A;  3NV0 B;  3FSD A;  2OQE A;  2W04 A;  1EA2 A;  3LXU X;  1STF I;  3FF2 A;  4HM1 B;  3NBR A;  2XF3 A;  1R4C A;  2HMM B;  3DXO A;  1ZX2 A;  1IT8 A;  3LYG A;  4HM3 B;  1M1K 4;  3EJV A;  1TUH A;  1OF5 B;  1W2B 2;  1V74 A;  2RCD A;  3CCL 3;  4NHF A;  3BNC A;  5AYS C;  1ROV A;  1LXE A;  3U1W A;  4H3U A;  4MMY B;  2W9P A;  3G0K A;  1IVU A;  3BND A;  4GL6 A;  3K0Z A;  1OPY A;  3U97 A;  1PU4 A;  3JUP A;  3H51 A;  3S27 A;  2B1X B;  3NX0 A;  5IER A;  4IPB A;  5IF6 A;  1D6Y A;  1CYU A;  4N6T A;  3F14 A;  3GRD A;  1HKX A;  1U8C B;  1GD3 A;  4CDL A;  3JVC A;  3EN8 A;  4KZ1 A;  3EE1 A;  4X2O A;  3WMD A;  3I56 3;  1CEW I;  2QIY A;  4EBG A;  5D81 A;  4LSO A;  3BB9 A;  3V98 A;  2F99 A;  3EBY A;  3F7X A;  3G4S 3;  1A2K A;  1AV4 A;  2F98 A;  4MEI A;  4STD A;  1MNL A;  1YHQ 3;  2OQE C;  1IQX A;  3PCR A;  4L8O A;  2BMO B;  2JDI H;  1VQ9 3;  2OTL 3;  1D6Z A;  2CWV A;  1Q40 A;  1WMN A;  4EV2 A;  3HK4 A;  5AIH A;  2Z6B A;  1N5H A;  3DGO A;  5CF2 A;  2HMN B;  1W4N A;  3VGN A;  1SQW A;  4N6V 0;  3VSY A;  4MMX B;  3MHE A;  3SLU A;  2KXG A;  3K63 A;  1GYB A;  3AMO A;  3LTC A;  1QAF A;  2P38 A;  1N5P A;  3EHC A;  2R4I A;  4NRE A;  3N8B A;  1N9E A;  3JUM A;  2HMJ B;  1IQ8 A;  2KRT A;  4OUQ A;  1OHP A;  4I4K A;  4AEQ A;  4AKY A;  3UL5 A;  1W5Z A;  3EX9 A;  3FG3 A;  3UB1 A;  3CCM 3;  1IQY A;  3ROB A;  1GS3 A;  4XDV A;  3CC4 3;  5LC6 A;  3MYT A;  2ML5 A;  2IUK A;  3HX8 A;  2LQV A;  1S5A A;  3OWY A;  3MWZ A;  3FG4 A;  4WWU C;  3OXA A;  1WMP A;  5DRV A;  5KP1 A;  4N6N B;  3NQY A;  5CK6 A;  4J8T A;  1VQ4 3;  3SX1 A;  3LT8 A;  1S72 3;  3NQZ A;  1TIJ A;  3I0Y A;  3G16 A;  3PS8 A;  3PCS A;  1YIT 3;  3S67 A;  4BTX A;  5CLK A;  1Q82 4;  3K7C A;  1Q7Y 4;  2XH9 A;  4LMI A;  2BT3 A;  3I55 3;  3L0R A;  2CG0 A;  3X3Y A;  2XSH B;  1TFK A;  1TP6 A;  2BHM A;  3DZL A;  5FGO A;  1JN5 B;  4WHA A;  1W6Y A;  3AMO B;  1YJW 3;  1DMM A;  3SOA A;  1LVN A;  3CNM A;  3CXC 2;  4X2H A;  2PZV A;  3LTD A;  1CYV A;  1WMO A;  4KFF A;  5IG3 A;  2YX9 A;  3IPT A;  2CWU A;  2C11 A;  2WOF A;  3F9S A;  3UL6 A;  3O8Y A;  5AYR B;  4FR9 A;  5IEO A;  3H3H A;  2L4V A;  1N8R 4;  2BMQ B;  3CU3 A;  3GZR A;  1YGE A;  4FMD A;  4HM2 B;  2CKF B;  1QMA A;  4HZ9 B;  2F86 B;  2CG1 A;  1W02 A;  3OW2 2;  1Q86 4;  3MG3 A;  3JUN A;  1UI7 A;  3K9M C;  1M9G A;  4N3V A;  3IMA B;  3DGM A;  3EQQ B;  4K1V A;  3PZW A;  3LML A;  1EG9 B;  4MJD A;  2FNQ A;  1ISK A;  4WP5 A;  3KKG A;  4HM5 B;  5IW9 A;  3MSO A;  5IG4 A;  2Y74 A;  4J9A A;  3G6E 3;  1OHO A;  1YI2 3;  3JUO A;  2CFK A;  3DY5 A;  5JPP A;  1NDO B;  2XGN A;  2CH9 A;  1RRH A;  1A67 A;  2XEP A;  1IV7 A;  4PEJ A;  2GU3 A;  1QVF 2;  3WA3 A;  3A76 A;  3K5T A;  1JV2 B;  4XBT A;  1O7G B;  2UX0 A;  2JQ5 A;  4O2H A;  1LNH A;  1WNH A;  1FGQ A;  2OCT A;  1W00 A;  1GY7 A;  5I97 A;  3FCS B;  1K9M 4;  2OWP A;  3GAX A;  1BUQ A;  3EBT A;  3S5C A;  2CFD A;  3LOY A;  3NHX A;  1VQP 3;  2OTJ 3;  5CF1 A;  5JPU A;  1Y4K A;  2W2C A;  5KP3 A;  2BO9 B;  3X40 A;  4FCJ A;  5IG0 A;  4IIA A;  2WO0 A;  4XB5 A;  1Z1S A;  3VF1 A;  1NB3 I;  2GEX A;  3KE7 A;  4FMA A;  4Q53 A;  2MC8 A;  1VQO 3;  1JKG A;  3LT9 A;  4G1M B;  4BTY A;  3STD A;  7STD A;  3RGA A;  1Q81 4;  1US1 A;  1E3V A;  4EXR A;  4XBY A;  2YFL B;  3MKI A;  2Y73 A;  3J7Y d;  5JBS A;  1VQN 3;  1VQ8 3;  3KFQ C;  1N8Q A;  3Q1C A;  4N6M A;  3RGR A;  2W6J H;  1ASK A;  1OCV A;  2KCD A;  2O3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...