3K7CA

Crystal structure of putative ntf2-like transpeptidase (np_281412.1) from campylobacter jejuni at 2.00 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
SNPEDLAKNFTKDLYSGDTKSVMSYIDLSEAKSDEEKTFVSDKITQVVAENAAKAKRMGGVKDIQIEEKTINKDSAKIRVLVLFNNDNNQSSNVFLAKKDRKWLVLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NTF2-like transpeptidase
publication title Crystal structure of Putative NTF2-like transpeptidase (NP_281412.1) from CAMPYLOBACTER JEJUNI at 2.00 A resolution
rcsb
source organism Campylobacter jejuni
molecule tags Protein binding
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12870 DUF4878 Domain of unknown function (DUF4878)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k7cA00
1JKGA 3NBRA 3G0KA 2XSHB 1ZX2A 3F40A 1OCVA 4U13A 5BXQA 5IG3A 3CNMA 3MG2A 2QIYA 3OWYA 4J9AA 5AEUB 4XDVA 3F7SA 3GZYB 2BMQB 1NWWA 4WYKA 1GY7A 2CKFB 2XRXB 3GWRA 5KP1A 1O7HB 3MKIA 4HVNA 2GBXB 2GXFA 3CPOA 3EN1B 2BMOB 3SEDA 3F14A 5IG0A 1UUVB 5CXOA 5TGNA 3NUVA 5IF6A 1W02A 3OX9A 1GYBA 3F9SA 3SOAA 2BNGA 3JUPA 4I4KA 1K41A 3IPTA 5D82A 2BMRB 4WP5A 5BVBA 5AIIA 1STDA 3OXAA 4HKVB 5CK6A 3HX8A 1CQSA 2HMKB 2JQ5A 1Q40B 3Q90A 1S5AA 3GRDA 3NM2A 3EQQB 2INXA 3NHXA 1Z1SA 1BUQA 3B4OA 2HMOB 2YFJB 1NU3A 3GZBA 3FZWA 1ULJB 3K7CA 3MHEA 3DM8A 3MG3A 3EN8A 1OHPA 3CU3A 3GZRA 3NXJA 1ULIB 5HGRA 5IEOA 4HZBB 2K54A 5CF2A 1O7NB 1Q40A 4H3UA 3OWUA 1JN5A 3FH1A 3G16A 4R9LA 4OVMA 1EG9B 4WYKB 3DZLA 3FSDA 1TP6A 1E3VA 3MG1A 5DREA 1ASKA 1AR0A 3JUQA 3WMDA 3EHCA 3G8ZA 5JPPA 2Z77A 4HM8B 4XDWA 2QGUA 1GY5A 2GBWB 3F7XA 1OUNA 3NV0B 1TUHA 4X2HA 5D81A 4R9KA 1DMQA 2HMMB 3S5CA 3D9RA 3MYTA 2GEYA 3EBYA 5KP3A 2F98A 1WQLB 3KKGA 2HMLB 1SJWA 4Q53A 2B24B 4HM6B 1C7HA 3EC9A 3ROBA 4FCJA 3NV0A 5AIGA 2RFRA 1W6YA 4XB5A 1OPYA 1A2KA 3FF0A 4RZMA 1JB5A 5IENA 4HZ9B 5AIFA 3H3HA 2XR8B 3VSYA 2YFIB 1U5OA 3SOYA 3LZAA 4XM4A 1HKXA 3GZXB 4HJLB 3RGAA 4J8TA 2A15A 2GEXA 3KSPA 2RGQA 3STDA 3ER7A 3K0ZA 3ECFA 5DRVA 1JN5B 4K1UA 3I0YA 5AIHA 3JUOA 5D83A 1O7GB 2W2CA 3DUKA 4N3VA 2PZVA 1QJGA 8CHOA 1JB4A 1O7WB 3FKAA 5G2GA 4HM2B 5FW5A 3HZPA 4HM7B 7STDA 1GS3A 4L7KA 1OHOA 3DXOA 5JPUA 3OV4A 5CF1A 1OHSA 5IEPA 3OWSA 2CHCA 4XBTA 3EJVA 4LEHA 2R4IA 1OGXA 3A76A 5KP4A 1EA2A 4FCMA 4K1VA 3F8HA 4PEJA 1GY6A 1VZZA 3KZTA 3CNXA 5AEWB 1JB2A 1OF5A 2YFLB 4GB5A 2Z76A 1DMNA 3B8LA 6STDA 2UX0A 4LGQA 5CLKA 4LMIA 1NDOB 3KE7A 5STDA 3F8XA 2OWPA 3EX9A 4HM4B 2STDA 4CDLA 2IMJA 4HM5B 3B7CA 5IG4A 4L8OA 3FLJA 3RGRA 3E99A 1OH0A 4OUQA 3UJMA 3JUMA 3EF8A 3DMCA 1OGZA 3M8CA 3LYGA 4R1KA 4KVHA 4ORLA 1E3RA 2F86B 1UUWB 4IIAA 2RCDA 2HMNB 1ISKA 4STDA 3VGNA 4HM0B 1W00A 4X2OA 2XSOB 3BLZA 2I9WA 3UNLA 3BB9A 5IERA 3JUNA 1W01A 5IG5A 1Q42A 1ZO2A 4HM1B 4L8PA 4XBXA 3MSOA 3FF2A 1DMMA 3HK4A 4HM3B 1O7PB 2B1XB 2Z7AA 1OF5B 1JKGB 2F99A 5AI1A 4XBYA 1O7MB 5EVHA 3H51A 3EBTA 2HMJB 1E97A 3T8NA 3B4PA 3FGYA 1QMAA 1IDPA 3T8UA 4MJDA 4WWUC
chains in the Genus database with same CATH superfamily
2MC8A 4BU4A 3A5EA 6RNTA 2O3OA 1JKGA 3Q1CA 1BNRA 4I5QA 5LC6A 2D42A 3NX0A 3PYJA 4BTXA 1FGTA 1K9M4 1MGRA 3NBRA 2RBIA 3G0KA 2Z6BA 2XSHB 1GOVA 1ZX2A 1ROVA 1KC84 1NNVA 1IVVA 3F40A 3K5TA 1OCVA 2WOHA 3NQYA 4U13A 5BXQA 3S27A 1TRQA 1IQ8A 5IG3A 1DVCA 1QALA 1PYLA 3CNMA 3MG2A 3AHSA 4FR9A 4R4KA 1QVG2 1BSEA 2QIYA 3KFQC 3OWYA 4J9AA 3LMLA 1W5ZA 5AEUB 1GSPA 4XDVA 1JV2B 3F7SA 1FGRA 2CIUA 3GZYB 2BMQB 1NO3A 1AV4A 5ELJA 2V1LA 2HOHA 1NWWA 2C11A 1GY7A 4KFDA 4WYKA 4N6UA 2CKFB 3X40A 1GMQA 4AKZA 2XRXB 1RJOA 3CCE3 3GWRA 3WA2X 4BIRA 5KP1A 2F4YA 1LQGC 1RGKA 1B3SA 1O7HB 1UI8A 3MKIA 4HVNA 4ZM8A 1IVXA 3ZG5A 2GBXB 2GXFA 3HIIA 1D6YA 3RNTA 3CPOA 1V58A 3EN1B 3U1WA 4AEQA 5BIRA 2BMOB 3BNCA 3SEDA 1JJ22 1FZUA 2XGNA 3F14A 3ZG0A 5IG0A 3V92A 1UUVB 5CXOA 5TGNA 1EKMA 3WOEB 4EW5A 2P05A 3NUVA 5IF6A 1W02A 1MNLA 3OX9A 1GYBA 3F9SA 3SOAA 4O8SA 1VQ43 2YX9A 1A67A 1RCKA 2BNGA 3FCSB 1UUGB 3JUPA 1W4NA 1BNGA 4I4KA 1B2ZA 1GD4A 2C4BA 1FGMA 1K41A 3Q3FA 3IPTA 3GAXA 3K9MC 5D82A 1N8QA 1GMRA 3O8YA 2BMRB 1AY7A 1M1XB 2JDIH 3CCR3 1LQMB 1BOXA 4WP5A 5BVBA 1ZS7A 5AIIA 1STDA 3OXAA 1DVDA 3PS8A 4HKVB 5CK6A 1DETA 3HX8A 3URPA 3JVCA 1VQL3 2KRTA 1NB3I 1X1YA 3X42A 1CQSA 2W56B 2CW9A 2W6JH 3T0UA 2HMKB 1RRHA 2JQ5A 1Q40B 3MWZA 3Q90A 1S5AA 1YHQ3 3GRDA 3BNEA 3PCRA 3NM2A 2C10A 3EQQB 5I97A 1I3FA 3KCHA 3CCM3 1BRKA 2INXA 3NHXA 1UGHI 1Z1SA 3I553 1BUQA 1DE3A 1MWUA 2KF3A 3B4OA 1VQ63 2HMOB 2YFJB 2W0QA 3G713 2CFLA 1YJ93 4LSOA 1NU3A 3GZBA 3FZWA 1ULJB 1V57A 2XGLA 3K7CA 3FG1A 3MHEA 2CC3A 3DM8A 3MG3A 2FXTA 3EN8A 1JRQA 3UB1A 1Q9EA 5RNTA 4DKIA 1OHPA 1PFPA 1STFI 2IY2A 2OCTA 2WGOA 3CU3A 3GZRA 3G6E3 3WODG 3NXJA 1RN4A 3WHOA 4G1MB 1ULIB 4GSPA 1TFOA 1BRIA 5HGRA 5IEOA 3EB8A 4HZBB 2K54A 1M904 5CF2A 1O7NB 1RMSA 2KF6A 2CWUA 1Q40A 2BT3A 4H3UA 3J7Yd 3QRDA 3OWUA 1IQYA 4RNZA 1JN5A 2BU4A 2UUGC 3FH1A 4LYLB 1JNQA 1UW1A 3S28A 3G16A 3AHWA 4K61A 4R9LA 1MWRA 1IV7A 2QA43 4OVMA 1EG9B 4WYKB 3DZLA 3FSDA 4KFEA 1TP6A 4BL3A 1V74A 2CWVA 1E3VA 3MG1A 5EQLA 5DREA 1BRNL 1ASKA 1N8R4 1BVIA 1AR0A 1YIT3 2ZA4A 3JUQA 1KWIA 1JZDA 2GU3A 4FCZA 2SBLA 8RNTA 1SQWA 1GMPA 3WMDA 1YVBI 3EHCA 3N8BA 1A2PA 3G8ZA 1Q7HA 1U8CB 5JPPA 3ALAA 4BTWA 2Z77A 3L0RA 1TFKA 2Y73A 4HM8B 1BIRA 3PCSA 1Q864 4XDWA 1N5PA 3DGYA 2QGUA 1I0XA 1GY5A 1QAKA 2GBWB 3F7XA 5AYRB 2XEPA 5A0OB 4KT3B 1OUNA 2LQVA 3NV0B 2E2UA 3NBBA 1R4YA 1I2EA 4NHFA 1FUWA 1TUHA 2XF3A 3N54B 1BSCA 1B21A 1G02A 3X3ZA 3X3XA 4X2HA 1LOYA 1WNHA 1TTOA 1VQQA 1I2GA 5D81A 4R9KA 3CCQ3 2E2VA 1RNTA 1IVWA 1GOYA 1DMQA 2WO0A 3V99A 2HMMB 3CC43 3S5CA 1FUTA 3D9RA 1YNVX 3MYTA 1RN1A 1IVUA 1N5HA 2OQEC 4MMZB 2GEYA 7RNTA 3PGBA 1ZGXA 3EBYA 2CFKA 4N6NB 5AYSC 5KP3A 1Q824 1CEWI 1FGOA 1FYSA 1SIHA 1WQLB 2F98A 2ZDJA 3OW22 2L1SA 3GSPA 3KKGA 2WGQA 3TDGA 3V98A 2OTL3 1VQN3 3D79A 2ML6A 2HMLB 1SJWA 4KFFA 4Q53A 2B24B 3IJEB 1C7HA 3LTDA 4HM6B 4HAAA 1HU9A 3EC9A 2CG1A 3ROBA 1LOXA 3BNBA 4FCJA 1RGHA 2FGTA 3CPW2 1BRJA 3NV0A 1JBRA 2ML5A 2CFGA 5AIGA 1CH0A 1SIIA 1UGIA 3DGOA 3X41A 2RFRA 1TIJA 1W6YA 4XB5A 4K90B 1FW7A 1OPYA 3S29A 3BIRA 3HIGA 1A2KA 3FF0A 2F56A 3PXMA 3BNDA 4N6V0 1JB5A 4RZMA 4IT7A 4EV2A 1VQK3 1IU7A 3UL5A 5IENA 3D3LA 4HZ9B 5AIFA 1KQS2 3H3HA 1FA3A 2XR8B 3VSYA 3CC23 2YFIB 1U5OA 3SOYA 3LZAA 1D6ZA 1AVLA 1T3BA 4XM4A 1HKXA 3AGNA 3GZXB 1MWTA 1FGQA 4HJLB 4MMXB 4J8TA 1UCKA 2AADA 2A15A 1PY3A 3RGAA 1BRHA 2KF4A 1I8VA 3IMAB 2GEXA 4KZ1A 3KSPA 4FMAA 2RGQA 1OACA 3STDA 5FGOA 4LZIA 1BANA 1G96A 2AAEA 3ER7A 3I563 3K0ZA 4AKYA 2OTJ3 2L4VA 3ECFA 3LT9A 4J5GA 5DRVA 1BNFA 1BNEA 1JN5B 1LOVA 1RGFA 2ZL8A 3I0YA 4K1UA 3KN4A 5AIHA 3JUOA 5D83A 2KCDA 1O7GB 1S723 2W2CA 2O9UX 3CCL3 3DUKA 1F8NA 2CH9A 4N3VA 3FG4A 2J8XB 2PZVA 1EQKA 1KSIA 2P0XA 4FMCA 1W7CA 4GL6A 1B2UA 1QJGA 8CHOA 4CCVA 1BRSA 1JB4A 1O7WB 4GHOA 3WR2A 1B20A 3FKAA 5G2GA 4HM2B 2E2TA 5FW5A 1T2HA 1VQ83 3SVAA 3CME3 1Y4KA 3LTBA 1LRAA 1N9JA 3DGLA 3HZPA 3DH2A 1JBSA 4O02B 3G4S3 4HM7B 3KSED 1AQZA 1YVSA 1GS3A 4N6MA 7STDA 4EV5A 4L7KA 2K0MA 1UI7A 1OHOA 3DXOA 5JPUA 3OV4A 5LC7A 5CF1A 3CMA3 1OHSA 5IEPA 4NREA 2PNCA 3OWSA 1RKYA 1BAOA 2CHCA 1QAFA 1US1A 1JZOA 4XBTA 4EBGA 1B27A 1J2BA 3EJVA 4LEHA 2CX0A 2R4IA 1LNIA 1MGWA 1OGXA 9RNTA 4MMYB 1M9GA 1T2IA 3A76A 1RCLA 2CWTA 3CC73 3PZWA 1BSBA 4N6OB 1YJN3 1B2XA 1YI23 1YGEA 1VQP3 4WFOA 5G1KA 1KD14 1BSAA 1RGGA 5KP4A 2OOVC 1BU4A 2Q07A 4HBRA 1VQ93 3X3YA 1C54A 2OQEA 1EA2A 4FCMA 2QEX3 2W9PA 1A2VA 2CK3H 1W2ZA 4K1VA 3WA3A 2CX1A 2KXGA 2ZHXB 5ELUA 2KF5A 3F8HA 1GD3A 1RLSA 2W03A 4PEJA 4N6LA 1TRPA 1GY6A 4BTYA 3K63A 1VZZA 3AMOA 4WHAA 3KZTA 3CNXA 4RNTA 5AEWB 3CD63 1JB2A 1OF5A 2RNTA 1YGWA 1RGCA 1X1UA 1Q814 2YFLB 4GB5A 3WOFB 2Z76A 1VQO3 1QVF2 3KIIA 1UCIA 1DMNA 2P38A 1I0VA 2FNQA 3B8LA 2LYXA 2M7OA 3S67A 3ZFZA 3DGMA 6STDA 5JBSA 2GSPA 2UX0A 1LVNA 1B2SA 4LGQA 1WMNA 3FG3A 5CLKA 3CXC2 2F5WA 1Q7Y4 4RBNA 1DYUA 1N9EA 1SARA 1K28A 1LOWA 2H0GA 1W6GA 3CCU3 3SLUA 1AVKA 2D1WA 4LMIA 4RNYA 1UCLA 1YIJ3 1NDOB 2BHMA 3KE7A 1SPUA 4O3VA 1L5GB 3RDEA 3CCJ3 3F8XA 5STDA 3Q2PA 2GU1A 1R4CA 1YJW3 2OWPA 3EX9A 4HM4B 2STDA 4CDLA 2IMJA 4HM5B 3B7CA 5IG4A 1TU5A 1A90A 4L8OA 2P0MA 3AGOA 3FLJA 4J5KA 3E99A 3LOYA 4ILFA 3RGRA 1OH0A 4OUQA 3CCV3 2CFDA 2P09A 4HOHA 3UJMA 1UCJA 2F5MA 2H0HA 2K3DA 1X1WA 3JUMA 1K8A4 3HOHA 3EF8A 3DMCA 1BNIA 1OGZA 1RTUA 6GSPA 3CCS3 3D4AA 3M8CA 1CYUA 3LYGA 4R1KA 3EE1A 1G0TA 1FUSA 4KVHA 4ORLA 1EEJA 2XH9A 1E3RA 1TJDA 2F86B 1UUWB 5BU4A 2R41A 3SYUA 3U97A 1HYFA 4IIAA 5EEOA 3LH4A 3LXUX 2RCDA 4HYZA 1IT8A 3N9HA 4N6TA 2HMNB 1ISKA 4STDA 3VGNA 1IQXA 3NM7A 1IYYA 4H61A 1BUJA 5HOHA 1BNJA 1GOUA 4MEIA 4HM0B 1W00A 1UDII 3DY5A 1M1K4 4X2OA 1I70A 1BSDA 2IUKA 4R80A 1WTHA 2XSOB 1NJI4 3BLZA 2I9WA 1RGAA 3UNLA 5G1LA 2XFSA 1LNHA 1T5YA 1X1XA 3BB9A 3DGNA 5IERA 4IPBA 2MF7A 4FMDA 2CFWA 7GSPA 1EUIC 4BL2A 1PU4A 1RSNA 3JUNA 1RDSA 1W01A 4CPKA 2IUJA 5IG5A 5M18A 1IK3A 1RRLA 3NQZA 2IA7A 1Q42A 3D5IA 3QK9A 1ZO2A 4HM1B 2BO9B 4FMBA 1MWSA 3MPHA 4L8PA 3NBJA 2OOVA 4XBXA 5M1AA 5M19A 3SXXA 2XFTA 4OK0A 3MSOA 3FF2A 1RN7A 3SX1A 1DMMA 3HK4A 3LTAA 3WDGB 2RSXA 4HM3B 4QWTA 3AMOB 2W04A 1O7PB 1W6CA 3LT8A 3VF1A 1RGLA 2B1XB 4EYCA 1NB5I 2WOFA 2CG0A 1OF5B 2Z7AA 1JKGB 2F99A 3BU4A 4O2HA 5IW9A 1K734 2UGIA 5AI1A 4CJNA 1W2B2 1BNSA 2Y74A 3LTCA 4NPBA 1WMOA 4XBYA 5GSPA 2W9QA 1LXEA 1ROAA 1BRGA 1BGSA 1IV9A 1B2MA 1RNBA 1RGEA 4JRFA 1O7MB 5EVHA 3H51A 3EBTA 1VQ73 2SARA 2BIRA 3D5GA 2HMJB 1E97A 2H0IA 2W56A 1VQM3 2IYJA 1IT7A 3T8NA 3B4PA 2KAAA 3FGYA 1WMPA 1I2FA 1CYVA 1I3IA 1JBTA 4EXRA 4EC6A 1QMAA 1IDPA 3T8UA 1D6UA 4MJDA 1VQ53 1HZ1A 1RHLA 4TX4A 3HI7A 4WWUC 1MOLA 4JF8A 3UL6A
chains in the Genus database with same CATH topology
2MC8A 2O3OA 1JKGA 3Q1CA 5LC6A 2D42A 3NX0A 3PYJA 4BTXA 1FGTA 1K9M4 3NBRA 3G0KA 2Z6BA 2XSHB 1ZX2A 1ROVA 1KC84 3K5TA 1IVVA 3F40A 3NQYA 1OCVA 2WOHA 4U13A 5BXQA 3S27A 1IQ8A 5IG3A 1DVCA 1QALA 3CNMA 3MG2A 4FR9A 4R4KA 1QVG2 2QIYA 3KFQC 3OWYA 4J9AA 3LMLA 1W5ZA 5AEUB 4XDVA 1JV2B 3F7SA 1FGRA 2CIUA 3GZYB 2BMQB 1NO3A 1AV4A 5ELJA 2V1LA 1NWWA 2C11A 1GY7A 4KFDA 4WYKA 4N6UA 2CKFB 3X40A 4AKZA 2XRXB 1RJOA 3CCE3 3GWRA 3WA2X 5KP1A 1O7HB 1UI8A 3MKIA 4HVNA 4ZM8A 1IVXA 2GBXB 2GXFA 3HIIA 1D6YA 3CPOA 3EN1B 3U1WA 4AEQA 2BMOB 3BNCA 3SEDA 1JJ22 2XGNA 3F14A 5IG0A 3V92A 1UUVB 5CXOA 5TGNA 1EKMA 3WOEB 2P05A 3NUVA 5IF6A 1W02A 1MNLA 3OX9A 1GYBA 3F9SA 3SOAA 4O8SA 1VQ43 2YX9A 1A67A 2BNGA 3FCSB 3JUPA 1W4NA 4I4KA 1GD4A 1FGMA 1K41A 3IPTA 3GAXA 3K9MC 5D82A 1N8QA 3O8YA 2BMRB 1M1XB 2JDIH 3CCR3 4WP5A 5BVBA 5AIIA 1STDA 3OXAA 1DVDA 3PS8A 4HKVB 5CK6A 3HX8A 3JVCA 1VQL3 2KRTA 1NB3I 3X42A 1CQSA 2W56B 2CW9A 2W6JH 3T0UA 2HMKB 1RRHA 2JQ5A 1Q40B 3MWZA 3Q90A 1S5AA 1YHQ3 3GRDA 3BNEA 3PCRA 3NM2A 2C10A 3EQQB 5I97A 3CCM3 2INXA 3NHXA 1Z1SA 3I553 1BUQA 3B4OA 1VQ63 2HMOB 2YFJB 2W0QA 3G713 2CFLA 1YJ93 4LSOA 1NU3A 3GZBA 3FZWA 1ULJB 3K7CA 2XGLA 3FG1A 3MHEA 2CC3A 3DM8A 3MG3A 2FXTA 3EN8A 1JRQA 3UB1A 1OHPA 1PFPA 1STFI 2OCTA 2WGOA 3CU3A 3GZRA 3G6E3 3WODG 3NXJA 4G1MB 1ULIB 1TFOA 5HGRA 5IEOA 3EB8A 4HZBB 2K54A 1M904 5CF2A 1O7NB 2CWUA 1Q40A 2BT3A 4H3UA 3J7Yd 3QRDA 3OWUA 1IQYA 4RNZA 1JN5A 3FH1A 1JNQA 1UW1A 3S28A 3G16A 4K61A 4R9LA 2QA43 1IV7A 4OVMA 1EG9B 4WYKB 3DZLA 3FSDA 4KFEA 1TP6A 1V74A 2CWVA 1E3VA 3MG1A 5EQLA 5DREA 1ASKA 1N8R4 1AR0A 1YIT3 3JUQA 1KWIA 2GU3A 4FCZA 2SBLA 1SQWA 3WMDA 1YVBI 3EHCA 3N8BA 3G8ZA 1U8CB 5JPPA 3ALAA 4BTWA 2Z77A 3L0RA 1TFKA 2Y73A 4HM8B 3PCSA 1Q864 4XDWA 1N5PA 2QGUA 1GY5A 1QAKA 2GBWB 3F7XA 5AYRB 2XEPA 5A0OB 1OUNA 2LQVA 3NV0B 2E2UA 3NBBA 4NHFA 1FUWA 1TUHA 2XF3A 3N54B 3X3ZA 3X3XA 4X2HA 1WNHA 5D81A 4R9KA 3CCQ3 2E2VA 3CC43 1IVWA 1DMQA 2WO0A 3V99A 2HMMB 3S5CA 3D9RA 3MYTA 4MMZB 1IVUA 1N5HA 2OQEC 2GEYA 3PGBA 4N6NB 3EBYA 2CFKA 5AYSC 5KP3A 1Q824 1CEWI 1FGOA 1SIHA 2ZDJA 1WQLB 2F98A 3OW22 3KKGA 2WGQA 3TDGA 3V98A 2OTL3 1VQN3 2ML6A 2HMLB 1SJWA 4KFFA 4Q53A 2B24B 3IJEB 1C7HA 3LTDA 4HM6B 1HU9A 3EC9A 2CG1A 3ROBA 1LOXA 3BNBA 4FCJA 2FGTA 3CPW2 3NV0A 2ML5A 2CFGA 5AIGA 1SIIA 3DGOA 3X41A 2RFRA 1TIJA 1W6YA 4XB5A 4K90B 1OPYA 3S29A 3HIGA 1A2KA 3FF0A 3PXMA 4RZMA 3BNDA 4N6V0 1JB5A 4EV2A 4IT7A 1VQK3 1IU7A 3UL5A 5IENA 3D3LA 4HZ9B 5AIFA 1KQS2 3H3HA 1FA3A 2XR8B 3VSYA 3CC23 2YFIB 1U5OA 3SOYA 3LZAA 1D6ZA 1AVLA 4XM4A 1HKXA 3GZXB 1FGQA 4HJLB 4MMXB 4J8TA 3RGAA 2A15A 3IMAB 2GEXA 4KZ1A 3KSPA 4FMAA 2RGQA 1OACA 3STDA 5FGOA 4LZIA 1G96A 3ER7A 3I563 3K0ZA 4AKYA 2OTJ3 2L4VA 3ECFA 3LT9A 5DRVA 1JN5B 4K1UA 2ZL8A 3I0YA 3KN4A 5AIHA 3JUOA 5D83A 2KCDA 1O7GB 1S723 2W2CA 2O9UX 3CCL3 3DUKA 1F8NA 2CH9A 4N3VA 3FG4A 2PZVA 1EQKA 1KSIA 2P0XA 4FMCA 1W7CA 4GL6A 1QJGA 8CHOA 4CCVA 1JB4A 1O7WB 3FKAA 5G2GA 4HM2B 2E2TA 5FW5A 3SVAA 3CME3 1Y4KA 3LTBA 3DGLA 1N9JA 3HZPA 4O02B 3G4S3 4HM7B 3KSED 4N6MA 7STDA 1GS3A 4EV5A 4L7KA 2K0MA 1UI7A 1OHOA 3DXOA 5JPUA 3OV4A 5LC7A 5CF1A 3CMA3 1OHSA 5IEPA 4NREA 2PNCA 3OWSA 1RKYA 2CHCA 1QAFA 1US1A 4XBTA 4EBGA 1J2BA 3EJVA 4LEHA 2R4IA 1OGXA 4MMYB 1M9GA 3A76A 2CWTA 3CC73 3PZWA 4N6OB 1YJN3 1YI23 1YGEA 1VQP3 4WFOA 1KD14 5KP4A 2OOVC 2Q07A 4HBRA 1VQ93 3X3YA 2OQEA 1EA2A 4FCMA 2QEX3 2W9PA 1A2VA 2CK3H 1W2ZA 4K1VA 3WA3A 2KXGA 5ELUA 3F8HA 1GD3A 2W03A 4PEJA 4N6LA 1GY6A 4BTYA 3K63A 1VZZA 3AMOA 4WHAA 3KZTA 3CNXA 3CD63 5AEWB 1JB2A 1OF5A 1Q814 2YFLB 4GB5A 3WOFB 2Z76A 1VQO3 1QVF2 3KIIA 1DMNA 2P38A 2FNQA 5JBSA 3B8LA 2LYXA 2M7OA 3S67A 6STDA 3DGMA 1VQ83 2UX0A 1LVNA 4LGQA 1WMNA 3FG3A 5CLKA 3CXC2 1Q7Y4 4RBNA 1DYUA 1N9EA 1K28A 1W6GA 3CCU3 3SLUA 1AVKA 2D1WA 4LMIA 4RNYA 1YIJ3 1NDOB 2BHMA 3KE7A 1SPUA 4O3VA 1L5GB 3RDEA 3CCJ3 3F8XA 5STDA 3Q2PA 2GU1A 1R4CA 1YJW3 2OWPA 3EX9A 4HM4B 2STDA 4CDLA 2IMJA 4HM5B 3B7CA 5IG4A 1TU5A 1A90A 4L8OA 2P0MA 3FLJA 3RGRA 3E99A 3LOYA 1OH0A 4OUQA 3CCV3 2CFDA 2P09A 3UJMA 3JUMA 1K8A4 3EF8A 3DMCA 1OGZA 3CCS3 3M8CA 1CYUA 3LYGA 4R1KA 3EE1A 4KVHA 4ORLA 2XH9A 1E3RA 2F86B 1UUWB 3U97A 4IIAA 5EEOA 3LH4A 3LXUX 2RCDA 4HYZA 1IT8A 3N9HA 4N6TA 2HMNB 1ISKA 4STDA 3VGNA 1IQXA 3NM7A 4H61A 4MEIA 4HM0B 1W00A 3DY5A 1M1K4 4X2OA 4R80A 2IUKA 1WTHA 2XSOB 1NJI4 3BLZA 2I9WA 3UNLA 2XFSA 1LNHA 1T5YA 3DGNA 3BB9A 5IERA 4IPBA 2MF7A 4FMDA 2CFWA 1PU4A 3JUNA 1W01A 2IUJA 5IG5A 1IK3A 1RRLA 3NQZA 2IA7A 1Q42A 3QK9A 1ZO2A 4HM1B 2BO9B 4FMBA 3MPHA 4L8PA 3NBJA 2OOVA 4XBXA 3SXXA 2XFTA 4OK0A 3MSOA 3FF2A 1RN7A 3SX1A 1DMMA 3HK4A 3LTAA 3WDGB 2RSXA 4HM3B 4QWTA 3AMOB 2W04A 1O7PB 1W6CA 3LT8A 3VF1A 4EYCA 2B1XB 1NB5I 2WOFA 2CG0A 1OF5B 2Z7AA 1JKGB 2F99A 4O2HA 5IW9A 1K734 5AI1A 1W2B2 2Y74A 3LTCA 4XBYA 1WMOA 2W9QA 1LXEA 1ROAA 1IV9A 4JRFA 1O7MB 5EVHA 3H51A 3EBTA 1VQ73 2HMJB 1E97A 2W56A 1VQM3 1IT7A 3T8NA 3B4PA 3FGYA 1WMPA 1CYVA 4EXRA 4EC6A 1QMAA 1IDPA 3T8UA 1D6UA 4MJDA 1VQ53 4TX4A 3HI7A 4WWUC 1MOLA 4JF8A 3UL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKG A;  3NBR A;  3G0K A;  2XSH B;  1ZX2 A;  3F40 A;  1OCV A;  4U13 A;  5BXQ A;  5IG3 A;  3CNM A;  3MG2 A;  2QIY A;  3OWY A;  4J9A A;  5AEU B;  4XDV A;  3F7S A;  3GZY B;  2BMQ B;  1NWW A;  4WYK A;  1GY7 A;  2CKF B;  2XRX B;  3GWR A;  5KP1 A;  1O7H B;  3MKI A;  4HVN A;  2GBX B;  2GXF A;  3CPO A;  3EN1 B;  2BMO B;  3SED A;  3F14 A;  5IG0 A;  1UUV B;  5CXO A;  5TGN A;  3NUV A;  5IF6 A;  1W02 A;  3OX9 A;  1GYB A;  3F9S A;  3SOA A;  2BNG A;  3JUP A;  4I4K A;  1K41 A;  3IPT A;  5D82 A;  2BMR B;  4WP5 A;  5BVB A;  5AII A;  1STD A;  3OXA A;  4HKV B;  5CK6 A;  3HX8 A;  1CQS A;  2HMK B;  2JQ5 A;  1Q40 B;  3Q90 A;  1S5A A;  3GRD A;  3NM2 A;  3EQQ B;  2INX A;  3NHX A;  1Z1S A;  1BUQ A;  3B4O A;  2HMO B;  2YFJ B;  1NU3 A;  3GZB A;  3FZW A;  1ULJ B;  3K7C A;  3MHE A;  3DM8 A;  3MG3 A;  3EN8 A;  1OHP A;  3CU3 A;  3GZR A;  3NXJ A;  1ULI B;  5HGR A;  5IEO A;  4HZB B;  2K54 A;  5CF2 A;  1O7N B;  1Q40 A;  4H3U A;  3OWU A;  1JN5 A;  3FH1 A;  3G16 A;  4R9L A;  4OVM A;  1EG9 B;  4WYK B;  3DZL A;  3FSD A;  1TP6 A;  1E3V A;  3MG1 A;  5DRE A;  1ASK A;  1AR0 A;  3JUQ A;  3WMD A;  3EHC A;  3G8Z A;  5JPP A;  2Z77 A;  4HM8 B;  4XDW A;  2QGU A;  1GY5 A;  2GBW B;  3F7X A;  1OUN A;  3NV0 B;  1TUH A;  4X2H A;  5D81 A;  4R9K A;  1DMQ A;  2HMM B;  3S5C A;  3D9R A;  3MYT A;  2GEY A;  3EBY A;  5KP3 A;  2F98 A;  1WQL B;  3KKG A;  2HML B;  1SJW A;  4Q53 A;  2B24 B;  4HM6 B;  1C7H A;  3EC9 A;  3ROB A;  4FCJ A;  3NV0 A;  5AIG A;  2RFR A;  1W6Y A;  4XB5 A;  1OPY A;  1A2K A;  3FF0 A;  4RZM A;  1JB5 A;  5IEN A;  4HZ9 B;  5AIF A;  3H3H A;  2XR8 B;  3VSY A;  2YFI B;  1U5O A;  3SOY A;  3LZA A;  4XM4 A;  1HKX A;  3GZX B;  4HJL B;  3RGA A;  4J8T A;  2A15 A;  2GEX A;  3KSP A;  2RGQ A;  3STD A;  3ER7 A;  3K0Z A;  3ECF A;  5DRV A;  1JN5 B;  4K1U A;  3I0Y A;  5AIH A;  3JUO A;  5D83 A;  1O7G B;  2W2C A;  3DUK A;  4N3V A;  2PZV A;  1QJG A;  8CHO A;  1JB4 A;  1O7W B;  3FKA A;  5G2G A;  4HM2 B;  5FW5 A;  3HZP A;  4HM7 B;  7STD A;  1GS3 A;  4L7K A;  1OHO A;  3DXO A;  5JPU A;  3OV4 A;  5CF1 A;  1OHS A;  5IEP A;  3OWS A;  2CHC A;  4XBT A;  3EJV A;  4LEH A;  2R4I A;  1OGX A;  3A76 A;  5KP4 A;  1EA2 A;  4FCM A;  4K1V A;  3F8H A;  4PEJ A;  1GY6 A;  1VZZ A;  3KZT A;  3CNX A;  5AEW B;  1JB2 A;  1OF5 A;  2YFL B;  4GB5 A;  2Z76 A;  1DMN A;  3B8L A;  6STD A;  2UX0 A;  4LGQ A;  5CLK A;  4LMI A;  1NDO B;  3KE7 A;  5STD A;  3F8X A;  2OWP A;  3EX9 A;  4HM4 B;  2STD A;  4CDL A;  2IMJ A;  4HM5 B;  3B7C A;  5IG4 A;  4L8O A;  3FLJ A;  3RGR A;  3E99 A;  1OH0 A;  4OUQ A;  3UJM A;  3JUM A;  3EF8 A;  3DMC A;  1OGZ A;  3M8C A;  3LYG A;  4R1K A;  4KVH A;  4ORL A;  1E3R A;  2F86 B;  1UUW B;  4IIA A;  2RCD A;  2HMN B;  1ISK A;  4STD A;  3VGN A;  4HM0 B;  1W00 A;  4X2O A;  2XSO B;  3BLZ A;  2I9W A;  3UNL A;  3BB9 A;  5IER A;  3JUN A;  1W01 A;  5IG5 A;  1Q42 A;  1ZO2 A;  4HM1 B;  4L8P A;  4XBX A;  3MSO A;  3FF2 A;  1DMM A;  3HK4 A;  4HM3 B;  1O7P B;  2B1X B;  2Z7A A;  1OF5 B;  1JKG B;  2F99 A;  5AI1 A;  4XBY A;  1O7M B;  5EVH A;  3H51 A;  3EBT A;  2HMJ B;  1E97 A;  3T8N A;  3B4P A;  3FGY A;  1QMA A;  1IDP A;  3T8U A;  4MJD A;  4WWU C; 
#chains in the Genus database with same CATH topology
 2MC8 A;  4BU4 A;  3A5E A;  6RNT A;  2O3O A;  1JKG A;  3Q1C A;  1BNR A;  4I5Q A;  5LC6 A;  2D42 A;  3NX0 A;  3PYJ A;  4BTX A;  1FGT A;  1K9M 4;  1MGR A;  3NBR A;  2RBI A;  3G0K A;  2Z6B A;  2XSH B;  1GOV A;  1ZX2 A;  1ROV A;  1KC8 4;  1NNV A;  1IVV A;  3F40 A;  3K5T A;  1OCV A;  2WOH A;  3NQY A;  4U13 A;  5BXQ A;  3S27 A;  1TRQ A;  1IQ8 A;  5IG3 A;  1DVC A;  1QAL A;  1PYL A;  3CNM A;  3MG2 A;  3AHS A;  4FR9 A;  4R4K A;  1QVG 2;  1BSE A;  2QIY A;  3KFQ C;  3OWY A;  4J9A A;  3LML A;  1W5Z A;  5AEU B;  1GSP A;  4XDV A;  1JV2 B;  3F7S A;  1FGR A;  2CIU A;  3GZY B;  2BMQ B;  1NO3 A;  1AV4 A;  5ELJ A;  2V1L A;  2HOH A;  1NWW A;  2C11 A;  1GY7 A;  4KFD A;  4WYK A;  4N6U A;  2CKF B;  3X40 A;  1GMQ A;  4AKZ A;  2XRX B;  1RJO A;  3CCE 3;  3GWR A;  3WA2 X;  4BIR A;  5KP1 A;  2F4Y A;  1LQG C;  1RGK A;  1B3S A;  1O7H B;  1UI8 A;  3MKI A;  4HVN A;  4ZM8 A;  1IVX A;  3ZG5 A;  2GBX B;  2GXF A;  3HII A;  1D6Y A;  3RNT A;  3CPO A;  1V58 A;  3EN1 B;  3U1W A;  4AEQ A;  5BIR A;  2BMO B;  3BNC A;  3SED A;  1JJ2 2;  1FZU A;  2XGN A;  3F14 A;  3ZG0 A;  5IG0 A;  3V92 A;  1UUV B;  5CXO A;  5TGN A;  1EKM A;  3WOE B;  4EW5 A;  2P05 A;  3NUV A;  5IF6 A;  1W02 A;  1MNL A;  3OX9 A;  1GYB A;  3F9S A;  3SOA A;  4O8S A;  1VQ4 3;  2YX9 A;  1A67 A;  1RCK A;  2BNG A;  3FCS B;  1UUG B;  3JUP A;  1W4N A;  1BNG A;  4I4K A;  1B2Z A;  1GD4 A;  2C4B A;  1FGM A;  1K41 A;  3Q3F A;  3IPT A;  3GAX A;  3K9M C;  5D82 A;  1N8Q A;  1GMR A;  3O8Y A;  2BMR B;  1AY7 A;  1M1X B;  2JDI H;  3CCR 3;  1LQM B;  1BOX A;  4WP5 A;  5BVB A;  1ZS7 A;  5AII A;  1STD A;  3OXA A;  1DVD A;  3PS8 A;  4HKV B;  5CK6 A;  1DET A;  3HX8 A;  3URP A;  3JVC A;  1VQL 3;  2KRT A;  1NB3 I;  1X1Y A;  3X42 A;  1CQS A;  2W56 B;  2CW9 A;  2W6J H;  3T0U A;  2HMK B;  1RRH A;  2JQ5 A;  1Q40 B;  3MWZ A;  3Q90 A;  1S5A A;  1YHQ 3;  3GRD A;  3BNE A;  3PCR A;  3NM2 A;  2C10 A;  3EQQ B;  5I97 A;  1I3F A;  3KCH A;  3CCM 3;  1BRK A;  2INX A;  3NHX A;  1UGH I;  1Z1S A;  3I55 3;  1BUQ A;  1DE3 A;  1MWU A;  2KF3 A;  3B4O A;  1VQ6 3;  2HMO B;  2YFJ B;  2W0Q A;  3G71 3;  2CFL A;  1YJ9 3;  4LSO A;  1NU3 A;  3GZB A;  3FZW A;  1ULJ B;  1V57 A;  2XGL A;  3K7C A;  3FG1 A;  3MHE A;  2CC3 A;  3DM8 A;  3MG3 A;  2FXT A;  3EN8 A;  1JRQ A;  3UB1 A;  1Q9E A;  5RNT A;  4DKI A;  1OHP A;  1PFP A;  1STF I;  2IY2 A;  2OCT A;  2WGO A;  3CU3 A;  3GZR A;  3G6E 3;  3WOD G;  3NXJ A;  1RN4 A;  3WHO A;  4G1M B;  1ULI B;  4GSP A;  1TFO A;  1BRI A;  5HGR A;  5IEO A;  3EB8 A;  4HZB B;  2K54 A;  1M90 4;  5CF2 A;  1O7N B;  1RMS A;  2KF6 A;  2CWU A;  1Q40 A;  2BT3 A;  4H3U A;  3J7Y d;  3QRD A;  3OWU A;  1IQY A;  4RNZ A;  1JN5 A;  2BU4 A;  2UUG C;  3FH1 A;  4LYL B;  1JNQ A;  1UW1 A;  3S28 A;  3G16 A;  3AHW A;  4K61 A;  4R9L A;  1MWR A;  1IV7 A;  2QA4 3;  4OVM A;  1EG9 B;  4WYK B;  3DZL A;  3FSD A;  4KFE A;  1TP6 A;  4BL3 A;  1V74 A;  2CWV A;  1E3V A;  3MG1 A;  5EQL A;  5DRE A;  1BRN L;  1ASK A;  1N8R 4;  1BVI A;  1AR0 A;  1YIT 3;  2ZA4 A;  3JUQ A;  1KWI A;  1JZD A;  2GU3 A;  4FCZ A;  2SBL A;  8RNT A;  1SQW A;  1GMP A;  3WMD A;  1YVB I;  3EHC A;  3N8B A;  1A2P A;  3G8Z A;  1Q7H A;  1U8C B;  5JPP A;  3ALA A;  4BTW A;  2Z77 A;  3L0R A;  1TFK A;  2Y73 A;  4HM8 B;  1BIR A;  3PCS A;  1Q86 4;  4XDW A;  1N5P A;  3DGY A;  2QGU A;  1I0X A;  1GY5 A;  1QAK A;  2GBW B;  3F7X A;  5AYR B;  2XEP A;  5A0O B;  4KT3 B;  1OUN A;  2LQV A;  3NV0 B;  2E2U A;  3NBB A;  1R4Y A;  1I2E A;  4NHF A;  1FUW A;  1TUH A;  2XF3 A;  3N54 B;  1BSC A;  1B21 A;  1G02 A;  3X3Z A;  3X3X A;  4X2H A;  1LOY A;  1WNH A;  1TTO A;  1VQQ A;  1I2G A;  5D81 A;  4R9K A;  3CCQ 3;  2E2V A;  1RNT A;  1IVW A;  1GOY A;  1DMQ A;  2WO0 A;  3V99 A;  2HMM B;  3CC4 3;  3S5C A;  1FUT A;  3D9R A;  1YNV X;  3MYT A;  1RN1 A;  1IVU A;  1N5H A;  2OQE C;  4MMZ B;  2GEY A;  7RNT A;  3PGB A;  1ZGX A;  3EBY A;  2CFK A;  4N6N B;  5AYS C;  5KP3 A;  1Q82 4;  1CEW I;  1FGO A;  1FYS A;  1SIH A;  1WQL B;  2F98 A;  2ZDJ A;  3OW2 2;  2L1S A;  3GSP A;  3KKG A;  2WGQ A;  3TDG A;  3V98 A;  2OTL 3;  1VQN 3;  3D79 A;  2ML6 A;  2HML B;  1SJW A;  4KFF A;  4Q53 A;  2B24 B;  3IJE B;  1C7H A;  3LTD A;  4HM6 B;  4HAA A;  1HU9 A;  3EC9 A;  2CG1 A;  3ROB A;  1LOX A;  3BNB A;  4FCJ A;  1RGH A;  2FGT A;  3CPW 2;  1BRJ A;  3NV0 A;  1JBR A;  2ML5 A;  2CFG A;  5AIG A;  1CH0 A;  1SII A;  1UGI A;  3DGO A;  3X41 A;  2RFR A;  1TIJ A;  1W6Y A;  4XB5 A;  4K90 B;  1FW7 A;  1OPY A;  3S29 A;  3BIR A;  3HIG A;  1A2K A;  3FF0 A;  2F56 A;  3PXM A;  3BND A;  4N6V 0;  1JB5 A;  4RZM A;  4IT7 A;  4EV2 A;  1VQK 3;  1IU7 A;  3UL5 A;  5IEN A;  3D3L A;  4HZ9 B;  5AIF A;  1KQS 2;  3H3H A;  1FA3 A;  2XR8 B;  3VSY A;  3CC2 3;  2YFI B;  1U5O A;  3SOY A;  3LZA A;  1D6Z A;  1AVL A;  1T3B A;  4XM4 A;  1HKX A;  3AGN A;  3GZX B;  1MWT A;  1FGQ A;  4HJL B;  4MMX B;  4J8T A;  1UCK A;  2AAD A;  2A15 A;  1PY3 A;  3RGA A;  1BRH A;  2KF4 A;  1I8V A;  3IMA B;  2GEX A;  4KZ1 A;  3KSP A;  4FMA A;  2RGQ A;  1OAC A;  3STD A;  5FGO A;  4LZI A;  1BAN A;  1G96 A;  2AAE A;  3ER7 A;  3I56 3;  3K0Z A;  4AKY A;  2OTJ 3;  2L4V A;  3ECF A;  3LT9 A;  4J5G A;  5DRV A;  1BNF A;  1BNE A;  1JN5 B;  1LOV A;  1RGF A;  2ZL8 A;  3I0Y A;  4K1U A;  3KN4 A;  5AIH A;  3JUO A;  5D83 A;  2KCD A;  1O7G B;  1S72 3;  2W2C A;  2O9U X;  3CCL 3;  3DUK A;  1F8N A;  2CH9 A;  4N3V A;  3FG4 A;  2J8X B;  2PZV A;  1EQK A;  1KSI A;  2P0X A;  4FMC A;  1W7C A;  4GL6 A;  1B2U A;  1QJG A;  8CHO A;  4CCV A;  1BRS A;  1JB4 A;  1O7W B;  4GHO A;  3WR2 A;  1B20 A;  3FKA A;  5G2G A;  4HM2 B;  2E2T A;  5FW5 A;  1T2H A;  1VQ8 3;  3SVA A;  3CME 3;  1Y4K A;  3LTB A;  1LRA A;  1N9J A;  3DGL A;  3HZP A;  3DH2 A;  1JBS A;  4O02 B;  3G4S 3;  4HM7 B;  3KSE D;  1AQZ A;  1YVS A;  1GS3 A;  4N6M A;  7STD A;  4EV5 A;  4L7K A;  2K0M A;  1UI7 A;  1OHO A;  3DXO A;  5JPU A;  3OV4 A;  5LC7 A;  5CF1 A;  3CMA 3;  1OHS A;  5IEP A;  4NRE A;  2PNC A;  3OWS A;  1RKY A;  1BAO A;  2CHC A;  1QAF A;  1US1 A;  1JZO A;  4XBT A;  4EBG A;  1B27 A;  1J2B A;  3EJV A;  4LEH A;  2CX0 A;  2R4I A;  1LNI A;  1MGW A;  1OGX A;  9RNT A;  4MMY B;  1M9G A;  1T2I A;  3A76 A;  1RCL A;  2CWT A;  3CC7 3;  3PZW A;  1BSB A;  4N6O B;  1YJN 3;  1B2X A;  1YI2 3;  1YGE A;  1VQP 3;  4WFO A;  5G1K A;  1KD1 4;  1BSA A;  1RGG A;  5KP4 A;  2OOV C;  1BU4 A;  2Q07 A;  4HBR A;  1VQ9 3;  3X3Y A;  1C54 A;  2OQE A;  1EA2 A;  4FCM A;  2QEX 3;  2W9P A;  1A2V A;  2CK3 H;  1W2Z A;  4K1V A;  3WA3 A;  2CX1 A;  2KXG A;  2ZHX B;  5ELU A;  2KF5 A;  3F8H A;  1GD3 A;  1RLS A;  2W03 A;  4PEJ A;  4N6L A;  1TRP A;  1GY6 A;  4BTY A;  3K63 A;  1VZZ A;  3AMO A;  4WHA A;  3KZT A;  3CNX A;  4RNT A;  5AEW B;  3CD6 3;  1JB2 A;  1OF5 A;  2RNT A;  1YGW A;  1RGC A;  1X1U A;  1Q81 4;  2YFL B;  4GB5 A;  3WOF B;  2Z76 A;  1VQO 3;  1QVF 2;  3KII A;  1UCI A;  1DMN A;  2P38 A;  1I0V A;  2FNQ A;  3B8L A;  2LYX A;  2M7O A;  3S67 A;  3ZFZ A;  3DGM A;  6STD A;  5JBS A;  2GSP A;  2UX0 A;  1LVN A;  1B2S A;  4LGQ A;  1WMN A;  3FG3 A;  5CLK A;  3CXC 2;  2F5W A;  1Q7Y 4;  4RBN A;  1DYU A;  1N9E A;  1SAR A;  1K28 A;  1LOW A;  2H0G A;  1W6G A;  3CCU 3;  3SLU A;  1AVK A;  2D1W A;  4LMI A;  4RNY A;  1UCL A;  1YIJ 3;  1NDO B;  2BHM A;  3KE7 A;  1SPU A;  4O3V A;  1L5G B;  3RDE A;  3CCJ 3;  3F8X A;  5STD A;  3Q2P A;  2GU1 A;  1R4C A;  1YJW 3;  2OWP A;  3EX9 A;  4HM4 B;  2STD A;  4CDL A;  2IMJ A;  4HM5 B;  3B7C A;  5IG4 A;  1TU5 A;  1A90 A;  4L8O A;  2P0M A;  3AGO A;  3FLJ A;  4J5K A;  3E99 A;  3LOY A;  4ILF A;  3RGR A;  1OH0 A;  4OUQ A;  3CCV 3;  2CFD A;  2P09 A;  4HOH A;  3UJM A;  1UCJ A;  2F5M A;  2H0H A;  2K3D A;  1X1W A;  3JUM A;  1K8A 4;  3HOH A;  3EF8 A;  3DMC A;  1BNI A;  1OGZ A;  1RTU A;  6GSP A;  3CCS 3;  3D4A A;  3M8C A;  1CYU A;  3LYG A;  4R1K A;  3EE1 A;  1G0T A;  1FUS A;  4KVH A;  4ORL A;  1EEJ A;  2XH9 A;  1E3R A;  1TJD A;  2F86 B;  1UUW B;  5BU4 A;  2R41 A;  3SYU A;  3U97 A;  1HYF A;  4IIA A;  5EEO A;  3LH4 A;  3LXU X;  2RCD A;  4HYZ A;  1IT8 A;  3N9H A;  4N6T A;  2HMN B;  1ISK A;  4STD A;  3VGN A;  1IQX A;  3NM7 A;  1IYY A;  4H61 A;  1BUJ A;  5HOH A;  1BNJ A;  1GOU A;  4MEI A;  4HM0 B;  1W00 A;  1UDI I;  3DY5 A;  1M1K 4;  4X2O A;  1I70 A;  1BSD A;  2IUK A;  4R80 A;  1WTH A;  2XSO B;  1NJI 4;  3BLZ A;  2I9W A;  1RGA A;  3UNL A;  5G1L A;  2XFS A;  1LNH A;  1T5Y A;  1X1X A;  3BB9 A;  3DGN A;  5IER A;  4IPB A;  2MF7 A;  4FMD A;  2CFW A;  7GSP A;  1EUI C;  4BL2 A;  1PU4 A;  1RSN A;  3JUN A;  1RDS A;  1W01 A;  4CPK A;  2IUJ A;  5IG5 A;  5M18 A;  1IK3 A;  1RRL A;  3NQZ A;  2IA7 A;  1Q42 A;  3D5I A;  3QK9 A;  1ZO2 A;  4HM1 B;  2BO9 B;  4FMB A;  1MWS A;  3MPH A;  4L8P A;  3NBJ A;  2OOV A;  4XBX A;  5M1A A;  5M19 A;  3SXX A;  2XFT A;  4OK0 A;  3MSO A;  3FF2 A;  1RN7 A;  3SX1 A;  1DMM A;  3HK4 A;  3LTA A;  3WDG B;  2RSX A;  4HM3 B;  4QWT A;  3AMO B;  2W04 A;  1O7P B;  1W6C A;  3LT8 A;  3VF1 A;  1RGL A;  2B1X B;  4EYC A;  1NB5 I;  2WOF A;  2CG0 A;  1OF5 B;  2Z7A A;  1JKG B;  2F99 A;  3BU4 A;  4O2H A;  5IW9 A;  1K73 4;  2UGI A;  5AI1 A;  4CJN A;  1W2B 2;  1BNS A;  2Y74 A;  3LTC A;  4NPB A;  1WMO A;  4XBY A;  5GSP A;  2W9Q A;  1LXE A;  1ROA A;  1BRG A;  1BGS A;  1IV9 A;  1B2M A;  1RNB A;  1RGE A;  4JRF A;  1O7M B;  5EVH A;  3H51 A;  3EBT A;  1VQ7 3;  2SAR A;  2BIR A;  3D5G A;  2HMJ B;  1E97 A;  2H0I A;  2W56 A;  1VQM 3;  2IYJ A;  1IT7 A;  3T8N A;  3B4P A;  2KAA A;  3FGY A;  1WMP A;  1I2F A;  1CYV A;  1I3I A;  1JBT A;  4EXR A;  4EC6 A;  1QMA A;  1IDP A;  3T8U A;  1D6U A;  4MJD A;  1VQ5 3;  1HZ1 A;  1RHL A;  4TX4 A;  3HI7 A;  4WWU C;  1MOL A;  4JF8 A;  3UL6 A; 
#chains in the Genus database with same CATH homology
 2MC8 A;  2O3O A;  1JKG A;  3Q1C A;  5LC6 A;  2D42 A;  3NX0 A;  3PYJ A;  4BTX A;  1FGT A;  1K9M 4;  3NBR A;  3G0K A;  2Z6B A;  2XSH B;  1ZX2 A;  1ROV A;  1KC8 4;  3K5T A;  1IVV A;  3F40 A;  3NQY A;  1OCV A;  2WOH A;  4U13 A;  5BXQ A;  3S27 A;  1IQ8 A;  5IG3 A;  1DVC A;  1QAL A;  3CNM A;  3MG2 A;  4FR9 A;  4R4K A;  1QVG 2;  2QIY A;  3KFQ C;  3OWY A;  4J9A A;  3LML A;  1W5Z A;  5AEU B;  4XDV A;  1JV2 B;  3F7S A;  1FGR A;  2CIU A;  3GZY B;  2BMQ B;  1NO3 A;  1AV4 A;  5ELJ A;  2V1L A;  1NWW A;  2C11 A;  1GY7 A;  4KFD A;  4WYK A;  4N6U A;  2CKF B;  3X40 A;  4AKZ A;  2XRX B;  1RJO A;  3CCE 3;  3GWR A;  3WA2 X;  5KP1 A;  1O7H B;  1UI8 A;  3MKI A;  4HVN A;  4ZM8 A;  1IVX A;  2GBX B;  2GXF A;  3HII A;  1D6Y A;  3CPO A;  3EN1 B;  3U1W A;  4AEQ A;  2BMO B;  3BNC A;  3SED A;  1JJ2 2;  2XGN A;  3F14 A;  5IG0 A;  3V92 A;  1UUV B;  5CXO A;  5TGN A;  1EKM A;  3WOE B;  2P05 A;  3NUV A;  5IF6 A;  1W02 A;  1MNL A;  3OX9 A;  1GYB A;  3F9S A;  3SOA A;  4O8S A;  1VQ4 3;  2YX9 A;  1A67 A;  2BNG A;  3FCS B;  3JUP A;  1W4N A;  4I4K A;  1GD4 A;  1FGM A;  1K41 A;  3IPT A;  3GAX A;  3K9M C;  5D82 A;  1N8Q A;  3O8Y A;  2BMR B;  1M1X B;  2JDI H;  3CCR 3;  4WP5 A;  5BVB A;  5AII A;  1STD A;  3OXA A;  1DVD A;  3PS8 A;  4HKV B;  5CK6 A;  3HX8 A;  3JVC A;  1VQL 3;  2KRT A;  1NB3 I;  3X42 A;  1CQS A;  2W56 B;  2CW9 A;  2W6J H;  3T0U A;  2HMK B;  1RRH A;  2JQ5 A;  1Q40 B;  3MWZ A;  3Q90 A;  1S5A A;  1YHQ 3;  3GRD A;  3BNE A;  3PCR A;  3NM2 A;  2C10 A;  3EQQ B;  5I97 A;  3CCM 3;  2INX A;  3NHX A;  1Z1S A;  3I55 3;  1BUQ A;  3B4O A;  1VQ6 3;  2HMO B;  2YFJ B;  2W0Q A;  3G71 3;  2CFL A;  1YJ9 3;  4LSO A;  1NU3 A;  3GZB A;  3FZW A;  1ULJ B;  3K7C A;  2XGL A;  3FG1 A;  3MHE A;  2CC3 A;  3DM8 A;  3MG3 A;  2FXT A;  3EN8 A;  1JRQ A;  3UB1 A;  1OHP A;  1PFP A;  1STF I;  2OCT A;  2WGO A;  3CU3 A;  3GZR A;  3G6E 3;  3WOD G;  3NXJ A;  4G1M B;  1ULI B;  1TFO A;  5HGR A;  5IEO A;  3EB8 A;  4HZB B;  2K54 A;  1M90 4;  5CF2 A;  1O7N B;  2CWU A;  1Q40 A;  2BT3 A;  4H3U A;  3J7Y d;  3QRD A;  3OWU A;  1IQY A;  4RNZ A;  1JN5 A;  3FH1 A;  1JNQ A;  1UW1 A;  3S28 A;  3G16 A;  4K61 A;  4R9L A;  2QA4 3;  1IV7 A;  4OVM A;  1EG9 B;  4WYK B;  3DZL A;  3FSD A;  4KFE A;  1TP6 A;  1V74 A;  2CWV A;  1E3V A;  3MG1 A;  5EQL A;  5DRE A;  1ASK A;  1N8R 4;  1AR0 A;  1YIT 3;  3JUQ A;  1KWI A;  2GU3 A;  4FCZ A;  2SBL A;  1SQW A;  3WMD A;  1YVB I;  3EHC A;  3N8B A;  3G8Z A;  1U8C B;  5JPP A;  3ALA A;  4BTW A;  2Z77 A;  3L0R A;  1TFK A;  2Y73 A;  4HM8 B;  3PCS A;  1Q86 4;  4XDW A;  1N5P A;  2QGU A;  1GY5 A;  1QAK A;  2GBW B;  3F7X A;  5AYR B;  2XEP A;  5A0O B;  1OUN A;  2LQV A;  3NV0 B;  2E2U A;  3NBB A;  4NHF A;  1FUW A;  1TUH A;  2XF3 A;  3N54 B;  3X3Z A;  3X3X A;  4X2H A;  1WNH A;  5D81 A;  4R9K A;  3CCQ 3;  2E2V A;  3CC4 3;  1IVW A;  1DMQ A;  2WO0 A;  3V99 A;  2HMM B;  3S5C A;  3D9R A;  3MYT A;  4MMZ B;  1IVU A;  1N5H A;  2OQE C;  2GEY A;  3PGB A;  4N6N B;  3EBY A;  2CFK A;  5AYS C;  5KP3 A;  1Q82 4;  1CEW I;  1FGO A;  1SIH A;  2ZDJ A;  1WQL B;  2F98 A;  3OW2 2;  3KKG A;  2WGQ A;  3TDG A;  3V98 A;  2OTL 3;  1VQN 3;  2ML6 A;  2HML B;  1SJW A;  4KFF A;  4Q53 A;  2B24 B;  3IJE B;  1C7H A;  3LTD A;  4HM6 B;  1HU9 A;  3EC9 A;  2CG1 A;  3ROB A;  1LOX A;  3BNB A;  4FCJ A;  2FGT A;  3CPW 2;  3NV0 A;  2ML5 A;  2CFG A;  5AIG A;  1SII A;  3DGO A;  3X41 A;  2RFR A;  1TIJ A;  1W6Y A;  4XB5 A;  4K90 B;  1OPY A;  3S29 A;  3HIG A;  1A2K A;  3FF0 A;  3PXM A;  4RZM A;  3BND A;  4N6V 0;  1JB5 A;  4EV2 A;  4IT7 A;  1VQK 3;  1IU7 A;  3UL5 A;  5IEN A;  3D3L A;  4HZ9 B;  5AIF A;  1KQS 2;  3H3H A;  1FA3 A;  2XR8 B;  3VSY A;  3CC2 3;  2YFI B;  1U5O A;  3SOY A;  3LZA A;  1D6Z A;  1AVL A;  4XM4 A;  1HKX A;  3GZX B;  1FGQ A;  4HJL B;  4MMX B;  4J8T A;  3RGA A;  2A15 A;  3IMA B;  2GEX A;  4KZ1 A;  3KSP A;  4FMA A;  2RGQ A;  1OAC A;  3STD A;  5FGO A;  4LZI A;  1G96 A;  3ER7 A;  3I56 3;  3K0Z A;  4AKY A;  2OTJ 3;  2L4V A;  3ECF A;  3LT9 A;  5DRV A;  1JN5 B;  4K1U A;  2ZL8 A;  3I0Y A;  3KN4 A;  5AIH A;  3JUO A;  5D83 A;  2KCD A;  1O7G B;  1S72 3;  2W2C A;  2O9U X;  3CCL 3;  3DUK A;  1F8N A;  2CH9 A;  4N3V A;  3FG4 A;  2PZV A;  1EQK A;  1KSI A;  2P0X A;  4FMC A;  1W7C A;  4GL6 A;  1QJG A;  8CHO A;  4CCV A;  1JB4 A;  1O7W B;  3FKA A;  5G2G A;  4HM2 B;  2E2T A;  5FW5 A;  3SVA A;  3CME 3;  1Y4K A;  3LTB A;  3DGL A;  1N9J A;  3HZP A;  4O02 B;  3G4S 3;  4HM7 B;  3KSE D;  4N6M A;  7STD A;  1GS3 A;  4EV5 A;  4L7K A;  2K0M A;  1UI7 A;  1OHO A;  3DXO A;  5JPU A;  3OV4 A;  5LC7 A;  5CF1 A;  3CMA 3;  1OHS A;  5IEP A;  4NRE A;  2PNC A;  3OWS A;  1RKY A;  2CHC A;  1QAF A;  1US1 A;  4XBT A;  4EBG A;  1J2B A;  3EJV A;  4LEH A;  2R4I A;  1OGX A;  4MMY B;  1M9G A;  3A76 A;  2CWT A;  3CC7 3;  3PZW A;  4N6O B;  1YJN 3;  1YI2 3;  1YGE A;  1VQP 3;  4WFO A;  1KD1 4;  5KP4 A;  2OOV C;  2Q07 A;  4HBR A;  1VQ9 3;  3X3Y A;  2OQE A;  1EA2 A;  4FCM A;  2QEX 3;  2W9P A;  1A2V A;  2CK3 H;  1W2Z A;  4K1V A;  3WA3 A;  2KXG A;  5ELU A;  3F8H A;  1GD3 A;  2W03 A;  4PEJ A;  4N6L A;  1GY6 A;  4BTY A;  3K63 A;  1VZZ A;  3AMO A;  4WHA A;  3KZT A;  3CNX A;  3CD6 3;  5AEW B;  1JB2 A;  1OF5 A;  1Q81 4;  2YFL B;  4GB5 A;  3WOF B;  2Z76 A;  1VQO 3;  1QVF 2;  3KII A;  1DMN A;  2P38 A;  2FNQ A;  5JBS A;  3B8L A;  2LYX A;  2M7O A;  3S67 A;  6STD A;  3DGM A;  1VQ8 3;  2UX0 A;  1LVN A;  4LGQ A;  1WMN A;  3FG3 A;  5CLK A;  3CXC 2;  1Q7Y 4;  4RBN A;  1DYU A;  1N9E A;  1K28 A;  1W6G A;  3CCU 3;  3SLU A;  1AVK A;  2D1W A;  4LMI A;  4RNY A;  1YIJ 3;  1NDO B;  2BHM A;  3KE7 A;  1SPU A;  4O3V A;  1L5G B;  3RDE A;  3CCJ 3;  3F8X A;  5STD A;  3Q2P A;  2GU1 A;  1R4C A;  1YJW 3;  2OWP A;  3EX9 A;  4HM4 B;  2STD A;  4CDL A;  2IMJ A;  4HM5 B;  3B7C A;  5IG4 A;  1TU5 A;  1A90 A;  4L8O A;  2P0M A;  3FLJ A;  3RGR A;  3E99 A;  3LOY A;  1OH0 A;  4OUQ A;  3CCV 3;  2CFD A;  2P09 A;  3UJM A;  3JUM A;  1K8A 4;  3EF8 A;  3DMC A;  1OGZ A;  3CCS 3;  3M8C A;  1CYU A;  3LYG A;  4R1K A;  3EE1 A;  4KVH A;  4ORL A;  2XH9 A;  1E3R A;  2F86 B;  1UUW B;  3U97 A;  4IIA A;  5EEO A;  3LH4 A;  3LXU X;  2RCD A;  4HYZ A;  1IT8 A;  3N9H A;  4N6T A;  2HMN B;  1ISK A;  4STD A;  3VGN A;  1IQX A;  3NM7 A;  4H61 A;  4MEI A;  4HM0 B;  1W00 A;  3DY5 A;  1M1K 4;  4X2O A;  4R80 A;  2IUK A;  1WTH A;  2XSO B;  1NJI 4;  3BLZ A;  2I9W A;  3UNL A;  2XFS A;  1LNH A;  1T5Y A;  3DGN A;  3BB9 A;  5IER A;  4IPB A;  2MF7 A;  4FMD A;  2CFW A;  1PU4 A;  3JUN A;  1W01 A;  2IUJ A;  5IG5 A;  1IK3 A;  1RRL A;  3NQZ A;  2IA7 A;  1Q42 A;  3QK9 A;  1ZO2 A;  4HM1 B;  2BO9 B;  4FMB A;  3MPH A;  4L8P A;  3NBJ A;  2OOV A;  4XBX A;  3SXX A;  2XFT A;  4OK0 A;  3MSO A;  3FF2 A;  1RN7 A;  3SX1 A;  1DMM A;  3HK4 A;  3LTA A;  3WDG B;  2RSX A;  4HM3 B;  4QWT A;  3AMO B;  2W04 A;  1O7P B;  1W6C A;  3LT8 A;  3VF1 A;  4EYC A;  2B1X B;  1NB5 I;  2WOF A;  2CG0 A;  1OF5 B;  2Z7A A;  1JKG B;  2F99 A;  4O2H A;  5IW9 A;  1K73 4;  5AI1 A;  1W2B 2;  2Y74 A;  3LTC A;  4XBY A;  1WMO A;  2W9Q A;  1LXE A;  1ROA A;  1IV9 A;  4JRF A;  1O7M B;  5EVH A;  3H51 A;  3EBT A;  1VQ7 3;  2HMJ B;  1E97 A;  2W56 A;  1VQM 3;  1IT7 A;  3T8N A;  3B4P A;  3FGY A;  1WMP A;  1CYV A;  4EXR A;  4EC6 A;  1QMA A;  1IDP A;  3T8U A;  1D6U A;  4MJD A;  1VQ5 3;  4TX4 A;  3HI7 A;  4WWU C;  1MOL A;  4JF8 A;  3UL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...