3J7Yd

Structure of the large ribosomal subunit from human mitochondria
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
162
Chain Sequence
ASQVSIRRIKDYDANFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSHVVQVRCNVYGQITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLPYGSWRMHTKIVPPWAPPKQPILKTVMIPGPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 26
structure length 162
sequence length 171
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF04280 Tim44 Tim44-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.240 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3j7yd00
3QK9A 2FXTA 2CW9A 3J7Yd
chains in the Genus database with same CATH superfamily
1CEWI 2HMLB 1UI8A 2F98A 2RSXA 1Q9EA 1W7CA 2OWPA 1SARA 1RN7A 2HMKB 1RN1A 2WGOA 4FMCA 2GEXA 4AEQA 3PCSA 4RZMA 2OTJ3 1LOWA 3SXXA 1Q7HA 3F7XA 1I2FA 1TTOA 3G4S3 1OGXA 1A2VA 1JB2A 1I3IA 1JBSA 2OQEC 2ZL8A 2E2VA 1AQZA 4IPBA 1CYUA 4K61A 5JBSA 1QVG2 1ZO2A 1W2ZA 2M7OA 4H61A 1KSIA 3DGLA 4STDA 2W56A 1RNTA 1N5PA 1G02A 4GSPA 2CIUA 4GB5A 4J9AA 1RCLA 2RBIA 1O7PB 2YFIB 1NB3I 1Z1SA 1FA3A 1Q40A 1RKYA 3WR2A 3EN8A 3DM8A 3I553 2IMJA 3LT9A 3S27A 4MMXB 1FW7A 3D5GA 3D5IA 1S5AA 1BGSA 3F8XA 3T8UA 3WA3A 4HM0B 1BU4A 3PZWA 2Q07A 5IG0A 1TJDA 2GSPA 1BOXA 2H0IA 2UGIA 2CG0A 3EBYA 2BHMA 3O8YA 3NBBA 1AV4A 1CQSA 2MC8A 1KD14 3MKIA 1YI23 1BRJA 1BUJA 3Q1CA 1I0VA 3ZG0A 3NHXA 1GMQA 1B3SA 3BNDA 2P05A 3RNTA 1SJWA 1ZX2A 1AVKA 4IIAA 4KFDA 1OPYA 4HZ9B 1RGCA 3VF1A 1GD4A 2A15A 1Q824 3D9RA 1FUWA 1HKXA 4HAAA 1KC84 1B21A 3MYTA 1BVIA 3KCHA 1YIT3 1RGAA 1ULJB 4RNTA 1I8VA 2WGQA 5HGRA 4WYKA 3PS8A 1B2XA 1JNQA 1AY7A 3G16A 5AEUB 3NBJA 5IG3A 1IVUA 3F14A 4HJLB 2V1LA 3EHCA 1BSDA 4HM3B 5IEOA 1QMAA 1MWTA 1TRQA 1US1A 2WO0A 4ORLA 3S28A 3RGAA 2BU4A 2INXA 4K1VA 3KZTA 4R4KA 3WDGB 2FNQA 2MF7A 3LXUX 2WOHA 5CXOA 4BL3A 2E2UA 1BIRA 3AMOA 1GY6A 3DH2A 1BSBA 3OWSA 4H3UA 2OQEA 1X1UA 1TU5A 1S723 5JPPA 1BNFA 2GBWB 5AI1A 6STDA 1EEJA 4DKIA 2FGTA 3SX1A 3HK4A 1E3RA 1I2EA 4MMZB 2CFLA 4JF8A 2CFWA 1BNJA 3WA2X 1M904 5LC6A 4RNYA 5DRVA 1BRGA 4O3VA 4EV5A 5CLKA 5M1AA 1YJ93 1JKGB 1JRQA 3CCS3 1EKMA 4XBTA 3PXMA 3EQQB 3HIGA 3URPA 1IT8A 1W4NA 2E2TA 2KXGA 3DMCA 2YX9A 3GAXA 4XBYA 3RGRA 1JBRA 1NB5I 1FGRA 1VQ43 4HM6B 3J7Yd 5AIFA 3T0UA 5IW9A 1WMNA 2GBXB 3EBTA 4LGQA 1IQYA 1W6GA 2P38A 1IQ8A 1YGWA 1IVVA 4EYCA 3G713 3LTDA 1N9JA 5IEPA 4FCJA 1IYYA 1LVNA 4X2OA 1BSEA 3D3LA 3NV0B 4QWTA 3NQZA 9RNTA 1VQ93 4J8TA 2I9WA 1MWSA 3CCE3 5DREA 2PZVA 5I97A 2W56B 1JV2B 1ROAA 2F4YA 2P09A 3KIIA 3K7CA 4J5KA 4OUQA 1FGTA 3HIIA 3CCL3 3OWUA 1RJOA 1ULIB 1RTUA 1Q40B 1O7NB 4OK0A 4N6NB 2XGLA 4BIRA 3AGNA 1UCJA 1ZS7A 4I5QA 1IK3A 1BRNL 1NU3A 1GMPA 3FF0A 3G6E3 1DE3A 3FG4A 1UCLA 1UUGB 3X41A 3F7SA 1R4CA 3PCRA 3FKAA 3N8BA 2CFKA 4JRFA 3FSDA 3X3YA 3LTBA 3X40A 2W04A 4HM8B 1BSAA 2QA43 3ER7A 1GMRA 1DVCA 2JDIH 4HM7B 1I0XA 1PYLA 4EBGA 3S29A 1G96A 2J8XB 3K5TA 3LOYA 3JVCA 1K41A 3K63A 1JN5A 2P0XA 2IA7A 1T2HA 7STDA 1T3BA 4N6LA 2BO9B 5CF1A 3HOHA 1J2BA 1B2SA 5CK6A 6RNTA 1V58A 1GY7A 3IMAB 1X1XA 1TP6A 1ZGXA 3HX8A 1RNBA 1DMQA 1VQN3 4HOHA 2XF3A 3CCJ3 3NUVA 4WYKB 4O02B 3WMDA 5KP3A 3MG3A 1TFOA 5BXQA 2KF4A 1BAOA 1FGOA 2QIYA 1BNIA 2JQ5A 2W03A 4EC6A 3MPHA 2Z6BA 2BIRA 3H3HA 3CCQ3 3EJVA 1LOXA 3CNXA 5KP4A 5EVHA 1OUNA 2CFGA 1BNSA 2H0GA 3AMOB 1AVLA 2C11A 1A2KA 2KF5A 4RNZA 5D81A 1D6ZA 4O8SA 1TIJA 1TRPA 4BTWA 3PYJA 1VQP3 2BMOB 3E99A 1JJ22 2OTL3 1TFKA 1WMPA 3B8LA 1V74A 2D42A 4Q53A 1K9M4 3GSPA 1RRHA 1ASKA 1VQQA 3LT8A 3L0RA 1ISKA 1W5ZA 1RN4A 3B4OA 2HMJB 4FMBA 4OVMA 1FGMA 1IVWA 1A90A 3X3XA 2LYXA 4I4KA 3CPW2 4WP5A 2BNGA 2CFDA 2CWUA 3VSYA 1L5GB 3EX9A 3KSPA 3DXOA 2F99A 1UUWB 2XR8B 1LQGC 2F5WA 7GSPA 2O9UX 3GZBA 6GSPA 4BU4A 1OACA 3EC9A 1GYBA 2SARA 4R80A 5AIGA 3LMLA 3JUNA 2IY2A 1W02A 5D83A 5AYRB 4TX4A 1EQKA 2XSOB 1BSCA 3NM7A 4HM1B 4U13A 1M1XB 5BVBA 3EE1A 4MEIA 1QALA 3WODG 3EF8A 3ZFZA 1BNGA 3D79A 4L8PA 3UJMA 1N5HA 1WMOA 4R9LA 3S5CA 1RGKA 4N6MA 1UW1A 1ROVA 1LOVA 4L7KA 3A76A 4FMAA 3LTAA 2C10A 3B7CA 4LMIA 1HZ1A 4HKVB 4AKYA 3H51A 1UI7A 3T8NA 3CC73 2Z7AA 3D4AA 1YVSA 2AADA 1VQ83 3UL5A 2W0QA 1Q814 3DGYA 3Q2PA 1IV7A 1BRSA 1VQO3 1I70A 1W6CA 3FZWA 3BNBA 4FCZA 4N6UA 4LEHA 1MOLA 5BIRA 1BRKA 3CME3 4BL2A 2XSHB 2FXTA 3X42A 4GL6A 4CPKA 5EEOA 2CX0A 1CH0A 3BIRA 3WOEB 2L4VA 1JN5B 3CPOA 3NXJA 1VQ53 3KFQC 1VQK3 4BTYA 1A2PA 4K90B 5AIIA 3ZG5A 1SPUA 3DGNA 2GU1A 1RGEA 1TUHA 4PEJA 1IQXA 3NBRA 3GWRA 1IT7A 3TDGA 1HYFA 2CX1A 2W2CA 1MGWA 2UX0A 3KE7A 1UUVB 1WNHA 2HMNB 1KWIA 2UUGC 5IERA 3CU3A 2KF6A 3AGOA 8RNTA 1W2B2 3UB1A 3N9HA 3LZAA 1HU9A 2GEYA 4CJNA 1O7GB 1OH0A 4XM4A 5BU4A 1Y4KA 1WQLB 4N6OB 4KVHA 1RGGA 5IF6A 1LQMB 2XEPA 4HZBB 4BTXA 4HM5B 1NNVA 3MSOA 1N8QA 2R41A 1DMMA 1GD3A 2CG1A 1O7HB 5TGNA 5ELUA 1QVF2 3LYGA 1DETA 2CWVA 1PU4A 5G2GA 4EW5A 5A0OB 3SLUA 1W01A 1FZUA 1X1YA 3NX0A 1PFPA 4NHFA 2H0HA 1IVXA 4FMDA 1NWWA 1V57A 3IJEB 1LXEA 3KSED 2B1XB 1VQ73 4G1MB 1B2UA 1OHOA 5D82A 8CHOA 1PY3A 1QAFA 1YJW3 1UGIA 1DMNA 1BNRA 2GU3A 4ILFA 4NREA 2IUKA 4CDLA 2Z76A 3CCR3 1M9GA 4HVNA 1GOUA 3LTCA 1T5YA 2W9QA 1STDA 1VQ63 1NDOB 3MWZA 1BANA 4X2HA 3U1WA 2F5MA 2CW9A 1OHPA 1Q42A 1BRIA 4N6V0 1E97A 2XH9A 3JUPA 3QRDA 4LZIA 5KP1A 3CCU3 1Q7Y4 3SOYA 2B24B 4KZ1A 3FCSB 2WOFA 1AR0A 3F40A 2OOVC 3QK9A 4N6TA 1T2IA 3EN1B 5LC7A 1DVDA 1X1WA 3UNLA 3V92A 3FG1A 1YVBI 1IU7A 1RLSA 1YJN3 1FUTA 1IV9A 4HBRA 1Q864 1MGRA 2O3OA 1B27A 4WWUC 1QJGA 2XRXB 3NV0A 3U97A 5FW5A 1VQM3 2OCTA 2ML6A 3OXAA 1UCKA 3S67A 3V98A 1OCVA 3Q90A 1K28A 2KF3A 2RGQA 4R9KA 1OF5A 5AEWB 2IUJA 1BNEA 5IENA 1K734 3DUKA 5AYSC 4LYLB 4ZM8A 4HYZA 4MMYB 3RDEA 2AAEA 3FF2A 5G1KA 4WHAA 1MWUA 3CMA3 1SQWA 1NJI4 2PNCA 2Y73A 1WTHA 2BT3A 1YHQ3 2ZDJA 2SBLA 1IDPA 2CC3A 3N54B 1N9EA 3FH1A 3HI7A 5ELJA 2QEX3 4IT7A 1VZZA 3V99A 1OHSA 3JUMA 3BU4A 3CXC2 2W6JH 2RCDA 4LSOA 1EUIC 5FGOA 4GHOA 1JZDA 2P0MA 3FGYA 5CF2A 2C4BA 1JZOA 2BMQB 1OGZA 4KFEA 3CC23 1LRAA 1I3FA 1C54A 1LNHA 3SYUA 3WHOA 3GZXB 3MG1A 1R4YA 2CK3H 2CH9A 2HOHA 1O7MB 1GOVA 1MNLA 1FGQA 3NM2A 3LH4A 1M1K4 5IG5A 3BLZA 2D1WA 3A5EA 1JB5A 2F56A 1GS3A 2ZA4A 3DGOA 3AHWA 3B4PA 1UGHI 3ALAA 5STDA 4HM4B 3UL6A 1JB4A 1A67A 5HOHA 3OX9A 2CKFB 2ML5A 3Q3FA 2BMRB 3DGMA 1EA2A 5IG4A 4EXRA 1UCIA 2ZHXB 2W9PA 2OOVA 3SVAA 5RNTA 3HZPA 1BRHA 4J5GA 1W6YA 1E3VA 4XBXA 4KFFA 4KT3B 3K9MC 4NPBA 1YNVX 2HMMB 3GZRA 5G1LA 5GSPA 3OW22 1K8A4 3VGNA 1GOYA 4R1KA 1SIIA 1STFI 3OWYA 1SIHA 1RDSA 3CC43 2LQVA 4K1UA 2L1SA 1VQL3 3JUQA 2IYJA 3DY5A 3IPTA 4WFOA 5M19A 1D6UA 1NO3A 5JPUA 3KN4A 1B2ZA 4AKZA 1YIJ3 1JBTA 1O7WB 2Y74A 4O2HA 3GRDA 3EB8A 7RNTA 3OV4A 4L8OA 3CNMA 1BUQA 4XB5A 3MHEA 2K0MA 3WOFB 1U5OA 2QGUA 3M8CA 2STDA 2KAAA 4XDVA 3SEDA 2CHCA 3G0KA 2CWTA 1QAKA 4XDWA 2KCDA 1N8R4 3F8HA 3CCV3 3BB9A 1RHLA 1W00A 3I0YA 2RFRA 1U8CB 1DYUA 1RSNA 3BNCA 2Z77A 1F8NA 1FYSA 1RCKA 3BNEA 1CYVA 3AHSA 3MG2A 1EG9B 1LOYA 1RGFA 1RGHA 1C7HA 4RBNA 3CCM3 2XFTA 1KQS2 4N3VA 1B20A 2XFSA 3GZYB 2K3DA 1YGEA 4HM2B 1G0TA 3KKGA 3CD63 3X3ZA 4FR9A 1UDII 1RGLA 2HMOB 3G8ZA 1RRLA 1GY5A 5EQLA 4MJDA 2GXFA 3FG3A 3I563 1OF5B 5M18A 1I2GA 2R4IA 3DZLA 1LNIA 2KRTA 3NQYA 4CCVA 2YFLB 2YFJB 3ECFA 3SOAA 1MWRA 3ROBA 1JKGA 1FUSA 1RMSA 2RNTA 5AIHA 2K54A 2F86B 3FLJA 3PGBA 4FCMA 1GSPA 3K0ZA 3STDA 3F9SA 2XGNA 3JUOA 4EV2A 1D6YA 1B2MA
chains in the Genus database with same CATH topology
1CEWI 2HMLB 1UI8A 2F98A 2RSXA 1W7CA 2OWPA 1RN7A 2HMKB 2WGOA 4FMCA 2GEXA 4AEQA 3PCSA 4RZMA 2OTJ3 3SXXA 3F7XA 3G4S3 1OGXA 1A2VA 1JB2A 2OQEC 2ZL8A 2E2VA 4IPBA 1CYUA 4K61A 5JBSA 1QVG2 1ZO2A 1W2ZA 2M7OA 4H61A 1KSIA 3DGLA 4STDA 2W56A 1N5PA 2CIUA 4GB5A 4J9AA 1O7PB 2YFIB 1NB3I 1Z1SA 1FA3A 1Q40A 1RKYA 3EN8A 3DM8A 3I553 2IMJA 3LT9A 3S27A 4MMXB 1S5AA 3F8XA 3T8UA 3WA3A 4HM0B 3PZWA 2Q07A 5IG0A 3O8YA 2CG0A 3EBYA 2BHMA 1KD14 3NBBA 1AV4A 1CQSA 2MC8A 3MKIA 1YI23 3Q1CA 3NHXA 3BNDA 2P05A 1SJWA 1ZX2A 1AVKA 4IIAA 4KFDA 1OPYA 4HZ9B 3VF1A 1GD4A 2A15A 1Q824 3D9RA 1FUWA 1HKXA 1KC84 3MYTA 1YIT3 1ULJB 2WGQA 5HGRA 4WYKA 3PS8A 1JNQA 5AEUB 3G16A 3NBJA 5IG3A 1IVUA 3F14A 4HJLB 2V1LA 3EHCA 4HM3B 5IEOA 1QMAA 1US1A 2WO0A 4ORLA 3S28A 3RGAA 2INXA 4K1VA 3KZTA 4R4KA 3WDGB 2FNQA 2MF7A 3LXUX 2WOHA 5CXOA 2E2UA 3AMOA 1GY6A 3OWSA 2OQEA 4H3UA 1TU5A 1S723 5JPPA 2GBWB 5AI1A 6STDA 2FGTA 3SX1A 3HK4A 1E3RA 4MMZB 2CFLA 4JF8A 2CFWA 3WA2X 1M904 5LC6A 4RNYA 5DRVA 4O3VA 4EV5A 5CLKA 1YJ93 1JKGB 1JRQA 3CCS3 1EKMA 4XBTA 3PXMA 3EQQB 3HIGA 1IT8A 1W4NA 2E2TA 2KXGA 3DMCA 2YX9A 3GAXA 4XBYA 3RGRA 1NB5I 1FGRA 1VQ43 4HM6B 3J7Yd 5AIFA 3T0UA 5IW9A 1WMNA 2GBXB 3EBTA 4LGQA 1IQYA 1W6GA 2P38A 1IQ8A 1IVVA 4EYCA 3G713 3LTDA 1N9JA 5IEPA 4FCJA 1LVNA 4X2OA 3D3LA 3NV0B 4QWTA 1VQ93 3NQZA 4J8TA 2I9WA 3CCE3 5DREA 2PZVA 5I97A 2W56B 1JV2B 1ROAA 2P09A 3KIIA 3K7CA 4OUQA 1FGTA 3HIIA 3CCL3 3OWUA 1RJOA 1ULIB 1Q40B 1O7NB 4OK0A 4N6NB 2XGLA 1IK3A 1NU3A 3FF0A 3G6E3 3FG4A 3X41A 3F7SA 1R4CA 3PCRA 3FKAA 3N8BA 2CFKA 4JRFA 3FSDA 3X3YA 3LTBA 3X40A 2W04A 4HM8B 2QA43 3ER7A 1DVCA 2JDIH 4HM7B 4EBGA 3S29A 1G96A 3K5TA 3LOYA 3JVCA 1K41A 3K63A 1JN5A 2P0XA 2IA7A 7STDA 4N6LA 2BO9B 5CF1A 1J2BA 5CK6A 3IMAB 1GY7A 1TP6A 3HX8A 1DMQA 1VQN3 2XF3A 3CCJ3 3NUVA 4WYKB 4O02B 3WMDA 5KP3A 3MG3A 1TFOA 5BXQA 1FGOA 2QIYA 2JQ5A 2W03A 4EC6A 3MPHA 2Z6BA 3H3HA 3CCQ3 3EJVA 1LOXA 3CNXA 5KP4A 5EVHA 1OUNA 2CFGA 3AMOB 1AVLA 2C11A 1A2KA 4RNZA 5D81A 1D6ZA 4O8SA 1TIJA 4BTWA 1JJ22 3PYJA 1VQP3 2BMOB 3E99A 2OTL3 1TFKA 1WMPA 3B8LA 1V74A 2D42A 4Q53A 1K9M4 1RRHA 1ASKA 3LT8A 3L0RA 1ISKA 1W5ZA 3B4OA 4FMBA 2HMJB 4OVMA 1FGMA 1IVWA 1A90A 3X3XA 2LYXA 4I4KA 3CPW2 4WP5A 2BNGA 2CFDA 2CWUA 3VSYA 1L5GB 3EX9A 3KSPA 3DXOA 2F99A 1UUWB 2XR8B 2O9UX 3GZBA 1OACA 3EC9A 1GYBA 4R80A 5AIGA 3LMLA 3JUNA 1W02A 5D83A 5AYRB 4TX4A 2XSOB 3NM7A 4HM1B 4U13A 1M1XB 5BVBA 3EE1A 4MEIA 1QALA 3WODG 3EF8A 4L8PA 3UJMA 1N5HA 1WMOA 4R9LA 3S5CA 4N6MA 1UW1A 1ROVA 4L7KA 3A76A 4FMAA 3LTAA 2C10A 3B7CA 4LMIA 4HKVB 4AKYA 3H51A 1UI7A 3T8NA 3CC73 2Z7AA 1VQ83 3UL5A 2W0QA 1Q814 3Q2PA 1IV7A 1VQO3 1W6CA 3FZWA 3BNBA 4FCZA 4N6UA 4LEHA 1MOLA 3CME3 2XSHB 2FXTA 3X42A 4GL6A 5EEOA 3WOEB 2L4VA 1JN5B 3CPOA 3NXJA 1VQ53 3KFQC 1VQK3 4BTYA 4K90B 5AIIA 1SPUA 3DGNA 2GU1A 1TUHA 4PEJA 1IQXA 3NBRA 3GWRA 1IT7A 3TDGA 2W2CA 3KE7A 2UX0A 5IERA 1UUVB 1WNHA 2HMNB 1KWIA 1W2B2 3CU3A 3UB1A 3N9HA 3LZAA 1HU9A 2GEYA 1O7GB 1OH0A 4XM4A 1Y4KA 1WQLB 4N6OB 4KVHA 5IF6A 2XEPA 4HZBB 4BTXA 4HM5B 3MSOA 1N8QA 1DMMA 1GD3A 2CG1A 1O7HB 5TGNA 5ELUA 1QVF2 3LYGA 2CWVA 1PU4A 5G2GA 5A0OB 3SLUA 1W01A 3NX0A 1PFPA 4NHFA 1IVXA 4FMDA 1NWWA 3IJEB 1LXEA 3KSED 2B1XB 1VQ73 4G1MB 1OHOA 5D82A 8CHOA 1QAFA 1YJW3 1DMNA 2GU3A 4NREA 2IUKA 4CDLA 2Z76A 3CCR3 1M9GA 4HVNA 3LTCA 1T5YA 2W9QA 1STDA 1VQ63 1NDOB 3MWZA 4X2HA 3U1WA 2CW9A 1OHPA 1Q42A 4N6V0 1E97A 2XH9A 3JUPA 3QRDA 4LZIA 5KP1A 3CCU3 1Q7Y4 3SOYA 2B24B 4KZ1A 3FCSB 2WOFA 1AR0A 3F40A 2OOVC 3QK9A 4N6TA 3EN1B 5LC7A 1DVDA 3UNLA 3V92A 3FG1A 1YVBI 1IU7A 1YJN3 1IV9A 4HBRA 1Q864 2O3OA 4WWUC 1QJGA 2XRXB 3NV0A 3U97A 5FW5A 1VQM3 2OCTA 2ML6A 3OXAA 3S67A 3V98A 1OCVA 3Q90A 1K28A 4R9KA 2RGQA 1OF5A 5AEWB 2IUJA 5IENA 1K734 3DUKA 5AYSC 4ZM8A 4HYZA 4MMYB 3RDEA 3FF2A 4WHAA 3CMA3 1SQWA 1NJI4 2PNCA 2Y73A 1WTHA 2BT3A 1YHQ3 2ZDJA 2SBLA 1IDPA 2CC3A 3N54B 1N9EA 3FH1A 3HI7A 5ELJA 2QEX3 4IT7A 1VZZA 3V99A 1OHSA 3JUMA 3CXC2 2W6JH 2RCDA 4LSOA 5FGOA 5CF2A 2P0MA 3FGYA 2BMQB 4KFEA 1OGZA 3CC23 1LNHA 3GZXB 3MG1A 2CK3H 2CH9A 1O7MB 1MNLA 1FGQA 3NM2A 3LH4A 1M1K4 5IG5A 3BLZA 2D1WA 1JB5A 1GS3A 3DGOA 5STDA 3B4PA 3ALAA 4HM4B 3UL6A 1JB4A 1A67A 3OX9A 2CKFB 2ML5A 2BMRB 3DGMA 1EA2A 5IG4A 4EXRA 2OOVA 2W9PA 3SVAA 3HZPA 1W6YA 1E3VA 4XBXA 4KFFA 3K9MC 1K8A4 3OW22 2HMMB 3GZRA 3VGNA 4R1KA 1SIIA 1STFI 3OWYA 1SIHA 3CC43 2LQVA 4K1UA 1VQL3 3JUQA 3DY5A 3IPTA 4WFOA 1D6UA 1NO3A 5JPUA 3KN4A 4AKZA 1YIJ3 1O7WB 2Y74A 4O2HA 3GRDA 3EB8A 3OV4A 4L8OA 3CNMA 1BUQA 4XB5A 3MHEA 2K0MA 3WOFB 1U5OA 2QGUA 3M8CA 2STDA 4XDVA 3SEDA 2CHCA 3G0KA 2CWTA 1QAKA 4XDWA 2KCDA 1N8R4 3F8HA 3CCV3 3BB9A 1W00A 3I0YA 2RFRA 1U8CB 1DYUA 3BNCA 2Z77A 1F8NA 3BNEA 1CYVA 3MG2A 1EG9B 1C7HA 4RBNA 3CCM3 2XFTA 1KQS2 4N3VA 2XFSA 3GZYB 1YGEA 4HM2B 3KKGA 3CD63 3X3ZA 4FR9A 5EQLA 2HMOB 3G8ZA 1RRLA 1GY5A 3I563 4MJDA 2GXFA 3FG3A 1EQKA 1OF5B 2R4IA 3DZLA 3NQYA 2KRTA 4CCVA 2YFLB 2YFJB 3ECFA 3SOAA 3ROBA 1JKGA 5AIHA 2K54A 2F86B 3FLJA 3PGBA 4FCMA 3STDA 3K0ZA 3F9SA 2XGNA 3JUOA 4EV2A 1D6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK9 A;  2FXT A;  2CW9 A;  3J7Y d; 
#chains in the Genus database with same CATH topology
 1CEW I;  2HML B;  1UI8 A;  2F98 A;  2RSX A;  1Q9E A;  1W7C A;  2OWP A;  1SAR A;  1RN7 A;  2HMK B;  1RN1 A;  2WGO A;  4FMC A;  2GEX A;  4AEQ A;  3PCS A;  4RZM A;  2OTJ 3;  1LOW A;  3SXX A;  1Q7H A;  3F7X A;  1I2F A;  1TTO A;  3G4S 3;  1OGX A;  1A2V A;  1JB2 A;  1I3I A;  1JBS A;  2OQE C;  2ZL8 A;  2E2V A;  1AQZ A;  4IPB A;  1CYU A;  4K61 A;  5JBS A;  1QVG 2;  1ZO2 A;  1W2Z A;  2M7O A;  4H61 A;  1KSI A;  3DGL A;  4STD A;  2W56 A;  1RNT A;  1N5P A;  1G02 A;  4GSP A;  2CIU A;  4GB5 A;  4J9A A;  1RCL A;  2RBI A;  1O7P B;  2YFI B;  1NB3 I;  1Z1S A;  1FA3 A;  1Q40 A;  1RKY A;  3WR2 A;  3EN8 A;  3DM8 A;  3I55 3;  2IMJ A;  3LT9 A;  3S27 A;  4MMX B;  1FW7 A;  3D5G A;  3D5I A;  1S5A A;  1BGS A;  3F8X A;  3T8U A;  3WA3 A;  4HM0 B;  1BU4 A;  3PZW A;  2Q07 A;  5IG0 A;  1TJD A;  2GSP A;  1BOX A;  2H0I A;  2UGI A;  2CG0 A;  3EBY A;  2BHM A;  3O8Y A;  3NBB A;  1AV4 A;  1CQS A;  2MC8 A;  1KD1 4;  3MKI A;  1YI2 3;  1BRJ A;  1BUJ A;  3Q1C A;  1I0V A;  3ZG0 A;  3NHX A;  1GMQ A;  1B3S A;  3BND A;  2P05 A;  3RNT A;  1SJW A;  1ZX2 A;  1AVK A;  4IIA A;  4KFD A;  1OPY A;  4HZ9 B;  1RGC A;  3VF1 A;  1GD4 A;  2A15 A;  1Q82 4;  3D9R A;  1FUW A;  1HKX A;  4HAA A;  1KC8 4;  1B21 A;  3MYT A;  1BVI A;  3KCH A;  1YIT 3;  1RGA A;  1ULJ B;  4RNT A;  1I8V A;  2WGQ A;  5HGR A;  4WYK A;  3PS8 A;  1B2X A;  1JNQ A;  1AY7 A;  3G16 A;  5AEU B;  3NBJ A;  5IG3 A;  1IVU A;  3F14 A;  4HJL B;  2V1L A;  3EHC A;  1BSD A;  4HM3 B;  5IEO A;  1QMA A;  1MWT A;  1TRQ A;  1US1 A;  2WO0 A;  4ORL A;  3S28 A;  3RGA A;  2BU4 A;  2INX A;  4K1V A;  3KZT A;  4R4K A;  3WDG B;  2FNQ A;  2MF7 A;  3LXU X;  2WOH A;  5CXO A;  4BL3 A;  2E2U A;  1BIR A;  3AMO A;  1GY6 A;  3DH2 A;  1BSB A;  3OWS A;  4H3U A;  2OQE A;  1X1U A;  1TU5 A;  1S72 3;  5JPP A;  1BNF A;  2GBW B;  5AI1 A;  6STD A;  1EEJ A;  4DKI A;  2FGT A;  3SX1 A;  3HK4 A;  1E3R A;  1I2E A;  4MMZ B;  2CFL A;  4JF8 A;  2CFW A;  1BNJ A;  3WA2 X;  1M90 4;  5LC6 A;  4RNY A;  5DRV A;  1BRG A;  4O3V A;  4EV5 A;  5CLK A;  5M1A A;  1YJ9 3;  1JKG B;  1JRQ A;  3CCS 3;  1EKM A;  4XBT A;  3PXM A;  3EQQ B;  3HIG A;  3URP A;  1IT8 A;  1W4N A;  2E2T A;  2KXG A;  3DMC A;  2YX9 A;  3GAX A;  4XBY A;  3RGR A;  1JBR A;  1NB5 I;  1FGR A;  1VQ4 3;  4HM6 B;  3J7Y d;  5AIF A;  3T0U A;  5IW9 A;  1WMN A;  2GBX B;  3EBT A;  4LGQ A;  1IQY A;  1W6G A;  2P38 A;  1IQ8 A;  1YGW A;  1IVV A;  4EYC A;  3G71 3;  3LTD A;  1N9J A;  5IEP A;  4FCJ A;  1IYY A;  1LVN A;  4X2O A;  1BSE A;  3D3L A;  3NV0 B;  4QWT A;  3NQZ A;  9RNT A;  1VQ9 3;  4J8T A;  2I9W A;  1MWS A;  3CCE 3;  5DRE A;  2PZV A;  5I97 A;  2W56 B;  1JV2 B;  1ROA A;  2F4Y A;  2P09 A;  3KII A;  3K7C A;  4J5K A;  4OUQ A;  1FGT A;  3HII A;  3CCL 3;  3OWU A;  1RJO A;  1ULI B;  1RTU A;  1Q40 B;  1O7N B;  4OK0 A;  4N6N B;  2XGL A;  4BIR A;  3AGN A;  1UCJ A;  1ZS7 A;  4I5Q A;  1IK3 A;  1BRN L;  1NU3 A;  1GMP A;  3FF0 A;  3G6E 3;  1DE3 A;  3FG4 A;  1UCL A;  1UUG B;  3X41 A;  3F7S A;  1R4C A;  3PCR A;  3FKA A;  3N8B A;  2CFK A;  4JRF A;  3FSD A;  3X3Y A;  3LTB A;  3X40 A;  2W04 A;  4HM8 B;  1BSA A;  2QA4 3;  3ER7 A;  1GMR A;  1DVC A;  2JDI H;  4HM7 B;  1I0X A;  1PYL A;  4EBG A;  3S29 A;  1G96 A;  2J8X B;  3K5T A;  3LOY A;  3JVC A;  1K41 A;  3K63 A;  1JN5 A;  2P0X A;  2IA7 A;  1T2H A;  7STD A;  1T3B A;  4N6L A;  2BO9 B;  5CF1 A;  3HOH A;  1J2B A;  1B2S A;  5CK6 A;  6RNT A;  1V58 A;  1GY7 A;  3IMA B;  1X1X A;  1TP6 A;  1ZGX A;  3HX8 A;  1RNB A;  1DMQ A;  1VQN 3;  4HOH A;  2XF3 A;  3CCJ 3;  3NUV A;  4WYK B;  4O02 B;  3WMD A;  5KP3 A;  3MG3 A;  1TFO A;  5BXQ A;  2KF4 A;  1BAO A;  1FGO A;  2QIY A;  1BNI A;  2JQ5 A;  2W03 A;  4EC6 A;  3MPH A;  2Z6B A;  2BIR A;  3H3H A;  3CCQ 3;  3EJV A;  1LOX A;  3CNX A;  5KP4 A;  5EVH A;  1OUN A;  2CFG A;  1BNS A;  2H0G A;  3AMO B;  1AVL A;  2C11 A;  1A2K A;  2KF5 A;  4RNZ A;  5D81 A;  1D6Z A;  4O8S A;  1TIJ A;  1TRP A;  4BTW A;  3PYJ A;  1VQP 3;  2BMO B;  3E99 A;  1JJ2 2;  2OTL 3;  1TFK A;  1WMP A;  3B8L A;  1V74 A;  2D42 A;  4Q53 A;  1K9M 4;  3GSP A;  1RRH A;  1ASK A;  1VQQ A;  3LT8 A;  3L0R A;  1ISK A;  1W5Z A;  1RN4 A;  3B4O A;  2HMJ B;  4FMB A;  4OVM A;  1FGM A;  1IVW A;  1A90 A;  3X3X A;  2LYX A;  4I4K A;  3CPW 2;  4WP5 A;  2BNG A;  2CFD A;  2CWU A;  3VSY A;  1L5G B;  3EX9 A;  3KSP A;  3DXO A;  2F99 A;  1UUW B;  2XR8 B;  1LQG C;  2F5W A;  7GSP A;  2O9U X;  3GZB A;  6GSP A;  4BU4 A;  1OAC A;  3EC9 A;  1GYB A;  2SAR A;  4R80 A;  5AIG A;  3LML A;  3JUN A;  2IY2 A;  1W02 A;  5D83 A;  5AYR B;  4TX4 A;  1EQK A;  2XSO B;  1BSC A;  3NM7 A;  4HM1 B;  4U13 A;  1M1X B;  5BVB A;  3EE1 A;  4MEI A;  1QAL A;  3WOD G;  3EF8 A;  3ZFZ A;  1BNG A;  3D79 A;  4L8P A;  3UJM A;  1N5H A;  1WMO A;  4R9L A;  3S5C A;  1RGK A;  4N6M A;  1UW1 A;  1ROV A;  1LOV A;  4L7K A;  3A76 A;  4FMA A;  3LTA A;  2C10 A;  3B7C A;  4LMI A;  1HZ1 A;  4HKV B;  4AKY A;  3H51 A;  1UI7 A;  3T8N A;  3CC7 3;  2Z7A A;  3D4A A;  1YVS A;  2AAD A;  1VQ8 3;  3UL5 A;  2W0Q A;  1Q81 4;  3DGY A;  3Q2P A;  1IV7 A;  1BRS A;  1VQO 3;  1I70 A;  1W6C A;  3FZW A;  3BNB A;  4FCZ A;  4N6U A;  4LEH A;  1MOL A;  5BIR A;  1BRK A;  3CME 3;  4BL2 A;  2XSH B;  2FXT A;  3X42 A;  4GL6 A;  4CPK A;  5EEO A;  2CX0 A;  1CH0 A;  3BIR A;  3WOE B;  2L4V A;  1JN5 B;  3CPO A;  3NXJ A;  1VQ5 3;  3KFQ C;  1VQK 3;  4BTY A;  1A2P A;  4K90 B;  5AII A;  3ZG5 A;  1SPU A;  3DGN A;  2GU1 A;  1RGE A;  1TUH A;  4PEJ A;  1IQX A;  3NBR A;  3GWR A;  1IT7 A;  3TDG A;  1HYF A;  2CX1 A;  2W2C A;  1MGW A;  2UX0 A;  3KE7 A;  1UUV B;  1WNH A;  2HMN B;  1KWI A;  2UUG C;  5IER A;  3CU3 A;  2KF6 A;  3AGO A;  8RNT A;  1W2B 2;  3UB1 A;  3N9H A;  3LZA A;  1HU9 A;  2GEY A;  4CJN A;  1O7G B;  1OH0 A;  4XM4 A;  5BU4 A;  1Y4K A;  1WQL B;  4N6O B;  4KVH A;  1RGG A;  5IF6 A;  1LQM B;  2XEP A;  4HZB B;  4BTX A;  4HM5 B;  1NNV A;  3MSO A;  1N8Q A;  2R41 A;  1DMM A;  1GD3 A;  2CG1 A;  1O7H B;  5TGN A;  5ELU A;  1QVF 2;  3LYG A;  1DET A;  2CWV A;  1PU4 A;  5G2G A;  4EW5 A;  5A0O B;  3SLU A;  1W01 A;  1FZU A;  1X1Y A;  3NX0 A;  1PFP A;  4NHF A;  2H0H A;  1IVX A;  4FMD A;  1NWW A;  1V57 A;  3IJE B;  1LXE A;  3KSE D;  2B1X B;  1VQ7 3;  4G1M B;  1B2U A;  1OHO A;  5D82 A;  8CHO A;  1PY3 A;  1QAF A;  1YJW 3;  1UGI A;  1DMN A;  1BNR A;  2GU3 A;  4ILF A;  4NRE A;  2IUK A;  4CDL A;  2Z76 A;  3CCR 3;  1M9G A;  4HVN A;  1GOU A;  3LTC A;  1T5Y A;  2W9Q A;  1STD A;  1VQ6 3;  1NDO B;  3MWZ A;  1BAN A;  4X2H A;  3U1W A;  2F5M A;  2CW9 A;  1OHP A;  1Q42 A;  1BRI A;  4N6V 0;  1E97 A;  2XH9 A;  3JUP A;  3QRD A;  4LZI A;  5KP1 A;  3CCU 3;  1Q7Y 4;  3SOY A;  2B24 B;  4KZ1 A;  3FCS B;  2WOF A;  1AR0 A;  3F40 A;  2OOV C;  3QK9 A;  4N6T A;  1T2I A;  3EN1 B;  5LC7 A;  1DVD A;  1X1W A;  3UNL A;  3V92 A;  3FG1 A;  1YVB I;  1IU7 A;  1RLS A;  1YJN 3;  1FUT A;  1IV9 A;  4HBR A;  1Q86 4;  1MGR A;  2O3O A;  1B27 A;  4WWU C;  1QJG A;  2XRX B;  3NV0 A;  3U97 A;  5FW5 A;  1VQM 3;  2OCT A;  2ML6 A;  3OXA A;  1UCK A;  3S67 A;  3V98 A;  1OCV A;  3Q90 A;  1K28 A;  2KF3 A;  2RGQ A;  4R9K A;  1OF5 A;  5AEW B;  2IUJ A;  1BNE A;  5IEN A;  1K73 4;  3DUK A;  5AYS C;  4LYL B;  4ZM8 A;  4HYZ A;  4MMY B;  3RDE A;  2AAE A;  3FF2 A;  5G1K A;  4WHA A;  1MWU A;  3CMA 3;  1SQW A;  1NJI 4;  2PNC A;  2Y73 A;  1WTH A;  2BT3 A;  1YHQ 3;  2ZDJ A;  2SBL A;  1IDP A;  2CC3 A;  3N54 B;  1N9E A;  3FH1 A;  3HI7 A;  5ELJ A;  2QEX 3;  4IT7 A;  1VZZ A;  3V99 A;  1OHS A;  3JUM A;  3BU4 A;  3CXC 2;  2W6J H;  2RCD A;  4LSO A;  1EUI C;  5FGO A;  4GHO A;  1JZD A;  2P0M A;  3FGY A;  5CF2 A;  2C4B A;  1JZO A;  2BMQ B;  1OGZ A;  4KFE A;  3CC2 3;  1LRA A;  1I3F A;  1C54 A;  1LNH A;  3SYU A;  3WHO A;  3GZX B;  3MG1 A;  1R4Y A;  2CK3 H;  2CH9 A;  2HOH A;  1O7M B;  1GOV A;  1MNL A;  1FGQ A;  3NM2 A;  3LH4 A;  1M1K 4;  5IG5 A;  3BLZ A;  2D1W A;  3A5E A;  1JB5 A;  2F56 A;  1GS3 A;  2ZA4 A;  3DGO A;  3AHW A;  3B4P A;  1UGH I;  3ALA A;  5STD A;  4HM4 B;  3UL6 A;  1JB4 A;  1A67 A;  5HOH A;  3OX9 A;  2CKF B;  2ML5 A;  3Q3F A;  2BMR B;  3DGM A;  1EA2 A;  5IG4 A;  4EXR A;  1UCI A;  2ZHX B;  2W9P A;  2OOV A;  3SVA A;  5RNT A;  3HZP A;  1BRH A;  4J5G A;  1W6Y A;  1E3V A;  4XBX A;  4KFF A;  4KT3 B;  3K9M C;  4NPB A;  1YNV X;  2HMM B;  3GZR A;  5G1L A;  5GSP A;  3OW2 2;  1K8A 4;  3VGN A;  1GOY A;  4R1K A;  1SII A;  1STF I;  3OWY A;  1SIH A;  1RDS A;  3CC4 3;  2LQV A;  4K1U A;  2L1S A;  1VQL 3;  3JUQ A;  2IYJ A;  3DY5 A;  3IPT A;  4WFO A;  5M19 A;  1D6U A;  1NO3 A;  5JPU A;  3KN4 A;  1B2Z A;  4AKZ A;  1YIJ 3;  1JBT A;  1O7W B;  2Y74 A;  4O2H A;  3GRD A;  3EB8 A;  7RNT A;  3OV4 A;  4L8O A;  3CNM A;  1BUQ A;  4XB5 A;  3MHE A;  2K0M A;  3WOF B;  1U5O A;  2QGU A;  3M8C A;  2STD A;  2KAA A;  4XDV A;  3SED A;  2CHC A;  3G0K A;  2CWT A;  1QAK A;  4XDW A;  2KCD A;  1N8R 4;  3F8H A;  3CCV 3;  3BB9 A;  1RHL A;  1W00 A;  3I0Y A;  2RFR A;  1U8C B;  1DYU A;  1RSN A;  3BNC A;  2Z77 A;  1F8N A;  1FYS A;  1RCK A;  3BNE A;  1CYV A;  3AHS A;  3MG2 A;  1EG9 B;  1LOY A;  1RGF A;  1RGH A;  1C7H A;  4RBN A;  3CCM 3;  2XFT A;  1KQS 2;  4N3V A;  1B20 A;  2XFS A;  3GZY B;  2K3D A;  1YGE A;  4HM2 B;  1G0T A;  3KKG A;  3CD6 3;  3X3Z A;  4FR9 A;  1UDI I;  1RGL A;  2HMO B;  3G8Z A;  1RRL A;  1GY5 A;  5EQL A;  4MJD A;  2GXF A;  3FG3 A;  3I56 3;  1OF5 B;  5M18 A;  1I2G A;  2R4I A;  3DZL A;  1LNI A;  2KRT A;  3NQY A;  4CCV A;  2YFL B;  2YFJ B;  3ECF A;  3SOA A;  1MWR A;  3ROB A;  1JKG A;  1FUS A;  1RMS A;  2RNT A;  5AIH A;  2K54 A;  2F86 B;  3FLJ A;  3PGB A;  4FCM A;  1GSP A;  3K0Z A;  3STD A;  3F9S A;  2XGN A;  3JUO A;  4EV2 A;  1D6Y A;  1B2M A; 
#chains in the Genus database with same CATH homology
 1CEW I;  2HML B;  1UI8 A;  2F98 A;  2RSX A;  1W7C A;  2OWP A;  1RN7 A;  2HMK B;  2WGO A;  4FMC A;  2GEX A;  4AEQ A;  3PCS A;  4RZM A;  2OTJ 3;  3SXX A;  3F7X A;  3G4S 3;  1OGX A;  1A2V A;  1JB2 A;  2OQE C;  2ZL8 A;  2E2V A;  4IPB A;  1CYU A;  4K61 A;  5JBS A;  1QVG 2;  1ZO2 A;  1W2Z A;  2M7O A;  4H61 A;  1KSI A;  3DGL A;  4STD A;  2W56 A;  1N5P A;  2CIU A;  4GB5 A;  4J9A A;  1O7P B;  2YFI B;  1NB3 I;  1Z1S A;  1FA3 A;  1Q40 A;  1RKY A;  3EN8 A;  3DM8 A;  3I55 3;  2IMJ A;  3LT9 A;  3S27 A;  4MMX B;  1S5A A;  3F8X A;  3T8U A;  3WA3 A;  4HM0 B;  3PZW A;  2Q07 A;  5IG0 A;  3O8Y A;  2CG0 A;  3EBY A;  2BHM A;  1KD1 4;  3NBB A;  1AV4 A;  1CQS A;  2MC8 A;  3MKI A;  1YI2 3;  3Q1C A;  3NHX A;  3BND A;  2P05 A;  1SJW A;  1ZX2 A;  1AVK A;  4IIA A;  4KFD A;  1OPY A;  4HZ9 B;  3VF1 A;  1GD4 A;  2A15 A;  1Q82 4;  3D9R A;  1FUW A;  1HKX A;  1KC8 4;  3MYT A;  1YIT 3;  1ULJ B;  2WGQ A;  5HGR A;  4WYK A;  3PS8 A;  1JNQ A;  5AEU B;  3G16 A;  3NBJ A;  5IG3 A;  1IVU A;  3F14 A;  4HJL B;  2V1L A;  3EHC A;  4HM3 B;  5IEO A;  1QMA A;  1US1 A;  2WO0 A;  4ORL A;  3S28 A;  3RGA A;  2INX A;  4K1V A;  3KZT A;  4R4K A;  3WDG B;  2FNQ A;  2MF7 A;  3LXU X;  2WOH A;  5CXO A;  2E2U A;  3AMO A;  1GY6 A;  3OWS A;  2OQE A;  4H3U A;  1TU5 A;  1S72 3;  5JPP A;  2GBW B;  5AI1 A;  6STD A;  2FGT A;  3SX1 A;  3HK4 A;  1E3R A;  4MMZ B;  2CFL A;  4JF8 A;  2CFW A;  3WA2 X;  1M90 4;  5LC6 A;  4RNY A;  5DRV A;  4O3V A;  4EV5 A;  5CLK A;  1YJ9 3;  1JKG B;  1JRQ A;  3CCS 3;  1EKM A;  4XBT A;  3PXM A;  3EQQ B;  3HIG A;  1IT8 A;  1W4N A;  2E2T A;  2KXG A;  3DMC A;  2YX9 A;  3GAX A;  4XBY A;  3RGR A;  1NB5 I;  1FGR A;  1VQ4 3;  4HM6 B;  3J7Y d;  5AIF A;  3T0U A;  5IW9 A;  1WMN A;  2GBX B;  3EBT A;  4LGQ A;  1IQY A;  1W6G A;  2P38 A;  1IQ8 A;  1IVV A;  4EYC A;  3G71 3;  3LTD A;  1N9J A;  5IEP A;  4FCJ A;  1LVN A;  4X2O A;  3D3L A;  3NV0 B;  4QWT A;  1VQ9 3;  3NQZ A;  4J8T A;  2I9W A;  3CCE 3;  5DRE A;  2PZV A;  5I97 A;  2W56 B;  1JV2 B;  1ROA A;  2P09 A;  3KII A;  3K7C A;  4OUQ A;  1FGT A;  3HII A;  3CCL 3;  3OWU A;  1RJO A;  1ULI B;  1Q40 B;  1O7N B;  4OK0 A;  4N6N B;  2XGL A;  1IK3 A;  1NU3 A;  3FF0 A;  3G6E 3;  3FG4 A;  3X41 A;  3F7S A;  1R4C A;  3PCR A;  3FKA A;  3N8B A;  2CFK A;  4JRF A;  3FSD A;  3X3Y A;  3LTB A;  3X40 A;  2W04 A;  4HM8 B;  2QA4 3;  3ER7 A;  1DVC A;  2JDI H;  4HM7 B;  4EBG A;  3S29 A;  1G96 A;  3K5T A;  3LOY A;  3JVC A;  1K41 A;  3K63 A;  1JN5 A;  2P0X A;  2IA7 A;  7STD A;  4N6L A;  2BO9 B;  5CF1 A;  1J2B A;  5CK6 A;  3IMA B;  1GY7 A;  1TP6 A;  3HX8 A;  1DMQ A;  1VQN 3;  2XF3 A;  3CCJ 3;  3NUV A;  4WYK B;  4O02 B;  3WMD A;  5KP3 A;  3MG3 A;  1TFO A;  5BXQ A;  1FGO A;  2QIY A;  2JQ5 A;  2W03 A;  4EC6 A;  3MPH A;  2Z6B A;  3H3H A;  3CCQ 3;  3EJV A;  1LOX A;  3CNX A;  5KP4 A;  5EVH A;  1OUN A;  2CFG A;  3AMO B;  1AVL A;  2C11 A;  1A2K A;  4RNZ A;  5D81 A;  1D6Z A;  4O8S A;  1TIJ A;  4BTW A;  1JJ2 2;  3PYJ A;  1VQP 3;  2BMO B;  3E99 A;  2OTL 3;  1TFK A;  1WMP A;  3B8L A;  1V74 A;  2D42 A;  4Q53 A;  1K9M 4;  1RRH A;  1ASK A;  3LT8 A;  3L0R A;  1ISK A;  1W5Z A;  3B4O A;  4FMB A;  2HMJ B;  4OVM A;  1FGM A;  1IVW A;  1A90 A;  3X3X A;  2LYX A;  4I4K A;  3CPW 2;  4WP5 A;  2BNG A;  2CFD A;  2CWU A;  3VSY A;  1L5G B;  3EX9 A;  3KSP A;  3DXO A;  2F99 A;  1UUW B;  2XR8 B;  2O9U X;  3GZB A;  1OAC A;  3EC9 A;  1GYB A;  4R80 A;  5AIG A;  3LML A;  3JUN A;  1W02 A;  5D83 A;  5AYR B;  4TX4 A;  2XSO B;  3NM7 A;  4HM1 B;  4U13 A;  1M1X B;  5BVB A;  3EE1 A;  4MEI A;  1QAL A;  3WOD G;  3EF8 A;  4L8P A;  3UJM A;  1N5H A;  1WMO A;  4R9L A;  3S5C A;  4N6M A;  1UW1 A;  1ROV A;  4L7K A;  3A76 A;  4FMA A;  3LTA A;  2C10 A;  3B7C A;  4LMI A;  4HKV B;  4AKY A;  3H51 A;  1UI7 A;  3T8N A;  3CC7 3;  2Z7A A;  1VQ8 3;  3UL5 A;  2W0Q A;  1Q81 4;  3Q2P A;  1IV7 A;  1VQO 3;  1W6C A;  3FZW A;  3BNB A;  4FCZ A;  4N6U A;  4LEH A;  1MOL A;  3CME 3;  2XSH B;  2FXT A;  3X42 A;  4GL6 A;  5EEO A;  3WOE B;  2L4V A;  1JN5 B;  3CPO A;  3NXJ A;  1VQ5 3;  3KFQ C;  1VQK 3;  4BTY A;  4K90 B;  5AII A;  1SPU A;  3DGN A;  2GU1 A;  1TUH A;  4PEJ A;  1IQX A;  3NBR A;  3GWR A;  1IT7 A;  3TDG A;  2W2C A;  3KE7 A;  2UX0 A;  5IER A;  1UUV B;  1WNH A;  2HMN B;  1KWI A;  1W2B 2;  3CU3 A;  3UB1 A;  3N9H A;  3LZA A;  1HU9 A;  2GEY A;  1O7G B;  1OH0 A;  4XM4 A;  1Y4K A;  1WQL B;  4N6O B;  4KVH A;  5IF6 A;  2XEP A;  4HZB B;  4BTX A;  4HM5 B;  3MSO A;  1N8Q A;  1DMM A;  1GD3 A;  2CG1 A;  1O7H B;  5TGN A;  5ELU A;  1QVF 2;  3LYG A;  2CWV A;  1PU4 A;  5G2G A;  5A0O B;  3SLU A;  1W01 A;  3NX0 A;  1PFP A;  4NHF A;  1IVX A;  4FMD A;  1NWW A;  3IJE B;  1LXE A;  3KSE D;  2B1X B;  1VQ7 3;  4G1M B;  1OHO A;  5D82 A;  8CHO A;  1QAF A;  1YJW 3;  1DMN A;  2GU3 A;  4NRE A;  2IUK A;  4CDL A;  2Z76 A;  3CCR 3;  1M9G A;  4HVN A;  3LTC A;  1T5Y A;  2W9Q A;  1STD A;  1VQ6 3;  1NDO B;  3MWZ A;  4X2H A;  3U1W A;  2CW9 A;  1OHP A;  1Q42 A;  4N6V 0;  1E97 A;  2XH9 A;  3JUP A;  3QRD A;  4LZI A;  5KP1 A;  3CCU 3;  1Q7Y 4;  3SOY A;  2B24 B;  4KZ1 A;  3FCS B;  2WOF A;  1AR0 A;  3F40 A;  2OOV C;  3QK9 A;  4N6T A;  3EN1 B;  5LC7 A;  1DVD A;  3UNL A;  3V92 A;  3FG1 A;  1YVB I;  1IU7 A;  1YJN 3;  1IV9 A;  4HBR A;  1Q86 4;  2O3O A;  4WWU C;  1QJG A;  2XRX B;  3NV0 A;  3U97 A;  5FW5 A;  1VQM 3;  2OCT A;  2ML6 A;  3OXA A;  3S67 A;  3V98 A;  1OCV A;  3Q90 A;  1K28 A;  4R9K A;  2RGQ A;  1OF5 A;  5AEW B;  2IUJ A;  5IEN A;  1K73 4;  3DUK A;  5AYS C;  4ZM8 A;  4HYZ A;  4MMY B;  3RDE A;  3FF2 A;  4WHA A;  3CMA 3;  1SQW A;  1NJI 4;  2PNC A;  2Y73 A;  1WTH A;  2BT3 A;  1YHQ 3;  2ZDJ A;  2SBL A;  1IDP A;  2CC3 A;  3N54 B;  1N9E A;  3FH1 A;  3HI7 A;  5ELJ A;  2QEX 3;  4IT7 A;  1VZZ A;  3V99 A;  1OHS A;  3JUM A;  3CXC 2;  2W6J H;  2RCD A;  4LSO A;  5FGO A;  5CF2 A;  2P0M A;  3FGY A;  2BMQ B;  4KFE A;  1OGZ A;  3CC2 3;  1LNH A;  3GZX B;  3MG1 A;  2CK3 H;  2CH9 A;  1O7M B;  1MNL A;  1FGQ A;  3NM2 A;  3LH4 A;  1M1K 4;  5IG5 A;  3BLZ A;  2D1W A;  1JB5 A;  1GS3 A;  3DGO A;  5STD A;  3B4P A;  3ALA A;  4HM4 B;  3UL6 A;  1JB4 A;  1A67 A;  3OX9 A;  2CKF B;  2ML5 A;  2BMR B;  3DGM A;  1EA2 A;  5IG4 A;  4EXR A;  2OOV A;  2W9P A;  3SVA A;  3HZP A;  1W6Y A;  1E3V A;  4XBX A;  4KFF A;  3K9M C;  1K8A 4;  3OW2 2;  2HMM B;  3GZR A;  3VGN A;  4R1K A;  1SII A;  1STF I;  3OWY A;  1SIH A;  3CC4 3;  2LQV A;  4K1U A;  1VQL 3;  3JUQ A;  3DY5 A;  3IPT A;  4WFO A;  1D6U A;  1NO3 A;  5JPU A;  3KN4 A;  4AKZ A;  1YIJ 3;  1O7W B;  2Y74 A;  4O2H A;  3GRD A;  3EB8 A;  3OV4 A;  4L8O A;  3CNM A;  1BUQ A;  4XB5 A;  3MHE A;  2K0M A;  3WOF B;  1U5O A;  2QGU A;  3M8C A;  2STD A;  4XDV A;  3SED A;  2CHC A;  3G0K A;  2CWT A;  1QAK A;  4XDW A;  2KCD A;  1N8R 4;  3F8H A;  3CCV 3;  3BB9 A;  1W00 A;  3I0Y A;  2RFR A;  1U8C B;  1DYU A;  3BNC A;  2Z77 A;  1F8N A;  3BNE A;  1CYV A;  3MG2 A;  1EG9 B;  1C7H A;  4RBN A;  3CCM 3;  2XFT A;  1KQS 2;  4N3V A;  2XFS A;  3GZY B;  1YGE A;  4HM2 B;  3KKG A;  3CD6 3;  3X3Z A;  4FR9 A;  5EQL A;  2HMO B;  3G8Z A;  1RRL A;  1GY5 A;  3I56 3;  4MJD A;  2GXF A;  3FG3 A;  1EQK A;  1OF5 B;  2R4I A;  3DZL A;  3NQY A;  2KRT A;  4CCV A;  2YFL B;  2YFJ B;  3ECF A;  3SOA A;  3ROB A;  1JKG A;  5AIH A;  2K54 A;  2F86 B;  3FLJ A;  3PGB A;  4FCM A;  3STD A;  3K0Z A;  3F9S A;  2XGN A;  3JUO A;  4EV2 A;  1D6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...