3K7CA

Crystal structure of putative ntf2-like transpeptidase (np_281412.1) from campylobacter jejuni at 2.00 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
SNPEDLAKNFTKDLYSGDTKSVMSYIDLSEAKSDEEKTFVSDKITQVVAENAAKAKRMGGVKDIQIEEKTINKDSAKIRVLVLFNNDNNQSSNVFLAKKDRKWLVLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative NTF2-like transpeptidase (NP_281412.1) from CAMPYLOBACTER JEJUNI at 2.00 A resolution
rcsb
source organism Campylobacter jejuni
molecule tags Protein binding
molecule keywords Putative NTF2-like transpeptidase
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12870 DUF4878 Domain of unknown function (DUF4878)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k7cA00
1OGXA 5D83A 4XBYA 3WMDA 1NDOB 3VGNA 1OPYA 4LEHA 8CHOA 3UJMA 3EF8A 5AI1A 4LGQA 3DZLA 5IEOA 3F7XA 2PZVA 4H3UA 3OXAA 3SEDA 1U5OA 2F98A 1IDPA 3IPTA 3KZTA 4HM3B 4K1VA 3EBYA 1OGZA 1W02A 1ZO2A 4J8TA 1OCVA 4XB5A 2BMRB 3Q90A 1E3VA 1OHPA 3G0KA 3UNLA 3H3HA 2UX0A 3T8NA 4FCMA 4HM6B 3NBRA 5CF2A 5TGNA 4L8PA 1TP6A 3CU3A 4R9LA 4N3VA 2HMJB 3FGYA 3GZYB 3NXJA 5FW5A 3CNMA 2GXFA 3ER7A 3G16A 3K7CA 3OX9A 4HJLB 3EN8A 1Z1SA 4GB5A 4HM1B 4Q53A 4R1KA 4R9KA 5AEWB 5IG5A 1OUNA 1W6YA 5KP1A 3BB9A 1E3RA 1GYBA 1STDA 3ECFA 3I0YA 3MG1A 3MHEA 3MYTA 2YFIB 3JUQA 2F86B 5DRVA 3HK4A 4X2HA 3VSYA 1GY6A 4HM7B 6STDA 1ASKA 2Z77A 3F9SA 5IG0A 3OWYA 3B8LA 1CQSA 1AR0A 3OWUA 2QIYA 1EG9B 2GBXB 3ROBA 3RGRA 4XDWA 5IG3A 5JPUA 3LYGA 4XBXA 1O7PB 1OHSA 2JQ5A 1DMQA 3DUKA 3JUMA 4I4KA 3KSPA 5IERA 3EC9A 1ULIB 2BMQB 4L8OA 1QJGA 3SOYA 3FLJA 2B1XB 2W2CA 3NHXA 1TUHA 1OH0A 3FZWA 4HM2B 4HM5B 3HZPA 4U13A 5AEUB 1W01A 5D82A 3OV4A 4X2OA 2BNGA 5AIFA 1Q40A 4XDVA 4K1UA 5AIHA 5STDA 5IENA 4ORLA 1OHOA 3FF0A 4MJDA 2GBWB 5G2GA 5HGRA 1Q40B 3DMCA 4XBTA 5D81A 3GRDA 4OVMA 5IF6A 3MKIA 2GEXA 1GS3A 4HM4B 5CK6A 4STDA 2RFRA 4IIAA 2CHCA 1Q42A 3B7CA 3EHCA 2HMNB 1JKGB 1DMNA 1O7WB 2I9WA 2XSHB 1O7HB 1VZZA 1JN5B 2XSOB 3CPOA 3EQQB 3EN1B 1O7GB 3NUVA 4HVNA 4LMIA 1O7NB 1HKXA 1W00A 3KE7A 4HKVB 3B4OA 1JKGA 2IMJA 1ZX2A 3FKAA 3HX8A 3KKGA 1JN5A 2HMMB 3MG3A 4FCJA 3S5CA 2A15A 5BVBA 3K0ZA 3NV0A 3FH1A 1O7MB 2XRXB 3G8ZA 3DM8A 3GZBA 2F99A 1A2KA 1C7HA 3GZXB 3NV0B 7STDA 3JUPA 4HZ9B 4CDLA 3T8UA 1S5AA 1BUQA 5EVHA 2XR8B 3F7SA 5JPPA 3A76A 2HMKB 4HZBB 2R4IA 3JUNA 2YFJB 4L7KA 1EA2A 1NWWA 4WP5A 2Z7AA 2HMOB 2K54A 5KP3A 1QMAA 5KP4A 2HMLB 3E99A 3EBTA 1ISKA 3STDA 4HM0B 1JB2A 3MSOA 1E97A 1WQLB 2RGQA 3CNXA 2B24B 3H51A 5IEPA 1ULJB 3B4PA 3DXOA 3JUOA 3MG2A 1GY7A 3OWSA 5BXQA 3F40A 3F8XA 3NM2A 3EX9A 3RGAA 5CXOA 3F8HA 4RZMA 4WYKB 3SOAA 1OF5B 4OUQA 2BMOB 5IG4A 4KVHA 1UUWB 1UUVB 2INXA 2Z76A 2QGUA 3D9RA 3GZRA 4WYKA 3LZAA 3BLZA 4XM4A 2RCDA 1OF5A 1K41A 5AIIA 5CF1A 4PEJA 1JB4A 3FSDA 3M8CA 4J9AA 5AIGA 5DREA 3F14A 3GWRA 1JB5A 5CLKA 1SJWA 2GEYA 4WWUC 2STDA 3FF2A 4HM8B 3EJVA 1NU3A 2YFLB 1DMMA 1GY5A 2CKFB 2OWPA
chains in the Genus database with same CATH superfamily
2GSPA 2CG0A 3IMAB 1EKMA 2UUGC 4LEHA 8CHOA 5HOHA 2KF6A 3EF8A 9RNTA 5RNTA 1BRNL 1VQL3 1UGIA 3G6E3 3PYJA 1TJDA 3S28A 3SEDA 1UUGB 2QA43 2F98A 3AGOA 1I3IA 1TTOA 2P38A 3KZTA 4J5KA 4LGQA 1FYSA 1B2UA 1W02A 4N6NB 1Q9EA 2W9QA 2BMRB 3Q90A 1RMSA 3DGYA 4G1MB 3V92A 3V99A 1CYVA 4KT3B 1UI8A 2KRTA 1IVVA 3NBRA 5TGNA 4MMYB 3CCM3 1RKYA 3CU3A 1YJ93 3QRDA 3D79A 4GL6A 1UI7A 4N3VA 1TFOA 1AV4A 1MWUA 3KN4A 1SQWA 2CFWA 2QEX3 4ILFA 4HM1B 5FGOA 3S67A 1Z1SA 2E2TA 4Q53A 1NB5I 2XGLA 4BTWA 5KP1A 1RGEA 1E3RA 1STDA 2Y73A 3I0YA 2CFKA 2YFIB 1PY3A 2F86B 1BUJA 3UB1A 1GY6A 4BIRA 3CD63 1JBRA 1BSBA 3FCSB 1CQSA 4FMAA 2M7OA 1IVXA 5JBSA 1T5YA 4N6MA 5IG3A 1BANA 3LYGA 4XBXA 2JQ5A 1YIJ3 1DMQA 3WOFB 2LQVA 3JUMA 3O8YA 3I563 3EC9A 2BMQB 1RN1A 3TDGA 3ZG0A 2B1XB 3FZWA 2WOHA 1GMRA 2BNGA 1JRQA 1UGHI 5STDA 1BSEA 3CCJ3 5ELJA 4O02B 1V58A 4ORLA 4MJDA 1FGQA 2IYJA 3GSPA 4OVMA 1JBTA 4NREA 4EW5A 5CK6A 2RFRA 1VQ43 1JKGB 3WHOA 5A0OB 1GOVA 4LMIA 3NUVA 3EN1B 3SX1A 1O7NB 1W00A 2XF3A 2D42A 3FKAA 1EUIC 1ZX2A 3D5IA 5JPUA 1JN5A 2HMMB 2PNCA 1UCJA 1I2FA 3PS8A 3FH1A 4GSPA 1IT8A 1BVIA 3G8ZA 3GZBA 1QALA 2OQEC 1I3FA 4O3VA 1EEJA 4BL2A 3PGBA 4K90B 1S5AA 5GSPA 8RNTA 2CWTA 1AQZA 4LSOA 3D3LA 3JUNA 4EXRA 1VQO3 1N8QA 2XFTA 4NPBA 3LTAA 2MC8A 2LYXA 2Z7AA 4H61A 1K9M4 2K0MA 1S723 1A67A 1BRSA 4J5GA 3STDA 1JB2A 2XFSA 1PU4A 3H51A 2CH9A 4NHFA 3B4PA 3FG1A 3JUOA 1Q814 2P0XA 1CH0A 5G1LA 3HOHA 2FXTA 1RCKA 1RJOA 5CXOA 3F8HA 4WYKB 3SOAA 4EV2A 3DGNA 4OUQA 2GU1A 1IU7A 1FUSA 1N9JA 1RGCA 1UUWB 2AADA 1UUVB 2Z76A 1D6YA 4WYKA 3GZRA 1R4CA 3LZAA 3AMOB 4PEJA 1JB4A 1RGHA 2KAAA 3FSDA 1RHLA 4J9AA 5AIGA 2H0IA 4I5QA 1CYUA 1B20A 3BNEA 1YGEA 2GEYA 5CLKA 1JJ22 2STDA 1X1YA 4HM8B 1SIHA 1NU3A 1DMMA 1B27A 2CKFB 4HM7B 3QK9A 1C54A 1W6CA 1GOYA 1OPYA 3UJMA 4AEQA 3X3ZA 5AI1A 3DZLA 3NQZA 1BRHA 1NNVA 3OXAA 1M9GA 1U5OA 1T2HA 1SARA 3GAXA 4K1VA 1AVKA 1ZS7A 1OHPA 2W0QA 3UNLA 1MWTA 1LVNA 1Q824 4BTXA 3NBBA 2V1LA 3NM7A 1X1WA 4R9LA 3FGYA 3GZYB 3Q1CA 4BU4A 4HJLB 1A90A 3JVCA 3OX9A 3ZG5A 5BVBA 4R1KA 5LC7A 6GSPA 4R9KA 5IG5A 1BRKA 3LH4A 1LOXA 2Q07A 3MYTA 1MNLA 5DRVA 3JUQA 1VQ83 3HK4A 1VQQA 1V57A 3CCQ3 1ASKA 3F9SA 3OWYA 1B2SA 1BNGA 4ZM8A 1BU4A 4FR9A 1FGRA 1TRPA 1A2PA 2CFDA 2UGIA 3DUKA 1MGWA 1W5ZA 3KSPA 4I4KA 7GSPA 1W2B2 2HOHA 3BNCA 2FGTA 1QJGA 1N5HA 4HM2B 4HM5B 4U13A 4MEIA 1K734 5AIHA 1M1K4 2C4BA 1A2VA 1BSAA 1OHOA 1WNHA 5HGRA 3KIIA 1Q40B 3DMCA 1BNFA 4XBTA 1DVDA 3GRDA 3X42A 1TFKA 2GEXA 1NJI4 4STDA 4IIAA 3VSYA 3BNBA 3B7CA 1YJN3 2HMNB 2I9WA 1DMNA 3CPOA 2BHMA 3OW22 1O7HB 1VZZA 1JN5B 4CDLA 1YI23 4RNYA 1O7GB 3HIGA 1HKXA 3KE7A 1AY7A 1TIJA 3LOYA 3B4OA 3KSED 1DETA 2IMJA 3HX8A 3KKGA 2IUJA 2CIUA 1B2ZA 4BL3A 2A15A 2SARA 1MOLA 1QAKA 3G4S3 1JZDA 1K28A 3DM8A 4AKYA 3CMA3 3RNTA 1A2KA 3GZXB 3AHSA 1STFI 2XGNA 1I0VA 3T8UA 1FGMA 1ROVA 4N6V0 2XR8B 1YNVX 1NB3I 3D4AA 5JPPA 2OOVA 2HMKB 2WGQA 2WO0A 1GMPA 5ELUA 1EA2A 1T2IA 1IVUA 4WP5A 1IQXA 3UL6A 2AAEA 5KP4A 1Q864 1ISKA 3ZFZA 3CC23 1RRHA 2F56A 1KD14 2B24B 4RNTA 5IEPA 1ULJB 1VQ73 4FCZA 3CCU3 1IK3A 1QVG2 1IQYA 1GY7A 3F40A 3RGAA 2ZA4A 2FNQA 3SVAA 4JRFA 4RZMA 1WMNA 3K63A 4LYLB 1US1A 3WDGB 1OF5B 1DE3A 2BMOB 2OTJ3 3LTDA 1VQ63 2BO9B 2QGUA 1SIIA 1OF5A 1K41A 2W9PA 3HI7A 1BIRA 5M1AA 2E2UA 3SXXA 3M8CA 3G713 3CPW2 1M904 1VQN3 1DYUA 3KCHA 3GWRA 1SJWA 1B2MA 4WWUC 4KZ1A 2YFLB 3X41A 2RCDA 5AIFA 4TX4A 1OGXA 5D83A 5BIRA 4XBYA 1FZUA 2CX1A 4BTYA 1RGAA 6RNTA 3F7XA 2PZVA 1YJW3 1IT7A 1KC84 2WGOA 5I97A 3URPA 1IDPA 1W4NA 3IPTA 2OCTA 4XB5A 3EBYA 1OGZA 3CME3 1NO3A 1OCVA 2J8XB 1L5GB 1E3VA 3NX0A 3G0KA 3N9HA 3CCR3 4FCMA 5CF2A 1FW7A 3DGOA 4L8PA 4MMZB 5EQLA 1D6ZA 1WTHA 3Q3FA 4IPBA 1YIT3 2IY2A 3K9MC 3CNMA 2GXFA 3ER7A 3NXJA 2CWVA 1IVWA 3EN8A 3NBJA 1CEWI 1I2GA 1RN7A 3DH2A 1W6YA 2KCDA 1GYBA 3ECFA 3MG1A 3MHEA 2ML6A 1QVF2 4EC6A 4X2HA 3RDEA 1IV9A 2OTL3 2Z77A 2IA7A 4AKZA 5IG0A 3B8LA 1VQ53 3OWUA 2QIYA 1EG9B 4IT7A 1I70A 5G1KA 1VQK3 1JZOA 1BAOA 4XDWA 1O7PB 1G02A 1B2XA 3U1WA 2MF7A 1EQKA 1N5PA 3PCRA 3FG3A 1OH0A 3T0UA 3HZPA 5D82A 3LT9A 1I0XA 1GD4A 1Q40A 2H0GA 5IENA 1BSCA 3AGNA 3X3XA 3I553 2GBWB 2O3OA 1ZGXA 3DY5A 1TU5A 3N54B 5D81A 1MWRA 1LQMB 3LXUX 3DGMA 4HM4B 1Q42A 5BU4A 2XSHB 1O7WB 1D6UA 2XSOB 3EQQB 3WOEB 5AEWB 4HVNA 4R4KA 3PZWA 1YVSA 1BGSA 1BSDA 2CW9A 1W2ZA 2ML5A 4HKVB 1LNHA 3SOYA 4HAAA 4KFDA 1UCKA 3K0ZA 3NV0A 5LC6A 3CC43 1RGKA 1RLSA 1RRLA 2C10A 2F99A 3NV0B 2BT3A 3LTBA 4GHOA 2Z6BA 1GMQA 3CXC2 5EVHA 1BOXA 2F5MA 4FMDA 2L1SA 1MGRA 1W6GA 3A76A 1BNIA 2IUKA 1J2BA 2CX0A 2RNTA 2RSXA 2O9UX 2YFJB 1WMOA 2YX9A 1NWWA 1K8A4 2KF4A 1UDII 2HMOB 1I8VA 4HBRA 5KP3A 1QMAA 1X1XA 2BIRA 2HMLB 3EB8A 2W56A 3MSOA 1N9EA 1WQLB 2RGQA 3HIIA 3S29A 3K5TA 2W56B 3OWSA 4RNZA 3AHWA 3EX9A 3CCV3 1Q7Y4 1FGTA 2KF5A 1W7CA 4HYZA 1VQM3 1LQGC 4N6TA 3D5GA 4CJNA 1VQ93 3PXMA 3S27A 1UCIA 3WA3A 5CF1A 4KFEA 1FGOA 4EV5A 1VQP3 2OOVC 5EEOA 1BNRA 1RTUA 3FF2A 3N8BA 3EJVA 3T8NA 3X3YA 2W03A 2P05A 3WMDA 1NDOB 3VGNA 1LOYA 4N6UA 1KWIA 1KSIA 1M1XB 2WOFA 5IEOA 1RDSA 1Y4KA 4H3UA 4N6LA 2SBLA 1LRAA 1HU9A 2W04A 4CPKA 5AYRB 2D1WA 1RGFA 4HM3B 1ZO2A 4J8TA 1YHQ3 1FUTA 3L0RA 1YVBI 3H3HA 2UX0A 4HM6B 1BRIA 1TP6A 1ROAA 4WHAA 3LTCA 1RGLA 3VF1A 3SLUA 1IQ8A 1AVLA 2HMJB 1UCLA 5FW5A 4L7KA 3G16A 3K7CA 3LT8A 1R4YA 4FMBA 4GB5A 1IV7A 2CWUA 1YGWA 2L4VA 1B21A 3BB9A 3RGRA 5M19A 4LZIA 1KQS2 1JV2B 6STDA 4HOHA 1G96A 2C11A 1IYYA 1T3BA 1AR0A 4OK0A 1OACA 1DVCA 3ROBA 2GBXB 1RNBA 1U8CB 2F4YA 4K61A 1OHSA 3WODG 1RSNA 3WA2X 1BRGA 3NQYA 4RBNA 1PYLA 1BNEA 1ULIB 4L8OA 5IERA 3SYUA 3FLJA 3KFQC 2W2CA 3NHXA 2GU3A 1TUHA 5M18A 1FA3A 1PFPA 3EE1A 3BU4A 5AEUB 1TRQA 1Q7HA 1JNQA 1W01A 1GOUA 3OV4A 4X2OA 3U97A 4EBGA 4XDVA 4K1UA 2OQEA 3FF0A 4O2HA 2CFGA 2H0HA 3CCS3 5IF6A 3MKIA 1GS3A 4WFOA 2CHCA 2ZDJA 3EHCA 4HM0B 2BU4A 4QWTA 3WR2A 1RGGA 3Q2PA 1JKGA 3DGLA 1RNTA 4FCJA 3S5CA 1X1UA 3BNDA 3MG3A 2E2VA 1F8NA 1FUWA 1O7MB 2XRXB 3IJEB 2ZHXB 1N8R4 2XEPA 4KFFA 1C7HA 4DKIA 7STDA 1WMPA 1B3SA 1LNIA 3JUPA 4HZ9B 4R80A 2KXGA 5IW9A 1BNJA 1BUQA 2F5WA 3CCL3 3F7SA 1GSPA 1RCLA 4HZBB 1BRJA 2R4IA 3A5EA 4CCVA 4N6OB 3FG4A 3CC73 2JDIH 1RN4A 3PCSA 1LOVA 1SPUA 2K54A 3V98A 1GD3A 3E99A 3ALAA 3EBTA 2R41A 1JBSA 2K3DA 1E97A 1LOWA 3LMLA 3CNXA 2ZL8A 1HZ1A 3DXOA 3MG2A 5BXQA 3F8XA 1I2EA 3NM2A 3X40A 3BIRA 1UW1A 2CC3A 2CFLA 4FMCA 2W6JH 4KVHA 2CG1A 5IG4A 2CK3H 2INXA 3D9RA 2P0MA 4XM4A 5AIIA 2RBIA 4EYCA 3BLZA 2KF3A 2Y74A 1LXEA 1MWSA 3UL5A 4JF8A 4MMXB 1QAFA 4O8SA 5DREA 3J7Yd 1HYFA 5AYSC 7RNTA 3AMOA 2XH9A 1JB5A 1BNSA 1V74A 3F14A 3MWZA 3CCE3 2P09A 1G0TA 3MPHA 5G2GA 1GY5A 1OUNA 2OWPA
chains in the Genus database with same CATH topology
2CG0A 3IMAB 1EKMA 8CHOA 4LEHA 1VQL3 3EF8A 3G6E3 3PYJA 3S28A 3SEDA 2QA43 2F98A 2P38A 4LGQA 3KZTA 4N6NB 1W02A 3V99A 2W9QA 2BMRB 3Q90A 4G1MB 3V92A 1CYVA 1UI8A 2KRTA 1IVVA 3NBRA 5TGNA 4MMYB 3CCM3 1RKYA 3CU3A 1YJ93 3QRDA 4GL6A 1UI7A 4N3VA 1TFOA 1AV4A 3KN4A 1SQWA 2CFWA 2QEX3 4HM1B 5FGOA 3S67A 1Z1SA 2E2TA 4Q53A 1NB5I 2XGLA 4BTWA 1OUNA 5KP1A 1E3RA 1STDA 2Y73A 3I0YA 2CFKA 2YFIB 2F86B 3UB1A 1GY6A 3CD63 3FCSB 1CQSA 4FMAA 2M7OA 1IVXA 1T5YA 4N6MA 5IG3A 1YIJ3 3LYGA 4XBXA 2JQ5A 1DMQA 3WOFB 2LQVA 3JUMA 3O8YA 3I563 3EC9A 2BMQB 3TDGA 2B1XB 3FZWA 2WOHA 2BNGA 1JRQA 5STDA 3CCJ3 5ELJA 4O02B 4ORLA 4MJDA 1FGQA 4OVMA 4NREA 5CK6A 2RFRA 1VQ43 1JKGB 5A0OB 4LMIA 3NUVA 3EN1B 3SX1A 1O7NB 1W00A 2XF3A 2D42A 3FKAA 1ZX2A 5JPUA 1JN5A 2HMMB 2PNCA 3PS8A 3FH1A 1IT8A 3G8ZA 3GZBA 1QALA 2OQEC 4O3VA 3PGBA 4K90B 1S5AA 2CWTA 4LSOA 3D3LA 3JUNA 4EXRA 1VQO3 1N8QA 2XFTA 2MC8A 3LTAA 2LYXA 2Z7AA 4H61A 1K9M4 2K0MA 1S723 1A67A 3STDA 1JB2A 2XFSA 1PU4A 3H51A 2CH9A 4NHFA 3B4PA 3FG1A 3JUOA 1Q814 2P0XA 2FXTA 1RJOA 5CXOA 3F8HA 4WYKB 3SOAA 4EV2A 3DGNA 4OUQA 2GU1A 1IU7A 1N9JA 1UUWB 1UUVB 2Z76A 1D6YA 4WYKA 3GZRA 1R4CA 3LZAA 3AMOB 4PEJA 1JB4A 3FSDA 4J9AA 5AIGA 1CYUA 5CLKA 3BNEA 1YGEA 2GEYA 1JJ22 2STDA 4HM8B 1SIHA 1NU3A 1DMMA 2CKFB 4HM7B 3QK9A 1W6CA 1OPYA 3UJMA 4AEQA 3X3ZA 5AI1A 3DZLA 3NQZA 3OXAA 1M9GA 1U5OA 4K1VA 3GAXA 1AVKA 1OHPA 2W0QA 3UNLA 1LVNA 1Q824 4BTXA 3NBBA 2V1LA 3NM7A 4R9LA 3FGYA 3GZYB 3Q1CA 4HJLB 1A90A 3JVCA 3OX9A 5BVBA 4R1KA 5LC7A 4R9KA 5IG5A 3LH4A 1LOXA 2Q07A 3MYTA 1MNLA 5DRVA 3JUQA 1VQ83 3HK4A 3CCQ3 1ASKA 3F9SA 3OWYA 4ZM8A 4FR9A 1FGRA 1W2B2 2CFDA 3DUKA 1W5ZA 4I4KA 3KSPA 3BNCA 2FGTA 1QJGA 1N5HA 4HM2B 4HM5B 4U13A 4MEIA 1K734 5AIHA 1M1K4 1A2VA 1OHOA 1WNHA 5HGRA 3KIIA 1Q40B 3DMCA 4XBTA 1DVDA 3GRDA 3X42A 1TFKA 2GEXA 1NJI4 4STDA 4IIAA 3VSYA 3BNBA 3B7CA 1YJN3 2HMNB 2I9WA 1DMNA 3CPOA 2BHMA 3OW22 1O7HB 1VZZA 1JN5B 4CDLA 1YI23 4RNYA 1O7GB 3HIGA 1HKXA 3KE7A 1TIJA 3LOYA 3B4OA 3KSED 2IMJA 3HX8A 3KKGA 2IUJA 2CIUA 2A15A 1MOLA 1QAKA 3G4S3 1K28A 3DM8A 4AKYA 3CMA3 1A2KA 3GZXB 1STFI 2XGNA 3T8UA 1FGMA 1ROVA 4N6V0 2XR8B 1NB3I 5JPPA 2OOVA 2HMKB 2WGQA 2WO0A 5ELUA 1EA2A 1IVUA 4WP5A 1IQXA 3UL6A 5KP4A 1Q864 1ISKA 3CC23 1RRHA 1KD14 2B24B 5IEPA 1ULJB 1VQ73 4FCZA 3CCU3 1IK3A 1QVG2 1IQYA 1GY7A 3F40A 3RGAA 2FNQA 3SVAA 4JRFA 4RZMA 1WMNA 3K63A 1US1A 3WDGB 1OF5B 2BMOB 2OTJ3 3LTDA 1VQ63 2BO9B 2QGUA 1SIIA 1OF5A 1K41A 2W9PA 3HI7A 1M904 3SXXA 2E2UA 3M8CA 3CPW2 1VQN3 1DYUA 3GWRA 1SJWA 4WWUC 4KZ1A 2YFLB 3X41A 2RCDA 5AIFA 4TX4A 1OGXA 5D83A 4XBYA 4BTYA 3F7XA 2PZVA 1YJW3 1IT7A 1KC84 2WGOA 5I97A 1IDPA 1W4NA 3IPTA 2OCTA 4XB5A 3EBYA 1OGZA 3CME3 1NO3A 1OCVA 1L5GB 1E3VA 3NX0A 3G0KA 3N9HA 3CCR3 4FCMA 5CF2A 3DGOA 4L8PA 4MMZB 5EQLA 1D6ZA 1WTHA 4IPBA 1YIT3 3K9MC 3NXJA 3CNMA 2GXFA 3ER7A 2CWVA 1IVWA 3EN8A 3NBJA 1CEWI 1RN7A 1W6YA 2KCDA 1GYBA 3ECFA 3MG1A 3MHEA 2ML6A 1QVF2 4EC6A 4X2HA 3RDEA 1IV9A 2OTL3 2Z77A 2IA7A 4AKZA 5IG0A 3B8LA 1VQ53 3OWUA 2QIYA 1EG9B 4IT7A 1VQK3 4XDWA 1O7PB 3U1WA 2MF7A 1EQKA 1N5PA 3PCRA 3FG3A 1OH0A 3T0UA 3HZPA 5D82A 3LT9A 1Q40A 1GD4A 5IENA 3X3XA 3I553 2GBWB 2O3OA 3DY5A 1TU5A 3N54B 5D81A 4HM4B 3LXUX 3DGMA 1Q42A 2XSHB 1O7WB 1D6UA 2XSOB 3EQQB 3WOEB 5AEWB 4HVNA 4R4KA 3PZWA 2CW9A 1W2ZA 2ML5A 4HKVB 1LNHA 3SOYA 4KFDA 3K0ZA 3NV0A 5LC6A 3CC43 1RRLA 2C10A 2F99A 3NV0B 2BT3A 3LTBA 2Z6BA 3CXC2 5EVHA 4FMDA 1W6GA 3A76A 1J2BA 2IUKA 2RSXA 2O9UX 2YFJB 1WMOA 2YX9A 1NWWA 1K8A4 2HMOB 4HBRA 5KP3A 1QMAA 3EB8A 2HMLB 2W56A 3MSOA 1N9EA 1WQLB 2RGQA 3HIIA 3S29A 3K5TA 2W56B 3OWSA 4RNZA 3EX9A 3CCV3 1Q7Y4 1FGTA 1W7CA 4HYZA 1VQM3 1VQ93 4N6TA 3PXMA 3S27A 3WA3A 5CF1A 4KFEA 1FGOA 4EV5A 1VQP3 2OOVC 5EEOA 3FF2A 3N8BA 3T8NA 3X3YA 2W03A 2P05A 3WMDA 1NDOB 3VGNA 4N6UA 1KWIA 1KSIA 1M1XB 2WOFA 5IEOA 1Y4KA 4H3UA 4N6LA 2SBLA 1HU9A 2W04A 5AYRB 2D1WA 4HM3B 1ZO2A 4J8TA 1YHQ3 3L0RA 1YVBI 3H3HA 2UX0A 4HM6B 1TP6A 1ROAA 4WHAA 3LTCA 3VF1A 3SLUA 1IQ8A 1AVLA 2HMJB 5FW5A 4L7KA 3G16A 3K7CA 3LT8A 4GB5A 4FMBA 1IV7A 2CWUA 2L4VA 3BB9A 3RGRA 4LZIA 1KQS2 1JV2B 6STDA 1G96A 2C11A 1AR0A 4OK0A 1OACA 1DVCA 3ROBA 2GBXB 1U8CB 4K61A 1OHSA 3WODG 3WA2X 3NQYA 4RBNA 5IERA 1ULIB 4L8OA 3FLJA 3KFQC 2W2CA 3NHXA 2GU3A 1TUHA 1FA3A 1PFPA 3EE1A 5AEUB 3G713 1JNQA 1W01A 3U97A 3OV4A 4X2OA 4EBGA 4XDVA 4K1UA 2OQEA 3FF0A 4O2HA 2CFGA 3CCS3 5IF6A 3MKIA 1GS3A 4WFOA 2CHCA 2ZDJA 3EHCA 4HM0B 4QWTA 3Q2PA 1JKGA 3DGLA 3S5CA 4FCJA 1FUWA 3BNDA 3MG3A 2E2VA 1F8NA 1O7MB 2XRXB 3IJEB 1N8R4 2XEPA 4KFFA 1C7HA 7STDA 1WMPA 3JUPA 4HZ9B 4R80A 5IW9A 2KXGA 1BUQA 3CCL3 3F7SA 4HZBB 2R4IA 4CCVA 4N6OB 3FG4A 3CC73 2JDIH 3V98A 3PCSA 1SPUA 2K54A 1GD3A 3E99A 3ALAA 3EBTA 1E97A 3LMLA 3CNXA 2ZL8A 3DXOA 3MG2A 5BXQA 3F8XA 3NM2A 3X40A 1UW1A 2CC3A 2CFLA 4FMCA 2W6JH 4KVHA 2CG1A 5IG4A 2CK3H 2INXA 3D9RA 2P0MA 4XM4A 5AIIA 4EYCA 3BLZA 2Y74A 1LXEA 3UL5A 4JF8A 4MMXB 1QAFA 4O8SA 5DREA 3J7Yd 5AYSC 3AMOA 2XH9A 1JB5A 3F14A 1V74A 3MWZA 3CCE3 2P09A 5JBSA 3MPHA 5G2GA 1GY5A 3EJVA 2OWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGX A;  5D83 A;  4XBY A;  3WMD A;  1NDO B;  3VGN A;  1OPY A;  4LEH A;  8CHO A;  3UJM A;  3EF8 A;  5AI1 A;  4LGQ A;  3DZL A;  5IEO A;  3F7X A;  2PZV A;  4H3U A;  3OXA A;  3SED A;  1U5O A;  2F98 A;  1IDP A;  3IPT A;  3KZT A;  4HM3 B;  4K1V A;  3EBY A;  1OGZ A;  1W02 A;  1ZO2 A;  4J8T A;  1OCV A;  4XB5 A;  2BMR B;  3Q90 A;  1E3V A;  1OHP A;  3G0K A;  3UNL A;  3H3H A;  2UX0 A;  3T8N A;  4FCM A;  4HM6 B;  3NBR A;  5CF2 A;  5TGN A;  4L8P A;  1TP6 A;  3CU3 A;  4R9L A;  4N3V A;  2HMJ B;  3FGY A;  3GZY B;  3NXJ A;  5FW5 A;  3CNM A;  2GXF A;  3ER7 A;  3G16 A;  3K7C A;  3OX9 A;  4HJL B;  3EN8 A;  1Z1S A;  4GB5 A;  4HM1 B;  4Q53 A;  4R1K A;  4R9K A;  5AEW B;  5IG5 A;  1OUN A;  1W6Y A;  5KP1 A;  3BB9 A;  1E3R A;  1GYB A;  1STD A;  3ECF A;  3I0Y A;  3MG1 A;  3MHE A;  3MYT A;  2YFI B;  3JUQ A;  2F86 B;  5DRV A;  3HK4 A;  4X2H A;  3VSY A;  1GY6 A;  4HM7 B;  6STD A;  1ASK A;  2Z77 A;  3F9S A;  5IG0 A;  3OWY A;  3B8L A;  1CQS A;  1AR0 A;  3OWU A;  2QIY A;  1EG9 B;  2GBX B;  3ROB A;  3RGR A;  4XDW A;  5IG3 A;  5JPU A;  3LYG A;  4XBX A;  1O7P B;  1OHS A;  2JQ5 A;  1DMQ A;  3DUK A;  3JUM A;  4I4K A;  3KSP A;  5IER A;  3EC9 A;  1ULI B;  2BMQ B;  4L8O A;  1QJG A;  3SOY A;  3FLJ A;  2B1X B;  2W2C A;  3NHX A;  1TUH A;  1OH0 A;  3FZW A;  4HM2 B;  4HM5 B;  3HZP A;  4U13 A;  5AEU B;  1W01 A;  5D82 A;  3OV4 A;  4X2O A;  2BNG A;  5AIF A;  1Q40 A;  4XDV A;  4K1U A;  5AIH A;  5STD A;  5IEN A;  4ORL A;  1OHO A;  3FF0 A;  4MJD A;  2GBW B;  5G2G A;  5HGR A;  1Q40 B;  3DMC A;  4XBT A;  5D81 A;  3GRD A;  4OVM A;  5IF6 A;  3MKI A;  2GEX A;  1GS3 A;  4HM4 B;  5CK6 A;  4STD A;  2RFR A;  4IIA A;  2CHC A;  1Q42 A;  3B7C A;  3EHC A;  2HMN B;  1JKG B;  1DMN A;  1O7W B;  2I9W A;  2XSH B;  1O7H B;  1VZZ A;  1JN5 B;  2XSO B;  3CPO A;  3EQQ B;  3EN1 B;  1O7G B;  3NUV A;  4HVN A;  4LMI A;  1O7N B;  1HKX A;  1W00 A;  3KE7 A;  4HKV B;  3B4O A;  1JKG A;  2IMJ A;  1ZX2 A;  3FKA A;  3HX8 A;  3KKG A;  1JN5 A;  2HMM B;  3MG3 A;  4FCJ A;  3S5C A;  2A15 A;  5BVB A;  3K0Z A;  3NV0 A;  3FH1 A;  1O7M B;  2XRX B;  3G8Z A;  3DM8 A;  3GZB A;  2F99 A;  1A2K A;  1C7H A;  3GZX B;  3NV0 B;  7STD A;  3JUP A;  4HZ9 B;  4CDL A;  3T8U A;  1S5A A;  1BUQ A;  5EVH A;  2XR8 B;  3F7S A;  5JPP A;  3A76 A;  2HMK B;  4HZB B;  2R4I A;  3JUN A;  2YFJ B;  4L7K A;  1EA2 A;  1NWW A;  4WP5 A;  2Z7A A;  2HMO B;  2K54 A;  5KP3 A;  1QMA A;  5KP4 A;  2HML B;  3E99 A;  3EBT A;  1ISK A;  3STD A;  4HM0 B;  1JB2 A;  3MSO A;  1E97 A;  1WQL B;  2RGQ A;  3CNX A;  2B24 B;  3H51 A;  5IEP A;  1ULJ B;  3B4P A;  3DXO A;  3JUO A;  3MG2 A;  1GY7 A;  3OWS A;  5BXQ A;  3F40 A;  3F8X A;  3NM2 A;  3EX9 A;  3RGA A;  5CXO A;  3F8H A;  4RZM A;  4WYK B;  3SOA A;  1OF5 B;  4OUQ A;  2BMO B;  5IG4 A;  4KVH A;  1UUW B;  1UUV B;  2INX A;  2Z76 A;  2QGU A;  3D9R A;  3GZR A;  4WYK A;  3LZA A;  3BLZ A;  4XM4 A;  2RCD A;  1OF5 A;  1K41 A;  5AII A;  5CF1 A;  4PEJ A;  1JB4 A;  3FSD A;  3M8C A;  4J9A A;  5AIG A;  5DRE A;  3F14 A;  3GWR A;  1JB5 A;  5CLK A;  1SJW A;  2GEY A;  4WWU C;  2STD A;  3FF2 A;  4HM8 B;  3EJV A;  1NU3 A;  2YFL B;  1DMM A;  1GY5 A;  2CKF B;  2OWP A; 
#chains in the Genus database with same CATH topology
 2GSP A;  2CG0 A;  3IMA B;  1EKM A;  2UUG C;  4LEH A;  8CHO A;  5HOH A;  2KF6 A;  3EF8 A;  9RNT A;  5RNT A;  1BRN L;  1VQL 3;  1UGI A;  3G6E 3;  3PYJ A;  1TJD A;  3S28 A;  3SED A;  1UUG B;  2QA4 3;  2F98 A;  3AGO A;  1I3I A;  1TTO A;  2P38 A;  3KZT A;  4J5K A;  4LGQ A;  1FYS A;  1B2U A;  1W02 A;  4N6N B;  1Q9E A;  2W9Q A;  2BMR B;  3Q90 A;  1RMS A;  3DGY A;  4G1M B;  3V92 A;  3V99 A;  1CYV A;  4KT3 B;  1UI8 A;  2KRT A;  1IVV A;  3NBR A;  5TGN A;  4MMY B;  3CCM 3;  1RKY A;  3CU3 A;  1YJ9 3;  3QRD A;  3D79 A;  4GL6 A;  1UI7 A;  4N3V A;  1TFO A;  1AV4 A;  1MWU A;  3KN4 A;  1SQW A;  2CFW A;  2QEX 3;  4ILF A;  4HM1 B;  5FGO A;  3S67 A;  1Z1S A;  2E2T A;  4Q53 A;  1NB5 I;  2XGL A;  4BTW A;  5KP1 A;  1RGE A;  1E3R A;  1STD A;  2Y73 A;  3I0Y A;  2CFK A;  2YFI B;  1PY3 A;  2F86 B;  1BUJ A;  3UB1 A;  1GY6 A;  4BIR A;  3CD6 3;  1JBR A;  1BSB A;  3FCS B;  1CQS A;  4FMA A;  2M7O A;  1IVX A;  5JBS A;  1T5Y A;  4N6M A;  5IG3 A;  1BAN A;  3LYG A;  4XBX A;  2JQ5 A;  1YIJ 3;  1DMQ A;  3WOF B;  2LQV A;  3JUM A;  3O8Y A;  3I56 3;  3EC9 A;  2BMQ B;  1RN1 A;  3TDG A;  3ZG0 A;  2B1X B;  3FZW A;  2WOH A;  1GMR A;  2BNG A;  1JRQ A;  1UGH I;  5STD A;  1BSE A;  3CCJ 3;  5ELJ A;  4O02 B;  1V58 A;  4ORL A;  4MJD A;  1FGQ A;  2IYJ A;  3GSP A;  4OVM A;  1JBT A;  4NRE A;  4EW5 A;  5CK6 A;  2RFR A;  1VQ4 3;  1JKG B;  3WHO A;  5A0O B;  1GOV A;  4LMI A;  3NUV A;  3EN1 B;  3SX1 A;  1O7N B;  1W00 A;  2XF3 A;  2D42 A;  3FKA A;  1EUI C;  1ZX2 A;  3D5I A;  5JPU A;  1JN5 A;  2HMM B;  2PNC A;  1UCJ A;  1I2F A;  3PS8 A;  3FH1 A;  4GSP A;  1IT8 A;  1BVI A;  3G8Z A;  3GZB A;  1QAL A;  2OQE C;  1I3F A;  4O3V A;  1EEJ A;  4BL2 A;  3PGB A;  4K90 B;  1S5A A;  5GSP A;  8RNT A;  2CWT A;  1AQZ A;  4LSO A;  3D3L A;  3JUN A;  4EXR A;  1VQO 3;  1N8Q A;  2XFT A;  4NPB A;  3LTA A;  2MC8 A;  2LYX A;  2Z7A A;  4H61 A;  1K9M 4;  2K0M A;  1S72 3;  1A67 A;  1BRS A;  4J5G A;  3STD A;  1JB2 A;  2XFS A;  1PU4 A;  3H51 A;  2CH9 A;  4NHF A;  3B4P A;  3FG1 A;  3JUO A;  1Q81 4;  2P0X A;  1CH0 A;  5G1L A;  3HOH A;  2FXT A;  1RCK A;  1RJO A;  5CXO A;  3F8H A;  4WYK B;  3SOA A;  4EV2 A;  3DGN A;  4OUQ A;  2GU1 A;  1IU7 A;  1FUS A;  1N9J A;  1RGC A;  1UUW B;  2AAD A;  1UUV B;  2Z76 A;  1D6Y A;  4WYK A;  3GZR A;  1R4C A;  3LZA A;  3AMO B;  4PEJ A;  1JB4 A;  1RGH A;  2KAA A;  3FSD A;  1RHL A;  4J9A A;  5AIG A;  2H0I A;  4I5Q A;  1CYU A;  1B20 A;  3BNE A;  1YGE A;  2GEY A;  5CLK A;  1JJ2 2;  2STD A;  1X1Y A;  4HM8 B;  1SIH A;  1NU3 A;  1DMM A;  1B27 A;  2CKF B;  4HM7 B;  3QK9 A;  1C54 A;  1W6C A;  1GOY A;  1OPY A;  3UJM A;  4AEQ A;  3X3Z A;  5AI1 A;  3DZL A;  3NQZ A;  1BRH A;  1NNV A;  3OXA A;  1M9G A;  1U5O A;  1T2H A;  1SAR A;  3GAX A;  4K1V A;  1AVK A;  1ZS7 A;  1OHP A;  2W0Q A;  3UNL A;  1MWT A;  1LVN A;  1Q82 4;  4BTX A;  3NBB A;  2V1L A;  3NM7 A;  1X1W A;  4R9L A;  3FGY A;  3GZY B;  3Q1C A;  4BU4 A;  4HJL B;  1A90 A;  3JVC A;  3OX9 A;  3ZG5 A;  5BVB A;  4R1K A;  5LC7 A;  6GSP A;  4R9K A;  5IG5 A;  1BRK A;  3LH4 A;  1LOX A;  2Q07 A;  3MYT A;  1MNL A;  5DRV A;  3JUQ A;  1VQ8 3;  3HK4 A;  1VQQ A;  1V57 A;  3CCQ 3;  1ASK A;  3F9S A;  3OWY A;  1B2S A;  1BNG A;  4ZM8 A;  1BU4 A;  4FR9 A;  1FGR A;  1TRP A;  1A2P A;  2CFD A;  2UGI A;  3DUK A;  1MGW A;  1W5Z A;  3KSP A;  4I4K A;  7GSP A;  1W2B 2;  2HOH A;  3BNC A;  2FGT A;  1QJG A;  1N5H A;  4HM2 B;  4HM5 B;  4U13 A;  4MEI A;  1K73 4;  5AIH A;  1M1K 4;  2C4B A;  1A2V A;  1BSA A;  1OHO A;  1WNH A;  5HGR A;  3KII A;  1Q40 B;  3DMC A;  1BNF A;  4XBT A;  1DVD A;  3GRD A;  3X42 A;  1TFK A;  2GEX A;  1NJI 4;  4STD A;  4IIA A;  3VSY A;  3BNB A;  3B7C A;  1YJN 3;  2HMN B;  2I9W A;  1DMN A;  3CPO A;  2BHM A;  3OW2 2;  1O7H B;  1VZZ A;  1JN5 B;  4CDL A;  1YI2 3;  4RNY A;  1O7G B;  3HIG A;  1HKX A;  3KE7 A;  1AY7 A;  1TIJ A;  3LOY A;  3B4O A;  3KSE D;  1DET A;  2IMJ A;  3HX8 A;  3KKG A;  2IUJ A;  2CIU A;  1B2Z A;  4BL3 A;  2A15 A;  2SAR A;  1MOL A;  1QAK A;  3G4S 3;  1JZD A;  1K28 A;  3DM8 A;  4AKY A;  3CMA 3;  3RNT A;  1A2K A;  3GZX B;  3AHS A;  1STF I;  2XGN A;  1I0V A;  3T8U A;  1FGM A;  1ROV A;  4N6V 0;  2XR8 B;  1YNV X;  1NB3 I;  3D4A A;  5JPP A;  2OOV A;  2HMK B;  2WGQ A;  2WO0 A;  1GMP A;  5ELU A;  1EA2 A;  1T2I A;  1IVU A;  4WP5 A;  1IQX A;  3UL6 A;  2AAE A;  5KP4 A;  1Q86 4;  1ISK A;  3ZFZ A;  3CC2 3;  1RRH A;  2F56 A;  1KD1 4;  2B24 B;  4RNT A;  5IEP A;  1ULJ B;  1VQ7 3;  4FCZ A;  3CCU 3;  1IK3 A;  1QVG 2;  1IQY A;  1GY7 A;  3F40 A;  3RGA A;  2ZA4 A;  2FNQ A;  3SVA A;  4JRF A;  4RZM A;  1WMN A;  3K63 A;  4LYL B;  1US1 A;  3WDG B;  1OF5 B;  1DE3 A;  2BMO B;  2OTJ 3;  3LTD A;  1VQ6 3;  2BO9 B;  2QGU A;  1SII A;  1OF5 A;  1K41 A;  2W9P A;  3HI7 A;  1BIR A;  5M1A A;  2E2U A;  3SXX A;  3M8C A;  3G71 3;  3CPW 2;  1M90 4;  1VQN 3;  1DYU A;  3KCH A;  3GWR A;  1SJW A;  1B2M A;  4WWU C;  4KZ1 A;  2YFL B;  3X41 A;  2RCD A;  5AIF A;  4TX4 A;  1OGX A;  5D83 A;  5BIR A;  4XBY A;  1FZU A;  2CX1 A;  4BTY A;  1RGA A;  6RNT A;  3F7X A;  2PZV A;  1YJW 3;  1IT7 A;  1KC8 4;  2WGO A;  5I97 A;  3URP A;  1IDP A;  1W4N A;  3IPT A;  2OCT A;  4XB5 A;  3EBY A;  1OGZ A;  3CME 3;  1NO3 A;  1OCV A;  2J8X B;  1L5G B;  1E3V A;  3NX0 A;  3G0K A;  3N9H A;  3CCR 3;  4FCM A;  5CF2 A;  1FW7 A;  3DGO A;  4L8P A;  4MMZ B;  5EQL A;  1D6Z A;  1WTH A;  3Q3F A;  4IPB A;  1YIT 3;  2IY2 A;  3K9M C;  3CNM A;  2GXF A;  3ER7 A;  3NXJ A;  2CWV A;  1IVW A;  3EN8 A;  3NBJ A;  1CEW I;  1I2G A;  1RN7 A;  3DH2 A;  1W6Y A;  2KCD A;  1GYB A;  3ECF A;  3MG1 A;  3MHE A;  2ML6 A;  1QVF 2;  4EC6 A;  4X2H A;  3RDE A;  1IV9 A;  2OTL 3;  2Z77 A;  2IA7 A;  4AKZ A;  5IG0 A;  3B8L A;  1VQ5 3;  3OWU A;  2QIY A;  1EG9 B;  4IT7 A;  1I70 A;  5G1K A;  1VQK 3;  1JZO A;  1BAO A;  4XDW A;  1O7P B;  1G02 A;  1B2X A;  3U1W A;  2MF7 A;  1EQK A;  1N5P A;  3PCR A;  3FG3 A;  1OH0 A;  3T0U A;  3HZP A;  5D82 A;  3LT9 A;  1I0X A;  1GD4 A;  1Q40 A;  2H0G A;  5IEN A;  1BSC A;  3AGN A;  3X3X A;  3I55 3;  2GBW B;  2O3O A;  1ZGX A;  3DY5 A;  1TU5 A;  3N54 B;  5D81 A;  1MWR A;  1LQM B;  3LXU X;  3DGM A;  4HM4 B;  1Q42 A;  5BU4 A;  2XSH B;  1O7W B;  1D6U A;  2XSO B;  3EQQ B;  3WOE B;  5AEW B;  4HVN A;  4R4K A;  3PZW A;  1YVS A;  1BGS A;  1BSD A;  2CW9 A;  1W2Z A;  2ML5 A;  4HKV B;  1LNH A;  3SOY A;  4HAA A;  4KFD A;  1UCK A;  3K0Z A;  3NV0 A;  5LC6 A;  3CC4 3;  1RGK A;  1RLS A;  1RRL A;  2C10 A;  2F99 A;  3NV0 B;  2BT3 A;  3LTB A;  4GHO A;  2Z6B A;  1GMQ A;  3CXC 2;  5EVH A;  1BOX A;  2F5M A;  4FMD A;  2L1S A;  1MGR A;  1W6G A;  3A76 A;  1BNI A;  2IUK A;  1J2B A;  2CX0 A;  2RNT A;  2RSX A;  2O9U X;  2YFJ B;  1WMO A;  2YX9 A;  1NWW A;  1K8A 4;  2KF4 A;  1UDI I;  2HMO B;  1I8V A;  4HBR A;  5KP3 A;  1QMA A;  1X1X A;  2BIR A;  2HML B;  3EB8 A;  2W56 A;  3MSO A;  1N9E A;  1WQL B;  2RGQ A;  3HII A;  3S29 A;  3K5T A;  2W56 B;  3OWS A;  4RNZ A;  3AHW A;  3EX9 A;  3CCV 3;  1Q7Y 4;  1FGT A;  2KF5 A;  1W7C A;  4HYZ A;  1VQM 3;  1LQG C;  4N6T A;  3D5G A;  4CJN A;  1VQ9 3;  3PXM A;  3S27 A;  1UCI A;  3WA3 A;  5CF1 A;  4KFE A;  1FGO A;  4EV5 A;  1VQP 3;  2OOV C;  5EEO A;  1BNR A;  1RTU A;  3FF2 A;  3N8B A;  3EJV A;  3T8N A;  3X3Y A;  2W03 A;  2P05 A;  3WMD A;  1NDO B;  3VGN A;  1LOY A;  4N6U A;  1KWI A;  1KSI A;  1M1X B;  2WOF A;  5IEO A;  1RDS A;  1Y4K A;  4H3U A;  4N6L A;  2SBL A;  1LRA A;  1HU9 A;  2W04 A;  4CPK A;  5AYR B;  2D1W A;  1RGF A;  4HM3 B;  1ZO2 A;  4J8T A;  1YHQ 3;  1FUT A;  3L0R A;  1YVB I;  3H3H A;  2UX0 A;  4HM6 B;  1BRI A;  1TP6 A;  1ROA A;  4WHA A;  3LTC A;  1RGL A;  3VF1 A;  3SLU A;  1IQ8 A;  1AVL A;  2HMJ B;  1UCL A;  5FW5 A;  4L7K A;  3G16 A;  3K7C A;  3LT8 A;  1R4Y A;  4FMB A;  4GB5 A;  1IV7 A;  2CWU A;  1YGW A;  2L4V A;  1B21 A;  3BB9 A;  3RGR A;  5M19 A;  4LZI A;  1KQS 2;  1JV2 B;  6STD A;  4HOH A;  1G96 A;  2C11 A;  1IYY A;  1T3B A;  1AR0 A;  4OK0 A;  1OAC A;  1DVC A;  3ROB A;  2GBX B;  1RNB A;  1U8C B;  2F4Y A;  4K61 A;  1OHS A;  3WOD G;  1RSN A;  3WA2 X;  1BRG A;  3NQY A;  4RBN A;  1PYL A;  1BNE A;  1ULI B;  4L8O A;  5IER A;  3SYU A;  3FLJ A;  3KFQ C;  2W2C A;  3NHX A;  2GU3 A;  1TUH A;  5M18 A;  1FA3 A;  1PFP A;  3EE1 A;  3BU4 A;  5AEU B;  1TRQ A;  1Q7H A;  1JNQ A;  1W01 A;  1GOU A;  3OV4 A;  4X2O A;  3U97 A;  4EBG A;  4XDV A;  4K1U A;  2OQE A;  3FF0 A;  4O2H A;  2CFG A;  2H0H A;  3CCS 3;  5IF6 A;  3MKI A;  1GS3 A;  4WFO A;  2CHC A;  2ZDJ A;  3EHC A;  4HM0 B;  2BU4 A;  4QWT A;  3WR2 A;  1RGG A;  3Q2P A;  1JKG A;  3DGL A;  1RNT A;  4FCJ A;  3S5C A;  1X1U A;  3BND A;  3MG3 A;  2E2V A;  1F8N A;  1FUW A;  1O7M B;  2XRX B;  3IJE B;  2ZHX B;  1N8R 4;  2XEP A;  4KFF A;  1C7H A;  4DKI A;  7STD A;  1WMP A;  1B3S A;  1LNI A;  3JUP A;  4HZ9 B;  4R80 A;  2KXG A;  5IW9 A;  1BNJ A;  1BUQ A;  2F5W A;  3CCL 3;  3F7S A;  1GSP A;  1RCL A;  4HZB B;  1BRJ A;  2R4I A;  3A5E A;  4CCV A;  4N6O B;  3FG4 A;  3CC7 3;  2JDI H;  1RN4 A;  3PCS A;  1LOV A;  1SPU A;  2K54 A;  3V98 A;  1GD3 A;  3E99 A;  3ALA A;  3EBT A;  2R41 A;  1JBS A;  2K3D A;  1E97 A;  1LOW A;  3LML A;  3CNX A;  2ZL8 A;  1HZ1 A;  3DXO A;  3MG2 A;  5BXQ A;  3F8X A;  1I2E A;  3NM2 A;  3X40 A;  3BIR A;  1UW1 A;  2CC3 A;  2CFL A;  4FMC A;  2W6J H;  4KVH A;  2CG1 A;  5IG4 A;  2CK3 H;  2INX A;  3D9R A;  2P0M A;  4XM4 A;  5AII A;  2RBI A;  4EYC A;  3BLZ A;  2KF3 A;  2Y74 A;  1LXE A;  1MWS A;  3UL5 A;  4JF8 A;  4MMX B;  1QAF A;  4O8S A;  5DRE A;  3J7Y d;  1HYF A;  5AYS C;  7RNT A;  3AMO A;  2XH9 A;  1JB5 A;  1BNS A;  1V74 A;  3F14 A;  3MWZ A;  3CCE 3;  2P09 A;  1G0T A;  3MPH A;  5G2G A;  1GY5 A;  1OUN A;  2OWP A; 
#chains in the Genus database with same CATH homology
 2CG0 A;  3IMA B;  1EKM A;  8CHO A;  4LEH A;  1VQL 3;  3EF8 A;  3G6E 3;  3PYJ A;  3S28 A;  3SED A;  2QA4 3;  2F98 A;  2P38 A;  4LGQ A;  3KZT A;  4N6N B;  1W02 A;  3V99 A;  2W9Q A;  2BMR B;  3Q90 A;  4G1M B;  3V92 A;  1CYV A;  1UI8 A;  2KRT A;  1IVV A;  3NBR A;  5TGN A;  4MMY B;  3CCM 3;  1RKY A;  3CU3 A;  1YJ9 3;  3QRD A;  4GL6 A;  1UI7 A;  4N3V A;  1TFO A;  1AV4 A;  3KN4 A;  1SQW A;  2CFW A;  2QEX 3;  4HM1 B;  5FGO A;  3S67 A;  1Z1S A;  2E2T A;  4Q53 A;  1NB5 I;  2XGL A;  4BTW A;  1OUN A;  5KP1 A;  1E3R A;  1STD A;  2Y73 A;  3I0Y A;  2CFK A;  2YFI B;  2F86 B;  3UB1 A;  1GY6 A;  3CD6 3;  3FCS B;  1CQS A;  4FMA A;  2M7O A;  1IVX A;  1T5Y A;  4N6M A;  5IG3 A;  1YIJ 3;  3LYG A;  4XBX A;  2JQ5 A;  1DMQ A;  3WOF B;  2LQV A;  3JUM A;  3O8Y A;  3I56 3;  3EC9 A;  2BMQ B;  3TDG A;  2B1X B;  3FZW A;  2WOH A;  2BNG A;  1JRQ A;  5STD A;  3CCJ 3;  5ELJ A;  4O02 B;  4ORL A;  4MJD A;  1FGQ A;  4OVM A;  4NRE A;  5CK6 A;  2RFR A;  1VQ4 3;  1JKG B;  5A0O B;  4LMI A;  3NUV A;  3EN1 B;  3SX1 A;  1O7N B;  1W00 A;  2XF3 A;  2D42 A;  3FKA A;  1ZX2 A;  5JPU A;  1JN5 A;  2HMM B;  2PNC A;  3PS8 A;  3FH1 A;  1IT8 A;  3G8Z A;  3GZB A;  1QAL A;  2OQE C;  4O3V A;  3PGB A;  4K90 B;  1S5A A;  2CWT A;  4LSO A;  3D3L A;  3JUN A;  4EXR A;  1VQO 3;  1N8Q A;  2XFT A;  2MC8 A;  3LTA A;  2LYX A;  2Z7A A;  4H61 A;  1K9M 4;  2K0M A;  1S72 3;  1A67 A;  3STD A;  1JB2 A;  2XFS A;  1PU4 A;  3H51 A;  2CH9 A;  4NHF A;  3B4P A;  3FG1 A;  3JUO A;  1Q81 4;  2P0X A;  2FXT A;  1RJO A;  5CXO A;  3F8H A;  4WYK B;  3SOA A;  4EV2 A;  3DGN A;  4OUQ A;  2GU1 A;  1IU7 A;  1N9J A;  1UUW B;  1UUV B;  2Z76 A;  1D6Y A;  4WYK A;  3GZR A;  1R4C A;  3LZA A;  3AMO B;  4PEJ A;  1JB4 A;  3FSD A;  4J9A A;  5AIG A;  1CYU A;  5CLK A;  3BNE A;  1YGE A;  2GEY A;  1JJ2 2;  2STD A;  4HM8 B;  1SIH A;  1NU3 A;  1DMM A;  2CKF B;  4HM7 B;  3QK9 A;  1W6C A;  1OPY A;  3UJM A;  4AEQ A;  3X3Z A;  5AI1 A;  3DZL A;  3NQZ A;  3OXA A;  1M9G A;  1U5O A;  4K1V A;  3GAX A;  1AVK A;  1OHP A;  2W0Q A;  3UNL A;  1LVN A;  1Q82 4;  4BTX A;  3NBB A;  2V1L A;  3NM7 A;  4R9L A;  3FGY A;  3GZY B;  3Q1C A;  4HJL B;  1A90 A;  3JVC A;  3OX9 A;  5BVB A;  4R1K A;  5LC7 A;  4R9K A;  5IG5 A;  3LH4 A;  1LOX A;  2Q07 A;  3MYT A;  1MNL A;  5DRV A;  3JUQ A;  1VQ8 3;  3HK4 A;  3CCQ 3;  1ASK A;  3F9S A;  3OWY A;  4ZM8 A;  4FR9 A;  1FGR A;  1W2B 2;  2CFD A;  3DUK A;  1W5Z A;  4I4K A;  3KSP A;  3BNC A;  2FGT A;  1QJG A;  1N5H A;  4HM2 B;  4HM5 B;  4U13 A;  4MEI A;  1K73 4;  5AIH A;  1M1K 4;  1A2V A;  1OHO A;  1WNH A;  5HGR A;  3KII A;  1Q40 B;  3DMC A;  4XBT A;  1DVD A;  3GRD A;  3X42 A;  1TFK A;  2GEX A;  1NJI 4;  4STD A;  4IIA A;  3VSY A;  3BNB A;  3B7C A;  1YJN 3;  2HMN B;  2I9W A;  1DMN A;  3CPO A;  2BHM A;  3OW2 2;  1O7H B;  1VZZ A;  1JN5 B;  4CDL A;  1YI2 3;  4RNY A;  1O7G B;  3HIG A;  1HKX A;  3KE7 A;  1TIJ A;  3LOY A;  3B4O A;  3KSE D;  2IMJ A;  3HX8 A;  3KKG A;  2IUJ A;  2CIU A;  2A15 A;  1MOL A;  1QAK A;  3G4S 3;  1K28 A;  3DM8 A;  4AKY A;  3CMA 3;  1A2K A;  3GZX B;  1STF I;  2XGN A;  3T8U A;  1FGM A;  1ROV A;  4N6V 0;  2XR8 B;  1NB3 I;  5JPP A;  2OOV A;  2HMK B;  2WGQ A;  2WO0 A;  5ELU A;  1EA2 A;  1IVU A;  4WP5 A;  1IQX A;  3UL6 A;  5KP4 A;  1Q86 4;  1ISK A;  3CC2 3;  1RRH A;  1KD1 4;  2B24 B;  5IEP A;  1ULJ B;  1VQ7 3;  4FCZ A;  3CCU 3;  1IK3 A;  1QVG 2;  1IQY A;  1GY7 A;  3F40 A;  3RGA A;  2FNQ A;  3SVA A;  4JRF A;  4RZM A;  1WMN A;  3K63 A;  1US1 A;  3WDG B;  1OF5 B;  2BMO B;  2OTJ 3;  3LTD A;  1VQ6 3;  2BO9 B;  2QGU A;  1SII A;  1OF5 A;  1K41 A;  2W9P A;  3HI7 A;  1M90 4;  3SXX A;  2E2U A;  3M8C A;  3CPW 2;  1VQN 3;  1DYU A;  3GWR A;  1SJW A;  4WWU C;  4KZ1 A;  2YFL B;  3X41 A;  2RCD A;  5AIF A;  4TX4 A;  1OGX A;  5D83 A;  4XBY A;  4BTY A;  3F7X A;  2PZV A;  1YJW 3;  1IT7 A;  1KC8 4;  2WGO A;  5I97 A;  1IDP A;  1W4N A;  3IPT A;  2OCT A;  4XB5 A;  3EBY A;  1OGZ A;  3CME 3;  1NO3 A;  1OCV A;  1L5G B;  1E3V A;  3NX0 A;  3G0K A;  3N9H A;  3CCR 3;  4FCM A;  5CF2 A;  3DGO A;  4L8P A;  4MMZ B;  5EQL A;  1D6Z A;  1WTH A;  4IPB A;  1YIT 3;  3K9M C;  3NXJ A;  3CNM A;  2GXF A;  3ER7 A;  2CWV A;  1IVW A;  3EN8 A;  3NBJ A;  1CEW I;  1RN7 A;  1W6Y A;  2KCD A;  1GYB A;  3ECF A;  3MG1 A;  3MHE A;  2ML6 A;  1QVF 2;  4EC6 A;  4X2H A;  3RDE A;  1IV9 A;  2OTL 3;  2Z77 A;  2IA7 A;  4AKZ A;  5IG0 A;  3B8L A;  1VQ5 3;  3OWU A;  2QIY A;  1EG9 B;  4IT7 A;  1VQK 3;  4XDW A;  1O7P B;  3U1W A;  2MF7 A;  1EQK A;  1N5P A;  3PCR A;  3FG3 A;  1OH0 A;  3T0U A;  3HZP A;  5D82 A;  3LT9 A;  1Q40 A;  1GD4 A;  5IEN A;  3X3X A;  3I55 3;  2GBW B;  2O3O A;  3DY5 A;  1TU5 A;  3N54 B;  5D81 A;  4HM4 B;  3LXU X;  3DGM A;  1Q42 A;  2XSH B;  1O7W B;  1D6U A;  2XSO B;  3EQQ B;  3WOE B;  5AEW B;  4HVN A;  4R4K A;  3PZW A;  2CW9 A;  1W2Z A;  2ML5 A;  4HKV B;  1LNH A;  3SOY A;  4KFD A;  3K0Z A;  3NV0 A;  5LC6 A;  3CC4 3;  1RRL A;  2C10 A;  2F99 A;  3NV0 B;  2BT3 A;  3LTB A;  2Z6B A;  3CXC 2;  5EVH A;  4FMD A;  1W6G A;  3A76 A;  1J2B A;  2IUK A;  2RSX A;  2O9U X;  2YFJ B;  1WMO A;  2YX9 A;  1NWW A;  1K8A 4;  2HMO B;  4HBR A;  5KP3 A;  1QMA A;  3EB8 A;  2HML B;  2W56 A;  3MSO A;  1N9E A;  1WQL B;  2RGQ A;  3HII A;  3S29 A;  3K5T A;  2W56 B;  3OWS A;  4RNZ A;  3EX9 A;  3CCV 3;  1Q7Y 4;  1FGT A;  1W7C A;  4HYZ A;  1VQM 3;  1VQ9 3;  4N6T A;  3PXM A;  3S27 A;  3WA3 A;  5CF1 A;  4KFE A;  1FGO A;  4EV5 A;  1VQP 3;  2OOV C;  5EEO A;  3FF2 A;  3N8B A;  3T8N A;  3X3Y A;  2W03 A;  2P05 A;  3WMD A;  1NDO B;  3VGN A;  4N6U A;  1KWI A;  1KSI A;  1M1X B;  2WOF A;  5IEO A;  1Y4K A;  4H3U A;  4N6L A;  2SBL A;  1HU9 A;  2W04 A;  5AYR B;  2D1W A;  4HM3 B;  1ZO2 A;  4J8T A;  1YHQ 3;  3L0R A;  1YVB I;  3H3H A;  2UX0 A;  4HM6 B;  1TP6 A;  1ROA A;  4WHA A;  3LTC A;  3VF1 A;  3SLU A;  1IQ8 A;  1AVL A;  2HMJ B;  5FW5 A;  4L7K A;  3G16 A;  3K7C A;  3LT8 A;  4GB5 A;  4FMB A;  1IV7 A;  2CWU A;  2L4V A;  3BB9 A;  3RGR A;  4LZI A;  1KQS 2;  1JV2 B;  6STD A;  1G96 A;  2C11 A;  1AR0 A;  4OK0 A;  1OAC A;  1DVC A;  3ROB A;  2GBX B;  1U8C B;  4K61 A;  1OHS A;  3WOD G;  3WA2 X;  3NQY A;  4RBN A;  5IER A;  1ULI B;  4L8O A;  3FLJ A;  3KFQ C;  2W2C A;  3NHX A;  2GU3 A;  1TUH A;  1FA3 A;  1PFP A;  3EE1 A;  5AEU B;  3G71 3;  1JNQ A;  1W01 A;  3U97 A;  3OV4 A;  4X2O A;  4EBG A;  4XDV A;  4K1U A;  2OQE A;  3FF0 A;  4O2H A;  2CFG A;  3CCS 3;  5IF6 A;  3MKI A;  1GS3 A;  4WFO A;  2CHC A;  2ZDJ A;  3EHC A;  4HM0 B;  4QWT A;  3Q2P A;  1JKG A;  3DGL A;  3S5C A;  4FCJ A;  1FUW A;  3BND A;  3MG3 A;  2E2V A;  1F8N A;  1O7M B;  2XRX B;  3IJE B;  1N8R 4;  2XEP A;  4KFF A;  1C7H A;  7STD A;  1WMP A;  3JUP A;  4HZ9 B;  4R80 A;  5IW9 A;  2KXG A;  1BUQ A;  3CCL 3;  3F7S A;  4HZB B;  2R4I A;  4CCV A;  4N6O B;  3FG4 A;  3CC7 3;  2JDI H;  3V98 A;  3PCS A;  1SPU A;  2K54 A;  1GD3 A;  3E99 A;  3ALA A;  3EBT A;  1E97 A;  3LML A;  3CNX A;  2ZL8 A;  3DXO A;  3MG2 A;  5BXQ A;  3F8X A;  3NM2 A;  3X40 A;  1UW1 A;  2CC3 A;  2CFL A;  4FMC A;  2W6J H;  4KVH A;  2CG1 A;  5IG4 A;  2CK3 H;  2INX A;  3D9R A;  2P0M A;  4XM4 A;  5AII A;  4EYC A;  3BLZ A;  2Y74 A;  1LXE A;  3UL5 A;  4JF8 A;  4MMX B;  1QAF A;  4O8S A;  5DRE A;  3J7Y d;  5AYS C;  3AMO A;  2XH9 A;  1JB5 A;  3F14 A;  1V74 A;  3MWZ A;  3CCE 3;  2P09 A;  5JBS A;  3MPH A;  5G2G A;  1GY5 A;  3EJV A;  2OWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...