3J7Yd

Structure of the large ribosomal subunit from human mitochondria
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
162
Chain Sequence
ASQVSIRRIKDYDANFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSHVVQVRCNVYGQITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLPYGSWRMHTKIVPPWAPPKQPILKTVMIPGPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 162
sequence length 171
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF04280 Tim44 Tim44-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.240 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3j7yd00
3J7Yd 3QK9A 2FXTA 2CW9A
chains in the Genus database with same CATH superfamily
2SBLA 1EKMA 2W6JH 3EX9A 3U97A 1I2GA 1LOXA 4I5QA 1B20A 1BSEA 2XFTA 3X3YA 1BUJA 1LVNA 4KFEA 1RMSA 3I553 3CCE3 1F8NA 4WHAA 3NX0A 4G1MB 2P38A 3G8ZA 4HM7B 1M1K4 1B2MA 2W0QA 1DYUA 3VSYA 3VGNA 2V1LA 2HMOB 1BNFA 3AHWA 3JVCA 4N6V0 3DMCA 3GWRA 3X41A 3Q90A 2XF3A 3FKAA 2HOHA 3KKGA 2E2TA 4NHFA 1ZO2A 5ELUA 3BNBA 1MNLA 4XDVA 5KP3A 2GEYA 3WOEB 5JBSA 2YX9A 4KFFA 3GZXB 2H0HA 3SXXA 2FXTA 2J8XB 1OGZA 2FGTA 3D79A 4ORLA 4WP5A 2ZHXB 4J5GA 1V74A 2WGOA 1YJ93 4WYKB 1PFPA 2W56A 1UDII 2CFGA 2QIYA 3OV4A 4HZ9B 3DUKA 5DREA 1WQLB 1BU4A 1G96A 1W02A 2CKFB 2QEX3 1X1YA 2K3DA 5M1AA 1FGOA 1I3IA 4OUQA 3DGLA 5STDA 3SOYA 4FCJA 1RKYA 3CME3 1RRLA 1TJDA 1N9JA 1DETA 1RGFA 1W6YA 3QRDA 1O7PB 5IENA 1S5AA 1FZUA 1UCJA 2P0MA 2MC8A 5G2GA 3NHXA 4HM3B 3B4OA 3IJEB 2RFRA 1BRIA 1IVUA 3D5IA 3EBTA 1OHPA 3F8HA 2K0MA 3OX9A 5D81A 4R80A 5AYRB 3KCHA 4MJDA 5LC6A 1NJI4 2GU3A 4GB5A 4GHOA 3EQQB 1B21A 3ER7A 1OACA 4R9KA 5FGOA 5TGNA 2MF7A 1T3BA 1T5YA 3JUPA 4Q53A 1VQN3 3H51A 1Q40B 4CJNA 1IQYA 1NU3A 4HJLB 5HGRA 3ZFZA 1RLSA 4ZM8A 1BNGA 3IMAB 3K5TA 3CXC2 3PZWA 2L4VA 4MMXB 3CCU3 1TFOA 2LYXA 4OVMA 1W4NA 4AEQA 1FYSA 2PNCA 2E2VA 1BNJA 1KQS2 1X1UA 3MPHA 1V58A 1IT7A 2Y74A 3ALAA 1TTOA 1BNSA 3LTAA 3B4PA 5IG3A 2GEXA 1TIJA 1ULJB 1NNVA 3WHOA 2F99A 3E99A 1QALA 3IPTA 5CF1A 5IERA 1ROAA 5D82A 3X3ZA 1O7HB 2P09A 4BU4A 2IY2A 2KF5A 3DGMA 1CH0A 1N8R4 1BSDA 1V57A 2AAEA 1A2VA 1IT8A 1OF5B 1N8QA 3J7Yd 1JZOA 4XDWA 3CCV3 3K7CA 3KN4A 1O7GB 3EC9A 1OH0A 1QAFA 2GU1A 3KSPA 1GOUA 5IEPA 3JUQA 1STFI 3MYTA 1VQ43 2SARA 3S29A 1NB5I 1QVF2 1UW1A 3LZAA 1RGEA 4HM6B 3MKIA 4OK0A 2WOFA 3AMOA 4CCVA 3S27A 4NREA 1LNIA 3G713 1UI8A 2R4IA 3SYUA 1RN4A 1MWTA 5IG4A 4N6TA 2CFLA 8RNTA 3N8BA 2UX0A 1B27A 3ECFA 3WODG 3ZG5A 1BGSA 1RGHA 2IYJA 4NPBA 4RNYA 4ILFA 3F14A 3GRDA 4L8PA 2YFLB 2F5MA 4EXRA 3G16A 1BSAA 1KWIA 1YGWA 2CWVA 3KE7A 5A0OB 1Q824 1SQWA 4BL3A 1W5ZA 2ML5A 3OWYA 4R4KA 4DKIA 1BRNL 4MEIA 3GSPA 2CFWA 1B2SA 2GBWB 1W7CA 3HIGA 4BTXA 3BNEA 3D9RA 1I2FA 5EVHA 3X3XA 1X1XA 5AEWB 4XB5A 2F5WA 1IDPA 1KSIA 1RGLA 2RGQA 1W00A 3CC23 2F98A 1CYUA 1FW7A 4EW5A 4O2HA 2Z7AA 1EUIC 3BLZA 7RNTA 3V99A 2Y73A 2HMLB 1PU4A 3CPW2 1MGWA 1UUWB 1YVSA 1AVLA 1JBTA 2OQEA 1MOLA 4IIAA 4O8SA 3BNDA 3RGRA 1ISKA 3PGBA 4L8OA 4FCZA 3NV0B 1HU9A 3K0ZA 5CXOA 2XH9A 3Q1CA 3PCRA 1BNRA 4WYKA 4XBYA 1RCLA 1JV2B 3NM2A 3RDEA 1BAOA 3RNTA 1RGCA 2XFSA 1M9GA 1VQK3 1OPYA 1WNHA 1RNTA 3LXUX 3LTDA 3EBYA 3N54B 4EYCA 4BTWA 1VQP3 1BIRA 3DH2A 3MWZA 3NQZA 3ROBA 1UI7A 2K54A 1LOWA 2OOVC 1W6GA 5GSPA 9RNTA 1YHQ3 1LNHA 3STDA 3RGAA 2GBXB 2C4BA 2WGQA 3KZTA 3T8NA 3UNLA 3AGNA 3CMA3 1EQKA 1UGHI 1R4CA 1T2IA 1GOYA 1HYFA 3A5EA 3S67A 5AIGA 1Q40A 3BNCA 4HM4B 1FA3A 4CPKA 3U1WA 1EA2A 3CCL3 4GL6A 5AYSC 5IG5A 4FMBA 5IW9A 1YIT3 1JB4A 2CG0A 3EE1A 4PEJA 1MWRA 2B1XB 3ZG0A 2YFIB 5IG0A 3CC43 3G6E3 1IQXA 1RN1A 3WDGB 3HK4A 1UUVB 4HKVB 2XGNA 1IV9A 2KRTA 1BRGA 3PS8A 1DVCA 3CU3A 1LQGC 2CFDA 1A2KA 1GYBA 2OTL3 5AEUB 1OF5A 1N5HA 1BOXA 1ZX2A 1LRAA 1ZS7A 2CIUA 3OWSA 4K61A 1IVVA 3AGOA 3CCS3 1U5OA 3BB9A 4JF8A 1L5GB 4H3UA 1YJN3 2F4YA 2KCDA 3SLUA 1IVXA 3LTCA 2XRXB 4XBTA 5M18A 1GS3A 5JPUA 1FGQA 2W03A 1RGGA 1B2XA 3LOYA 1UCLA 3FSDA 3JUNA 3G0KA 1YJW3 2OWPA 5IF6A 2BU4A 4N6UA 3WMDA 2QGUA 4N6MA 2IUJA 1KC84 3NBJA 3DZLA 1JRQA 1O7NB 4HBRA 2Z77A 3F7SA 1BRJA 4IT7A 3F9SA 4HZBB 3FF0A 3CCM3 1W2B2 3S28A 1GD4A 1Q42A 1SPUA 1BRKA 2CK3H 2CW9A 3AHSA 3V98A 4AKYA 1VQ53 2KF4A 3MHEA 1VQ63 2RSXA 4EV2A 3BU4A 1MWUA 3CCR3 3D4AA 1VQ73 2XSHB 1PY3A 1JNQA 4O3VA 4BTYA 1RHLA 3G4S3 2CFKA 1KD14 4EV5A 1C7HA 1VQ93 1RGKA 4N6NB 4HVNA 3WA3A 5G1KA 6RNTA 5BVBA 1RJOA 4LGQA 2CH9A 1QAKA 1NDOB 1PYLA 1FUWA 1QJGA 2OCTA 1VQQA 4X2HA 1K9M4 4AKZA 1AQZA 3FCSB 6GSPA 1B2UA 4KT3B 3DXOA 1TUHA 1WMNA 3WA2X 3URPA 1WMOA 3EJVA 2BMRB 5EEOA 3EB8A 1EG9B 2ZL8A 3NBRA 1VQL3 3CNMA 1JBSA 1MGRA 2ZA4A 1Z1SA 1BSCA 3HOHA 1ULIB 3MG3A 1UCKA 3PXMA 3UL6A 1TFKA 3NXJA 1T2HA 2BT3A 1BVIA 1I2EA 3NM7A 1BRSA 3L0RA 4GSPA 4J9AA 3NV0A 1ASKA 1CQSA 1GOVA 5DRVA 1JKGB 2W2CA 4LZIA 3FF2A 3GZBA 1BUQA 1US1A 1B2ZA 2XGLA 2CC3A 2BNGA 3M8CA 3WOFB 4MMZB 4N6LA 2IA7A 2Q07A 4QWTA 3MG1A 1K734 1GY7A 1SIIA 2RBIA 4FMAA 3VF1A 1Q7HA 3CCJ3 1CEWI 3PCSA 1FUSA 1A67A 3K63A 1LQMB 4H61A 3MSOA 1IVWA 3CPOA 3TDGA 1VZZA 2IUKA 2KXGA 1AR0A 1YVBI 2IMJA 1K28A 1E3RA 3HI7A 4TX4A 3SOAA 4KZ1A 3LYGA 5I97A 4HM0B 1O7MB 1GSPA 5CF2A 1IK3A 4RZMA 1BSBA 3FG3A 5M19A 3HX8A 3OWUA 1JN5B 2GSPA 5KP1A 3UB1A 5RNTA 1M904 3F7XA 3FGYA 2HMMB 3GAXA 1BNEA 2FNQA 4J8TA 4N6OB 5AIIA 3OXAA 3FG1A 5D83A 1UUGB 2XSOB 1IU7A 1LOYA 5ELJA 2O3OA 2ZDJA 4N3VA 4EC6A 1VQM3 5FW5A 1RNBA 7GSPA 1DMNA 3I563 5AI1A 1AVKA 2LQVA 1TP6A 3MG2A 1SJWA 3FZWA 3PYJA 1U8CB 1C54A 1UCIA 1A90A 1GMRA 1O7WB 1EEJA 4RNZA 1I0XA 7STDA 3X42A 3BIRA 1DMQA 1FGRA 1GY5A 3LT8A 3EF8A 3A76A 2B24B 1TRPA 2UGIA 1YNVX 2WOHA 2CWTA 3FH1A 5CLKA 4LMIA 4LSOA 1VQ83 1JB5A 2OOVA 2CG1A 2W04A 3D5GA 3NBBA 5CK6A 2Z76A 3CNXA 3DY5A 3X40A 1G0TA 1X1WA 4I4KA 2QA43 3OW22 1OHSA 1CYVA 3D3LA 1GMQA 2CX1A 2CWUA 4LEHA 4CDLA 1QMAA 1N5PA 3QK9A 1YI23 1HZ1A 3EN8A 1YGEA 2F86B 3FG4A 2Z6BA 1IQ8A 3SX1A 2YFJB 3DM8A 3NUVA 1GY6A 5BIRA 4FMDA 1WTHA 1JZDA 1OCVA 2BMQB 3LT9A 2KF6A 2PZVA 2JQ5A 5JPPA 1D6YA 4K1UA 1Q864 1N9EA 3CC73 1I70A 2STDA 3JUOA 4X2OA 4XM4A 5AIFA 3CCQ3 1W01A 1DE3A 4K1VA 2W9QA 2UUGC 2W9PA 4HM5B 1GD3A 2RCDA 3DGOA 5HOHA 1NWWA 1OUNA 2HMNB 1RN7A 1OGXA 1FGMA 1STDA 2BMOB 2W56B 3GZRA 2CX0A 4K90B 3F8XA 3LH4A 5LC7A 3FLJA 4HM2B 2HMKB 1BANA 4HYZA 1IYYA 3KSED 2ML6A 2BIRA 4FCMA 1G02A 3T0UA 5IEOA 1LOVA 4O02B 6STDA 2XR8B 1FUTA 2CHCA 1QVG2 4WFOA 1JKGA 4RNTA 2INXA 5BXQA 3B7CA 2C11A 2KF3A 2GXFA 2L1SA 3LMLA 4JRFA 4U13A 1IV7A 1OHOA 1JBRA 1BNIA 3Q2PA 3SVAA 1VQO3 3SEDA 3DGYA 4EBGA 1Q9EA 4HOHA 4XBXA 4R9LA 3V92A 4R1KA 1LXEA 3NQYA 1W2ZA 4HM1B 4STDA 1Y4KA 2H0IA 1YIJ3 2OTJ3 3B8LA 1DVDA 4IPBA 1D6ZA 1RRHA 1E97A 2P0XA 4RBNA 3S5CA 4WWUC 1RSNA 3JUMA 2P05A 3WR2A 2M7OA 1TU5A 4HM8B 1E3VA 1ROVA 2KAAA 3HIIA 1K41A 2JDIH 3F40A 3Q3FA 2BHMA 1BRHA 1SARA 2HMJB 1ZGXA 3EN1B 1JJ22 5EQLA 4L7KA 3CD63 3N9HA 4BIRA 1AV4A 1JN5A 1I0VA 4J5KA 1RCKA 2O9UX 1K8A4 1DMMA 1RDSA 1J2BA 1M1XB 2AADA 3I0YA 1NB3I 3H3HA 2OQEC 2E2UA 3EHCA 5G1LA 5BU4A 4LYLB 1A2PA 1RTUA 4BL2A 3UJMA 3K9MC 1B3SA 2XEPA 1NO3A 3KFQC 1FGTA 2D42A 3KIIA 1Q7Y4 1AY7A 2I9WA 2BO9B 4MMYB 1RGAA 5KP4A 1TRQA 3AMOB 1S723 1UGIA 2WO0A 1I3FA 1GMPA 4HAAA 1I8VA 2C10A 4FR9A 2R41A 1JB2A 4KVHA 3HZPA 3DGNA 3UL5A 3T8UA 1SIHA 1HKXA 1MWSA 3O8YA 1D6UA 2A15A 2D1WA 2H0GA 1Q814 4FMCA 2F56A 4KFDA 2RNTA 5AIHA 1WMPA 1R4YA 3GZYB 1W6CA 3LTBA 8CHOA
chains in the Genus database with same CATH topology
2SBLA 1EKMA 2W6JH 3EX9A 3U97A 1LOXA 2XFTA 3X3YA 1LVNA 4KFEA 3I553 3CCE3 1F8NA 4WHAA 3NX0A 4G1MB 2P38A 3G8ZA 4HM7B 1M1K4 2W0QA 1DYUA 3VSYA 3VGNA 2V1LA 2HMOB 3X41A 4N6V0 3JVCA 3DMCA 3GWRA 3Q90A 2XF3A 3FKAA 3KKGA 2E2TA 4NHFA 1ZO2A 5ELUA 3BNBA 1MNLA 4XDVA 5KP3A 2GEYA 3WOEB 5JBSA 2YX9A 4KFFA 3GZXB 3SXXA 2FXTA 1OGZA 2FGTA 4ORLA 4WP5A 1V74A 2WGOA 1YJ93 4WYKB 1PFPA 2W56A 2CFGA 2QIYA 3OV4A 4HZ9B 3DUKA 5DREA 1WQLB 1G96A 1W02A 2CKFB 2QEX3 5STDA 1FGOA 4OUQA 3SOYA 3DGLA 4FCJA 1RKYA 3CME3 1RRLA 1N9JA 1W6YA 3QRDA 1O7PB 5IENA 1S5AA 2P0MA 2MC8A 5G2GA 3NHXA 4HM3B 3B4OA 3IJEB 2RFRA 1IVUA 5D81A 3EBTA 1OHPA 3F8HA 2K0MA 3OX9A 5AYRB 4R80A 4MJDA 5LC6A 1NJI4 2GU3A 4GB5A 3EQQB 3ER7A 5FGOA 1OACA 4R9KA 5TGNA 2MF7A 4Q53A 1T5YA 3JUPA 1VQN3 3H51A 1Q40B 1IQYA 1NU3A 4HJLB 5HGRA 4ZM8A 3IMAB 3K5TA 3CXC2 3PZWA 2L4VA 4MMXB 3CCU3 1TFOA 2LYXA 4OVMA 1W4NA 4AEQA 2PNCA 2E2VA 1KQS2 3MPHA 1IT7A 2Y74A 3ALAA 3LTAA 3B4PA 5IG3A 2GEXA 1TIJA 1ULJB 2F99A 3E99A 1QALA 3IPTA 5CF1A 5IERA 1ROAA 5D82A 3X3ZA 1O7HB 2P09A 3DGMA 1N8R4 1A2VA 3J7Yd 1IT8A 1OF5B 1N8QA 4XDWA 3CCV3 3K7CA 3KN4A 1O7GB 3EC9A 1OH0A 1QAFA 2GU1A 3KSPA 5IEPA 3JUQA 1STFI 3MYTA 1VQ43 3S29A 1NB5I 1QVF2 1UW1A 3LZAA 4HM6B 4OK0A 3MKIA 2WOFA 3AMOA 4CCVA 3S27A 4NREA 3G713 1UI8A 2R4IA 5IG4A 4N6TA 2CFLA 3N8BA 2UX0A 3ECFA 3WODG 4RNYA 3F14A 3GRDA 4L8PA 2YFLB 4EXRA 3G16A 2CWVA 1KWIA 3KE7A 5A0OB 1Q824 1SQWA 1W5ZA 2ML5A 3OWYA 4R4KA 4MEIA 2CFWA 2GBWB 1W7CA 3HIGA 4BTXA 3BNEA 3D9RA 5EVHA 3X3XA 5AEWB 4XB5A 1IDPA 1KSIA 2RGQA 1W00A 3CC23 2F98A 1CYUA 4O2HA 2Z7AA 3BLZA 3CPW2 3V99A 2Y73A 2HMLB 1UUWB 1AVLA 2OQEA 1MOLA 4IIAA 4O8SA 3BNDA 3RGRA 1ISKA 3PGBA 4L8OA 4FCZA 3NV0B 1HU9A 3K0ZA 5CXOA 2XH9A 3Q1CA 3PCRA 4WYKA 4XBYA 1JV2B 3NM2A 3RDEA 2XFSA 1M9GA 1VQK3 1OPYA 1WNHA 3LXUX 3LTDA 3EBYA 3N54B 4EYCA 4BTWA 1VQP3 3NQZA 3MWZA 3ROBA 1UI7A 2K54A 2OOVC 1W6GA 1YHQ3 1LNHA 3STDA 3RGAA 2GBXB 2WGQA 3KZTA 3T8NA 3UNLA 3CMA3 1EQKA 1R4CA 3S67A 5AIGA 1Q40A 3BNCA 4HM4B 1FA3A 3U1WA 1EA2A 3CCL3 4GL6A 5AYSC 5IG5A 4FMBA 5IW9A 1YIT3 1JB4A 2CG0A 3EE1A 4PEJA 2B1XB 2YFIB 5IG0A 3CC43 3G6E3 1IQXA 3WDGB 3HK4A 1UUVB 4HKVB 2XGNA 1IV9A 2KRTA 3PS8A 1DVCA 3CU3A 2CFDA 1A2KA 1GYBA 2OTL3 5AEUB 1OF5A 1N5HA 3OWSA 1ZX2A 2CIUA 1PU4A 3CCS3 4K61A 1KD14 1IVVA 1U5OA 3BB9A 4JF8A 1L5GB 4H3UA 1YJN3 2KCDA 3SLUA 1IVXA 3LTCA 2XRXB 4XBTA 1GS3A 5JPUA 1FGQA 2W03A 3LOYA 3FSDA 3JUNA 3G0KA 1YJW3 2OWPA 5IF6A 4N6UA 3WMDA 2QGUA 4N6MA 2IUJA 1KC84 3NBJA 3DZLA 1JRQA 1O7NB 4HBRA 2Z77A 3F7SA 4IT7A 3F9SA 4HZBB 3FF0A 3CCM3 1W2B2 3S28A 1GD4A 1Q42A 1SPUA 2CK3H 2CW9A 3V98A 4AKYA 1VQ53 1VQ63 3MHEA 2RSXA 4EV2A 3CCR3 1VQ73 2XSHB 1JNQA 4O3VA 4BTYA 3G4S3 2CFKA 4EV5A 1C7HA 1VQ93 4N6NB 4HVNA 3WA3A 5BVBA 1RJOA 4LGQA 2CH9A 1QAKA 1NDOB 1FUWA 1QJGA 2OCTA 4X2HA 1K9M4 4AKZA 3FCSB 3DXOA 1TUHA 1WMNA 3WA2X 1WMOA 3EJVA 2BMRB 5EEOA 3EB8A 1EG9B 2ZL8A 3NBRA 1VQL3 3CNMA 1Z1SA 3MG3A 1ULIB 3PXMA 3UL6A 1TFKA 3NXJA 2BT3A 3NM7A 3L0RA 4J9AA 3NV0A 1ASKA 1CQSA 5DRVA 1JKGB 2W2CA 4LZIA 3FF2A 3GZBA 1BUQA 1US1A 2XGLA 2CC3A 2BNGA 3M8CA 3WOFB 4MMZB 4N6LA 2IA7A 2Q07A 4QWTA 3MG1A 1K734 1GY7A 1SIIA 4FMAA 3VF1A 3CCJ3 1CEWI 3PCSA 1A67A 3K63A 4H61A 3MSOA 1IVWA 3CPOA 3TDGA 1VZZA 2IUKA 2KXGA 1AR0A 1YVBI 2IMJA 1K28A 1E3RA 3HI7A 4TX4A 3SOAA 4KZ1A 3LYGA 5I97A 4HM0B 1O7MB 5CF2A 1IK3A 4RZMA 3FG3A 3HX8A 3OWUA 1JN5B 5KP1A 3UB1A 1M904 3F7XA 3FGYA 2HMMB 3GAXA 2FNQA 4J8TA 4N6OB 5AIIA 3OXAA 3FG1A 5D83A 2XSOB 1IU7A 5ELJA 2O3OA 2ZDJA 4N3VA 4EC6A 1VQM3 5FW5A 1DMNA 3I563 5AI1A 1AVKA 2LQVA 1TP6A 3MG2A 1SJWA 3FZWA 3PYJA 1U8CB 1A90A 1O7WB 7STDA 4RNZA 3X42A 1DMQA 1FGRA 1GY5A 3LT8A 3EF8A 3A76A 2B24B 2WOHA 2CWTA 3FH1A 5CLKA 4LMIA 4LSOA 1VQ83 1JB5A 2OOVA 2CG1A 2W04A 5CK6A 3NBBA 3X40A 2Z76A 3CNXA 3DY5A 2QA43 3OW22 4I4KA 1OHSA 1CYVA 3D3LA 2CWUA 4LEHA 4CDLA 1QMAA 1N5PA 3QK9A 1YI23 3EN8A 3FG4A 1YGEA 2F86B 2Z6BA 1IQ8A 3SX1A 2YFJB 3DM8A 3NUVA 1GY6A 4FMDA 1WTHA 1OCVA 2BMQB 3LT9A 2PZVA 2JQ5A 5JPPA 1D6YA 4K1UA 1Q864 1N9EA 3CC73 4X2OA 2STDA 3JUOA 4XM4A 5AIFA 3CCQ3 1W01A 4K1VA 2W9QA 2W9PA 4HM5B 1GD3A 2RCDA 3DGOA 1NWWA 1OUNA 2HMNB 1RN7A 1OGXA 1FGMA 1STDA 2BMOB 2W56B 3GZRA 4K90B 3F8XA 3LH4A 5LC7A 3FLJA 4HM2B 2HMKB 4HYZA 3KSED 2ML6A 4FCMA 3T0UA 5IEOA 4O02B 6STDA 2XR8B 2CHCA 1QVG2 4WFOA 1JKGA 2INXA 5BXQA 3B7CA 2C11A 2GXFA 3LMLA 4JRFA 4U13A 1IV7A 1OHOA 3Q2PA 3SVAA 1VQO3 3SEDA 4EBGA 4XBXA 4R9LA 3V92A 4R1KA 1LXEA 3NQYA 1W2ZA 4HM1B 4STDA 1Y4KA 1YIJ3 2OTJ3 3B8LA 1DVDA 4IPBA 1D6ZA 1RRHA 1E97A 2P0XA 4RBNA 3S5CA 4WWUC 3JUMA 2P05A 2M7OA 1TU5A 4HM8B 1E3VA 1ROVA 3HIIA 1K41A 2JDIH 3F40A 2BHMA 2HMJB 3EN1B 1JJ22 5EQLA 4L7KA 3CD63 3N9HA 1AV4A 1JN5A 2O9UX 1K8A4 1DMMA 1J2BA 1M1XB 3I0YA 1NB3I 3H3HA 2OQEC 2E2UA 3EHCA 3UJMA 3K9MC 2XEPA 1NO3A 3KFQC 1FGTA 2D42A 3KIIA 1Q7Y4 5KP4A 2I9WA 2BO9B 4MMYB 3AMOB 1S723 2WO0A 2C10A 4FR9A 1JB2A 4KVHA 3HZPA 3DGNA 3UL5A 3T8UA 1SIHA 1HKXA 3O8YA 1D6UA 2A15A 2D1WA 1Q814 4FMCA 4KFDA 5AIHA 1WMPA 3GZYB 1W6CA 3LTBA 8CHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y d;  3QK9 A;  2FXT A;  2CW9 A; 
#chains in the Genus database with same CATH topology
 2SBL A;  1EKM A;  2W6J H;  3EX9 A;  3U97 A;  1I2G A;  1LOX A;  4I5Q A;  1B20 A;  1BSE A;  2XFT A;  3X3Y A;  1BUJ A;  1LVN A;  4KFE A;  1RMS A;  3I55 3;  3CCE 3;  1F8N A;  4WHA A;  3NX0 A;  4G1M B;  2P38 A;  3G8Z A;  4HM7 B;  1M1K 4;  1B2M A;  2W0Q A;  1DYU A;  3VSY A;  3VGN A;  2V1L A;  2HMO B;  1BNF A;  3AHW A;  3JVC A;  4N6V 0;  3DMC A;  3GWR A;  3X41 A;  3Q90 A;  2XF3 A;  3FKA A;  2HOH A;  3KKG A;  2E2T A;  4NHF A;  1ZO2 A;  5ELU A;  3BNB A;  1MNL A;  4XDV A;  5KP3 A;  2GEY A;  3WOE B;  5JBS A;  2YX9 A;  4KFF A;  3GZX B;  2H0H A;  3SXX A;  2FXT A;  2J8X B;  1OGZ A;  2FGT A;  3D79 A;  4ORL A;  4WP5 A;  2ZHX B;  4J5G A;  1V74 A;  2WGO A;  1YJ9 3;  4WYK B;  1PFP A;  2W56 A;  1UDI I;  2CFG A;  2QIY A;  3OV4 A;  4HZ9 B;  3DUK A;  5DRE A;  1WQL B;  1BU4 A;  1G96 A;  1W02 A;  2CKF B;  2QEX 3;  1X1Y A;  2K3D A;  5M1A A;  1FGO A;  1I3I A;  4OUQ A;  3DGL A;  5STD A;  3SOY A;  4FCJ A;  1RKY A;  3CME 3;  1RRL A;  1TJD A;  1N9J A;  1DET A;  1RGF A;  1W6Y A;  3QRD A;  1O7P B;  5IEN A;  1S5A A;  1FZU A;  1UCJ A;  2P0M A;  2MC8 A;  5G2G A;  3NHX A;  4HM3 B;  3B4O A;  3IJE B;  2RFR A;  1BRI A;  1IVU A;  3D5I A;  3EBT A;  1OHP A;  3F8H A;  2K0M A;  3OX9 A;  5D81 A;  4R80 A;  5AYR B;  3KCH A;  4MJD A;  5LC6 A;  1NJI 4;  2GU3 A;  4GB5 A;  4GHO A;  3EQQ B;  1B21 A;  3ER7 A;  1OAC A;  4R9K A;  5FGO A;  5TGN A;  2MF7 A;  1T3B A;  1T5Y A;  3JUP A;  4Q53 A;  1VQN 3;  3H51 A;  1Q40 B;  4CJN A;  1IQY A;  1NU3 A;  4HJL B;  5HGR A;  3ZFZ A;  1RLS A;  4ZM8 A;  1BNG A;  3IMA B;  3K5T A;  3CXC 2;  3PZW A;  2L4V A;  4MMX B;  3CCU 3;  1TFO A;  2LYX A;  4OVM A;  1W4N A;  4AEQ A;  1FYS A;  2PNC A;  2E2V A;  1BNJ A;  1KQS 2;  1X1U A;  3MPH A;  1V58 A;  1IT7 A;  2Y74 A;  3ALA A;  1TTO A;  1BNS A;  3LTA A;  3B4P A;  5IG3 A;  2GEX A;  1TIJ A;  1ULJ B;  1NNV A;  3WHO A;  2F99 A;  3E99 A;  1QAL A;  3IPT A;  5CF1 A;  5IER A;  1ROA A;  5D82 A;  3X3Z A;  1O7H B;  2P09 A;  4BU4 A;  2IY2 A;  2KF5 A;  3DGM A;  1CH0 A;  1N8R 4;  1BSD A;  1V57 A;  2AAE A;  1A2V A;  1IT8 A;  1OF5 B;  1N8Q A;  3J7Y d;  1JZO A;  4XDW A;  3CCV 3;  3K7C A;  3KN4 A;  1O7G B;  3EC9 A;  1OH0 A;  1QAF A;  2GU1 A;  3KSP A;  1GOU A;  5IEP A;  3JUQ A;  1STF I;  3MYT A;  1VQ4 3;  2SAR A;  3S29 A;  1NB5 I;  1QVF 2;  1UW1 A;  3LZA A;  1RGE A;  4HM6 B;  3MKI A;  4OK0 A;  2WOF A;  3AMO A;  4CCV A;  3S27 A;  4NRE A;  1LNI A;  3G71 3;  1UI8 A;  2R4I A;  3SYU A;  1RN4 A;  1MWT A;  5IG4 A;  4N6T A;  2CFL A;  8RNT A;  3N8B A;  2UX0 A;  1B27 A;  3ECF A;  3WOD G;  3ZG5 A;  1BGS A;  1RGH A;  2IYJ A;  4NPB A;  4RNY A;  4ILF A;  3F14 A;  3GRD A;  4L8P A;  2YFL B;  2F5M A;  4EXR A;  3G16 A;  1BSA A;  1KWI A;  1YGW A;  2CWV A;  3KE7 A;  5A0O B;  1Q82 4;  1SQW A;  4BL3 A;  1W5Z A;  2ML5 A;  3OWY A;  4R4K A;  4DKI A;  1BRN L;  4MEI A;  3GSP A;  2CFW A;  1B2S A;  2GBW B;  1W7C A;  3HIG A;  4BTX A;  3BNE A;  3D9R A;  1I2F A;  5EVH A;  3X3X A;  1X1X A;  5AEW B;  4XB5 A;  2F5W A;  1IDP A;  1KSI A;  1RGL A;  2RGQ A;  1W00 A;  3CC2 3;  2F98 A;  1CYU A;  1FW7 A;  4EW5 A;  4O2H A;  2Z7A A;  1EUI C;  3BLZ A;  7RNT A;  3V99 A;  2Y73 A;  2HML B;  1PU4 A;  3CPW 2;  1MGW A;  1UUW B;  1YVS A;  1AVL A;  1JBT A;  2OQE A;  1MOL A;  4IIA A;  4O8S A;  3BND A;  3RGR A;  1ISK A;  3PGB A;  4L8O A;  4FCZ A;  3NV0 B;  1HU9 A;  3K0Z A;  5CXO A;  2XH9 A;  3Q1C A;  3PCR A;  1BNR A;  4WYK A;  4XBY A;  1RCL A;  1JV2 B;  3NM2 A;  3RDE A;  1BAO A;  3RNT A;  1RGC A;  2XFS A;  1M9G A;  1VQK 3;  1OPY A;  1WNH A;  1RNT A;  3LXU X;  3LTD A;  3EBY A;  3N54 B;  4EYC A;  4BTW A;  1VQP 3;  1BIR A;  3DH2 A;  3MWZ A;  3NQZ A;  3ROB A;  1UI7 A;  2K54 A;  1LOW A;  2OOV C;  1W6G A;  5GSP A;  9RNT A;  1YHQ 3;  1LNH A;  3STD A;  3RGA A;  2GBX B;  2C4B A;  2WGQ A;  3KZT A;  3T8N A;  3UNL A;  3AGN A;  3CMA 3;  1EQK A;  1UGH I;  1R4C A;  1T2I A;  1GOY A;  1HYF A;  3A5E A;  3S67 A;  5AIG A;  1Q40 A;  3BNC A;  4HM4 B;  1FA3 A;  4CPK A;  3U1W A;  1EA2 A;  3CCL 3;  4GL6 A;  5AYS C;  5IG5 A;  4FMB A;  5IW9 A;  1YIT 3;  1JB4 A;  2CG0 A;  3EE1 A;  4PEJ A;  1MWR A;  2B1X B;  3ZG0 A;  2YFI B;  5IG0 A;  3CC4 3;  3G6E 3;  1IQX A;  1RN1 A;  3WDG B;  3HK4 A;  1UUV B;  4HKV B;  2XGN A;  1IV9 A;  2KRT A;  1BRG A;  3PS8 A;  1DVC A;  3CU3 A;  1LQG C;  2CFD A;  1A2K A;  1GYB A;  2OTL 3;  5AEU B;  1OF5 A;  1N5H A;  1BOX A;  1ZX2 A;  1LRA A;  1ZS7 A;  2CIU A;  3OWS A;  4K61 A;  1IVV A;  3AGO A;  3CCS 3;  1U5O A;  3BB9 A;  4JF8 A;  1L5G B;  4H3U A;  1YJN 3;  2F4Y A;  2KCD A;  3SLU A;  1IVX A;  3LTC A;  2XRX B;  4XBT A;  5M18 A;  1GS3 A;  5JPU A;  1FGQ A;  2W03 A;  1RGG A;  1B2X A;  3LOY A;  1UCL A;  3FSD A;  3JUN A;  3G0K A;  1YJW 3;  2OWP A;  5IF6 A;  2BU4 A;  4N6U A;  3WMD A;  2QGU A;  4N6M A;  2IUJ A;  1KC8 4;  3NBJ A;  3DZL A;  1JRQ A;  1O7N B;  4HBR A;  2Z77 A;  3F7S A;  1BRJ A;  4IT7 A;  3F9S A;  4HZB B;  3FF0 A;  3CCM 3;  1W2B 2;  3S28 A;  1GD4 A;  1Q42 A;  1SPU A;  1BRK A;  2CK3 H;  2CW9 A;  3AHS A;  3V98 A;  4AKY A;  1VQ5 3;  2KF4 A;  3MHE A;  1VQ6 3;  2RSX A;  4EV2 A;  3BU4 A;  1MWU A;  3CCR 3;  3D4A A;  1VQ7 3;  2XSH B;  1PY3 A;  1JNQ A;  4O3V A;  4BTY A;  1RHL A;  3G4S 3;  2CFK A;  1KD1 4;  4EV5 A;  1C7H A;  1VQ9 3;  1RGK A;  4N6N B;  4HVN A;  3WA3 A;  5G1K A;  6RNT A;  5BVB A;  1RJO A;  4LGQ A;  2CH9 A;  1QAK A;  1NDO B;  1PYL A;  1FUW A;  1QJG A;  2OCT A;  1VQQ A;  4X2H A;  1K9M 4;  4AKZ A;  1AQZ A;  3FCS B;  6GSP A;  1B2U A;  4KT3 B;  3DXO A;  1TUH A;  1WMN A;  3WA2 X;  3URP A;  1WMO A;  3EJV A;  2BMR B;  5EEO A;  3EB8 A;  1EG9 B;  2ZL8 A;  3NBR A;  1VQL 3;  3CNM A;  1JBS A;  1MGR A;  2ZA4 A;  1Z1S A;  1BSC A;  3HOH A;  1ULI B;  3MG3 A;  1UCK A;  3PXM A;  3UL6 A;  1TFK A;  3NXJ A;  1T2H A;  2BT3 A;  1BVI A;  1I2E A;  3NM7 A;  1BRS A;  3L0R A;  4GSP A;  4J9A A;  3NV0 A;  1ASK A;  1CQS A;  1GOV A;  5DRV A;  1JKG B;  2W2C A;  4LZI A;  3FF2 A;  3GZB A;  1BUQ A;  1US1 A;  1B2Z A;  2XGL A;  2CC3 A;  2BNG A;  3M8C A;  3WOF B;  4MMZ B;  4N6L A;  2IA7 A;  2Q07 A;  4QWT A;  3MG1 A;  1K73 4;  1GY7 A;  1SII A;  2RBI A;  4FMA A;  3VF1 A;  1Q7H A;  3CCJ 3;  1CEW I;  3PCS A;  1FUS A;  1A67 A;  3K63 A;  1LQM B;  4H61 A;  3MSO A;  1IVW A;  3CPO A;  3TDG A;  1VZZ A;  2IUK A;  2KXG A;  1AR0 A;  1YVB I;  2IMJ A;  1K28 A;  1E3R A;  3HI7 A;  4TX4 A;  3SOA A;  4KZ1 A;  3LYG A;  5I97 A;  4HM0 B;  1O7M B;  1GSP A;  5CF2 A;  1IK3 A;  4RZM A;  1BSB A;  3FG3 A;  5M19 A;  3HX8 A;  3OWU A;  1JN5 B;  2GSP A;  5KP1 A;  3UB1 A;  5RNT A;  1M90 4;  3F7X A;  3FGY A;  2HMM B;  3GAX A;  1BNE A;  2FNQ A;  4J8T A;  4N6O B;  5AII A;  3OXA A;  3FG1 A;  5D83 A;  1UUG B;  2XSO B;  1IU7 A;  1LOY A;  5ELJ A;  2O3O A;  2ZDJ A;  4N3V A;  4EC6 A;  1VQM 3;  5FW5 A;  1RNB A;  7GSP A;  1DMN A;  3I56 3;  5AI1 A;  1AVK A;  2LQV A;  1TP6 A;  3MG2 A;  1SJW A;  3FZW A;  3PYJ A;  1U8C B;  1C54 A;  1UCI A;  1A90 A;  1GMR A;  1O7W B;  1EEJ A;  4RNZ A;  1I0X A;  7STD A;  3X42 A;  3BIR A;  1DMQ A;  1FGR A;  1GY5 A;  3LT8 A;  3EF8 A;  3A76 A;  2B24 B;  1TRP A;  2UGI A;  1YNV X;  2WOH A;  2CWT A;  3FH1 A;  5CLK A;  4LMI A;  4LSO A;  1VQ8 3;  1JB5 A;  2OOV A;  2CG1 A;  2W04 A;  3D5G A;  3NBB A;  5CK6 A;  2Z76 A;  3CNX A;  3DY5 A;  3X40 A;  1G0T A;  1X1W A;  4I4K A;  2QA4 3;  3OW2 2;  1OHS A;  1CYV A;  3D3L A;  1GMQ A;  2CX1 A;  2CWU A;  4LEH A;  4CDL A;  1QMA A;  1N5P A;  3QK9 A;  1YI2 3;  1HZ1 A;  3EN8 A;  1YGE A;  2F86 B;  3FG4 A;  2Z6B A;  1IQ8 A;  3SX1 A;  2YFJ B;  3DM8 A;  3NUV A;  1GY6 A;  5BIR A;  4FMD A;  1WTH A;  1JZD A;  1OCV A;  2BMQ B;  3LT9 A;  2KF6 A;  2PZV A;  2JQ5 A;  5JPP A;  1D6Y A;  4K1U A;  1Q86 4;  1N9E A;  3CC7 3;  1I70 A;  2STD A;  3JUO A;  4X2O A;  4XM4 A;  5AIF A;  3CCQ 3;  1W01 A;  1DE3 A;  4K1V A;  2W9Q A;  2UUG C;  2W9P A;  4HM5 B;  1GD3 A;  2RCD A;  3DGO A;  5HOH A;  1NWW A;  1OUN A;  2HMN B;  1RN7 A;  1OGX A;  1FGM A;  1STD A;  2BMO B;  2W56 B;  3GZR A;  2CX0 A;  4K90 B;  3F8X A;  3LH4 A;  5LC7 A;  3FLJ A;  4HM2 B;  2HMK B;  1BAN A;  4HYZ A;  1IYY A;  3KSE D;  2ML6 A;  2BIR A;  4FCM A;  1G02 A;  3T0U A;  5IEO A;  1LOV A;  4O02 B;  6STD A;  2XR8 B;  1FUT A;  2CHC A;  1QVG 2;  4WFO A;  1JKG A;  4RNT A;  2INX A;  5BXQ A;  3B7C A;  2C11 A;  2KF3 A;  2GXF A;  2L1S A;  3LML A;  4JRF A;  4U13 A;  1IV7 A;  1OHO A;  1JBR A;  1BNI A;  3Q2P A;  3SVA A;  1VQO 3;  3SED A;  3DGY A;  4EBG A;  1Q9E A;  4HOH A;  4XBX A;  4R9L A;  3V92 A;  4R1K A;  1LXE A;  3NQY A;  1W2Z A;  4HM1 B;  4STD A;  1Y4K A;  2H0I A;  1YIJ 3;  2OTJ 3;  3B8L A;  1DVD A;  4IPB A;  1D6Z A;  1RRH A;  1E97 A;  2P0X A;  4RBN A;  3S5C A;  4WWU C;  1RSN A;  3JUM A;  2P05 A;  3WR2 A;  2M7O A;  1TU5 A;  4HM8 B;  1E3V A;  1ROV A;  2KAA A;  3HII A;  1K41 A;  2JDI H;  3F40 A;  3Q3F A;  2BHM A;  1BRH A;  1SAR A;  2HMJ B;  1ZGX A;  3EN1 B;  1JJ2 2;  5EQL A;  4L7K A;  3CD6 3;  3N9H A;  4BIR A;  1AV4 A;  1JN5 A;  1I0V A;  4J5K A;  1RCK A;  2O9U X;  1K8A 4;  1DMM A;  1RDS A;  1J2B A;  1M1X B;  2AAD A;  3I0Y A;  1NB3 I;  3H3H A;  2OQE C;  2E2U A;  3EHC A;  5G1L A;  5BU4 A;  4LYL B;  1A2P A;  1RTU A;  4BL2 A;  3UJM A;  3K9M C;  1B3S A;  2XEP A;  1NO3 A;  3KFQ C;  1FGT A;  2D42 A;  3KII A;  1Q7Y 4;  1AY7 A;  2I9W A;  2BO9 B;  4MMY B;  1RGA A;  5KP4 A;  1TRQ A;  3AMO B;  1S72 3;  1UGI A;  2WO0 A;  1I3F A;  1GMP A;  4HAA A;  1I8V A;  2C10 A;  4FR9 A;  2R41 A;  1JB2 A;  4KVH A;  3HZP A;  3DGN A;  3UL5 A;  3T8U A;  1SIH A;  1HKX A;  1MWS A;  3O8Y A;  1D6U A;  2A15 A;  2D1W A;  2H0G A;  1Q81 4;  4FMC A;  2F56 A;  4KFD A;  2RNT A;  5AIH A;  1WMP A;  1R4Y A;  3GZY B;  1W6C A;  3LTB A;  8CHO A; 
#chains in the Genus database with same CATH homology
 2SBL A;  1EKM A;  2W6J H;  3EX9 A;  3U97 A;  1LOX A;  2XFT A;  3X3Y A;  1LVN A;  4KFE A;  3I55 3;  3CCE 3;  1F8N A;  4WHA A;  3NX0 A;  4G1M B;  2P38 A;  3G8Z A;  4HM7 B;  1M1K 4;  2W0Q A;  1DYU A;  3VSY A;  3VGN A;  2V1L A;  2HMO B;  3X41 A;  4N6V 0;  3JVC A;  3DMC A;  3GWR A;  3Q90 A;  2XF3 A;  3FKA A;  3KKG A;  2E2T A;  4NHF A;  1ZO2 A;  5ELU A;  3BNB A;  1MNL A;  4XDV A;  5KP3 A;  2GEY A;  3WOE B;  5JBS A;  2YX9 A;  4KFF A;  3GZX B;  3SXX A;  2FXT A;  1OGZ A;  2FGT A;  4ORL A;  4WP5 A;  1V74 A;  2WGO A;  1YJ9 3;  4WYK B;  1PFP A;  2W56 A;  2CFG A;  2QIY A;  3OV4 A;  4HZ9 B;  3DUK A;  5DRE A;  1WQL B;  1G96 A;  1W02 A;  2CKF B;  2QEX 3;  5STD A;  1FGO A;  4OUQ A;  3SOY A;  3DGL A;  4FCJ A;  1RKY A;  3CME 3;  1RRL A;  1N9J A;  1W6Y A;  3QRD A;  1O7P B;  5IEN A;  1S5A A;  2P0M A;  2MC8 A;  5G2G A;  3NHX A;  4HM3 B;  3B4O A;  3IJE B;  2RFR A;  1IVU A;  5D81 A;  3EBT A;  1OHP A;  3F8H A;  2K0M A;  3OX9 A;  5AYR B;  4R80 A;  4MJD A;  5LC6 A;  1NJI 4;  2GU3 A;  4GB5 A;  3EQQ B;  3ER7 A;  5FGO A;  1OAC A;  4R9K A;  5TGN A;  2MF7 A;  4Q53 A;  1T5Y A;  3JUP A;  1VQN 3;  3H51 A;  1Q40 B;  1IQY A;  1NU3 A;  4HJL B;  5HGR A;  4ZM8 A;  3IMA B;  3K5T A;  3CXC 2;  3PZW A;  2L4V A;  4MMX B;  3CCU 3;  1TFO A;  2LYX A;  4OVM A;  1W4N A;  4AEQ A;  2PNC A;  2E2V A;  1KQS 2;  3MPH A;  1IT7 A;  2Y74 A;  3ALA A;  3LTA A;  3B4P A;  5IG3 A;  2GEX A;  1TIJ A;  1ULJ B;  2F99 A;  3E99 A;  1QAL A;  3IPT A;  5CF1 A;  5IER A;  1ROA A;  5D82 A;  3X3Z A;  1O7H B;  2P09 A;  3DGM A;  1N8R 4;  1A2V A;  3J7Y d;  1IT8 A;  1OF5 B;  1N8Q A;  4XDW A;  3CCV 3;  3K7C A;  3KN4 A;  1O7G B;  3EC9 A;  1OH0 A;  1QAF A;  2GU1 A;  3KSP A;  5IEP A;  3JUQ A;  1STF I;  3MYT A;  1VQ4 3;  3S29 A;  1NB5 I;  1QVF 2;  1UW1 A;  3LZA A;  4HM6 B;  4OK0 A;  3MKI A;  2WOF A;  3AMO A;  4CCV A;  3S27 A;  4NRE A;  3G71 3;  1UI8 A;  2R4I A;  5IG4 A;  4N6T A;  2CFL A;  3N8B A;  2UX0 A;  3ECF A;  3WOD G;  4RNY A;  3F14 A;  3GRD A;  4L8P A;  2YFL B;  4EXR A;  3G16 A;  2CWV A;  1KWI A;  3KE7 A;  5A0O B;  1Q82 4;  1SQW A;  1W5Z A;  2ML5 A;  3OWY A;  4R4K A;  4MEI A;  2CFW A;  2GBW B;  1W7C A;  3HIG A;  4BTX A;  3BNE A;  3D9R A;  5EVH A;  3X3X A;  5AEW B;  4XB5 A;  1IDP A;  1KSI A;  2RGQ A;  1W00 A;  3CC2 3;  2F98 A;  1CYU A;  4O2H A;  2Z7A A;  3BLZ A;  3CPW 2;  3V99 A;  2Y73 A;  2HML B;  1UUW B;  1AVL A;  2OQE A;  1MOL A;  4IIA A;  4O8S A;  3BND A;  3RGR A;  1ISK A;  3PGB A;  4L8O A;  4FCZ A;  3NV0 B;  1HU9 A;  3K0Z A;  5CXO A;  2XH9 A;  3Q1C A;  3PCR A;  4WYK A;  4XBY A;  1JV2 B;  3NM2 A;  3RDE A;  2XFS A;  1M9G A;  1VQK 3;  1OPY A;  1WNH A;  3LXU X;  3LTD A;  3EBY A;  3N54 B;  4EYC A;  4BTW A;  1VQP 3;  3NQZ A;  3MWZ A;  3ROB A;  1UI7 A;  2K54 A;  2OOV C;  1W6G A;  1YHQ 3;  1LNH A;  3STD A;  3RGA A;  2GBX B;  2WGQ A;  3KZT A;  3T8N A;  3UNL A;  3CMA 3;  1EQK A;  1R4C A;  3S67 A;  5AIG A;  1Q40 A;  3BNC A;  4HM4 B;  1FA3 A;  3U1W A;  1EA2 A;  3CCL 3;  4GL6 A;  5AYS C;  5IG5 A;  4FMB A;  5IW9 A;  1YIT 3;  1JB4 A;  2CG0 A;  3EE1 A;  4PEJ A;  2B1X B;  2YFI B;  5IG0 A;  3CC4 3;  3G6E 3;  1IQX A;  3WDG B;  3HK4 A;  1UUV B;  4HKV B;  2XGN A;  1IV9 A;  2KRT A;  3PS8 A;  1DVC A;  3CU3 A;  2CFD A;  1A2K A;  1GYB A;  2OTL 3;  5AEU B;  1OF5 A;  1N5H A;  3OWS A;  1ZX2 A;  2CIU A;  1PU4 A;  3CCS 3;  4K61 A;  1KD1 4;  1IVV A;  1U5O A;  3BB9 A;  4JF8 A;  1L5G B;  4H3U A;  1YJN 3;  2KCD A;  3SLU A;  1IVX A;  3LTC A;  2XRX B;  4XBT A;  1GS3 A;  5JPU A;  1FGQ A;  2W03 A;  3LOY A;  3FSD A;  3JUN A;  3G0K A;  1YJW 3;  2OWP A;  5IF6 A;  4N6U A;  3WMD A;  2QGU A;  4N6M A;  2IUJ A;  1KC8 4;  3NBJ A;  3DZL A;  1JRQ A;  1O7N B;  4HBR A;  2Z77 A;  3F7S A;  4IT7 A;  3F9S A;  4HZB B;  3FF0 A;  3CCM 3;  1W2B 2;  3S28 A;  1GD4 A;  1Q42 A;  1SPU A;  2CK3 H;  2CW9 A;  3V98 A;  4AKY A;  1VQ5 3;  1VQ6 3;  3MHE A;  2RSX A;  4EV2 A;  3CCR 3;  1VQ7 3;  2XSH B;  1JNQ A;  4O3V A;  4BTY A;  3G4S 3;  2CFK A;  4EV5 A;  1C7H A;  1VQ9 3;  4N6N B;  4HVN A;  3WA3 A;  5BVB A;  1RJO A;  4LGQ A;  2CH9 A;  1QAK A;  1NDO B;  1FUW A;  1QJG A;  2OCT A;  4X2H A;  1K9M 4;  4AKZ A;  3FCS B;  3DXO A;  1TUH A;  1WMN A;  3WA2 X;  1WMO A;  3EJV A;  2BMR B;  5EEO A;  3EB8 A;  1EG9 B;  2ZL8 A;  3NBR A;  1VQL 3;  3CNM A;  1Z1S A;  3MG3 A;  1ULI B;  3PXM A;  3UL6 A;  1TFK A;  3NXJ A;  2BT3 A;  3NM7 A;  3L0R A;  4J9A A;  3NV0 A;  1ASK A;  1CQS A;  5DRV A;  1JKG B;  2W2C A;  4LZI A;  3FF2 A;  3GZB A;  1BUQ A;  1US1 A;  2XGL A;  2CC3 A;  2BNG A;  3M8C A;  3WOF B;  4MMZ B;  4N6L A;  2IA7 A;  2Q07 A;  4QWT A;  3MG1 A;  1K73 4;  1GY7 A;  1SII A;  4FMA A;  3VF1 A;  3CCJ 3;  1CEW I;  3PCS A;  1A67 A;  3K63 A;  4H61 A;  3MSO A;  1IVW A;  3CPO A;  3TDG A;  1VZZ A;  2IUK A;  2KXG A;  1AR0 A;  1YVB I;  2IMJ A;  1K28 A;  1E3R A;  3HI7 A;  4TX4 A;  3SOA A;  4KZ1 A;  3LYG A;  5I97 A;  4HM0 B;  1O7M B;  5CF2 A;  1IK3 A;  4RZM A;  3FG3 A;  3HX8 A;  3OWU A;  1JN5 B;  5KP1 A;  3UB1 A;  1M90 4;  3F7X A;  3FGY A;  2HMM B;  3GAX A;  2FNQ A;  4J8T A;  4N6O B;  5AII A;  3OXA A;  3FG1 A;  5D83 A;  2XSO B;  1IU7 A;  5ELJ A;  2O3O A;  2ZDJ A;  4N3V A;  4EC6 A;  1VQM 3;  5FW5 A;  1DMN A;  3I56 3;  5AI1 A;  1AVK A;  2LQV A;  1TP6 A;  3MG2 A;  1SJW A;  3FZW A;  3PYJ A;  1U8C B;  1A90 A;  1O7W B;  7STD A;  4RNZ A;  3X42 A;  1DMQ A;  1FGR A;  1GY5 A;  3LT8 A;  3EF8 A;  3A76 A;  2B24 B;  2WOH A;  2CWT A;  3FH1 A;  5CLK A;  4LMI A;  4LSO A;  1VQ8 3;  1JB5 A;  2OOV A;  2CG1 A;  2W04 A;  5CK6 A;  3NBB A;  3X40 A;  2Z76 A;  3CNX A;  3DY5 A;  2QA4 3;  3OW2 2;  4I4K A;  1OHS A;  1CYV A;  3D3L A;  2CWU A;  4LEH A;  4CDL A;  1QMA A;  1N5P A;  3QK9 A;  1YI2 3;  3EN8 A;  3FG4 A;  1YGE A;  2F86 B;  2Z6B A;  1IQ8 A;  3SX1 A;  2YFJ B;  3DM8 A;  3NUV A;  1GY6 A;  4FMD A;  1WTH A;  1OCV A;  2BMQ B;  3LT9 A;  2PZV A;  2JQ5 A;  5JPP A;  1D6Y A;  4K1U A;  1Q86 4;  1N9E A;  3CC7 3;  4X2O A;  2STD A;  3JUO A;  4XM4 A;  5AIF A;  3CCQ 3;  1W01 A;  4K1V A;  2W9Q A;  2W9P A;  4HM5 B;  1GD3 A;  2RCD A;  3DGO A;  1NWW A;  1OUN A;  2HMN B;  1RN7 A;  1OGX A;  1FGM A;  1STD A;  2BMO B;  2W56 B;  3GZR A;  4K90 B;  3F8X A;  3LH4 A;  5LC7 A;  3FLJ A;  4HM2 B;  2HMK B;  4HYZ A;  3KSE D;  2ML6 A;  4FCM A;  3T0U A;  5IEO A;  4O02 B;  6STD A;  2XR8 B;  2CHC A;  1QVG 2;  4WFO A;  1JKG A;  2INX A;  5BXQ A;  3B7C A;  2C11 A;  2GXF A;  3LML A;  4JRF A;  4U13 A;  1IV7 A;  1OHO A;  3Q2P A;  3SVA A;  1VQO 3;  3SED A;  4EBG A;  4XBX A;  4R9L A;  3V92 A;  4R1K A;  1LXE A;  3NQY A;  1W2Z A;  4HM1 B;  4STD A;  1Y4K A;  1YIJ 3;  2OTJ 3;  3B8L A;  1DVD A;  4IPB A;  1D6Z A;  1RRH A;  1E97 A;  2P0X A;  4RBN A;  3S5C A;  4WWU C;  3JUM A;  2P05 A;  2M7O A;  1TU5 A;  4HM8 B;  1E3V A;  1ROV A;  3HII A;  1K41 A;  2JDI H;  3F40 A;  2BHM A;  2HMJ B;  3EN1 B;  1JJ2 2;  5EQL A;  4L7K A;  3CD6 3;  3N9H A;  1AV4 A;  1JN5 A;  2O9U X;  1K8A 4;  1DMM A;  1J2B A;  1M1X B;  3I0Y A;  1NB3 I;  3H3H A;  2OQE C;  2E2U A;  3EHC A;  3UJM A;  3K9M C;  2XEP A;  1NO3 A;  3KFQ C;  1FGT A;  2D42 A;  3KII A;  1Q7Y 4;  5KP4 A;  2I9W A;  2BO9 B;  4MMY B;  3AMO B;  1S72 3;  2WO0 A;  2C10 A;  4FR9 A;  1JB2 A;  4KVH A;  3HZP A;  3DGN A;  3UL5 A;  3T8U A;  1SIH A;  1HKX A;  3O8Y A;  1D6U A;  2A15 A;  2D1W A;  1Q81 4;  4FMC A;  4KFD A;  5AIH A;  1WMP A;  3GZY B;  1W6C A;  3LTB A;  8CHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...