5FW5A

Crystal structure of human g3bp1 in complex with semliki forest virus nsp3-25 comprising two fgdf motives
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
SMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RAS GTPASE-ACTIVATING PROTEIN-BINDING PROTEIN 1
publication title Combined structural, biochemical and cellular evidence demonstrates that both FGDF motifs in alphavirus nsP3 are required for efficient replication.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5fw5A00
1GY5A 3EN8A 1ZX2A 5KP1A 3F7XA 2A15A 4XBTA 2F99A 3LYGA 3H51A 1ZO2A 1JB2A 2I9WA 3OWSA 3GRDA 3DUKA 2GBXB 4Q53A 5CXOA 2Z76A 3NV0A 1NU3A 3MKIA 3EX9A 1QMAA 3FF2A 3NXJA 2INXA 1S5AA 3CNMA 4L7KA 4HM5B 4LGQA 1E3VA 1BUQA 3EHCA 3NBRA 1C7HA 3K0ZA 2BMRB 3Q90A 1OH0A 4RZMA 1UUVB 1OGZA 5IENA 4XBYA 1EG9B 3BLZA 3JUNA 3F14A 4HM7B 3T8NA 2GEXA 2R4IA 2XRXB 3OWUA 1OGXA 3KE7A 3VGNA 2Z77A 5DRVA 2BMOB 3DXOA 1JN5A 4HM8B 3G16A 1STDA 2PZVA 1WQLB 2XSOB 1ISKA 5AEUB 3MG3A 3F7SA 4CDLA 3SOAA 3VSYA 2HMMB 4WYKA 1OHOA 3B7CA 2XR8B 2QGUA 4OVMA 5IERA 1OF5A 3MSOA 2RFRA 3EC9A 3MG2A 3DM8A 4XBXA 2Z7AA 4LEHA 3GZBA 1GYBA 2B24B 4L8PA 3KKGA 4K1VA 2JQ5A 5AIGA 5D82A 5JPPA 4XB5A 3FSDA 4LMIA 3MG1A 5AEWB 3NV0B 1CQSA 2CHCA 3DMCA 4KVHA 3JUMA 4WWUC 1Q42A 1ASKA 2GEYA 1SJWA 3OXAA 4R1KA 1TUHA 1W00A 5IF6A 1GY6A 4HM6B 3EBTA 3G0KA 2BMQB 1O7HB 1Q40A 5AIHA 5STDA 3F40A 3K7CA 4ORLA 1JN5B 3GWRA 2UX0A 2HMNB 1UUWB 1OHPA 3GZXB 1O7NB 3CNXA 3UJMA 3FKAA 2IMJA 5D81A 3OX9A 1O7WB 3ECFA 2W2CA 4WYKB 5BXQA 5AI1A 1OHSA 4HZ9B 3GZYB 1OF5B 3A76A 5EVHA 1IDPA 1W01A 2YFLB 5CF2A 3ROBA 4GB5A 3F8XA 5AIIA 3OV4A 3D9RA 1W6YA 4OUQA 3OWYA 3FF0A 1JKGA 1NDOB 3EJVA 3NHXA 1DMNA 3FGYA 4HZBB 4X2OA 5IG5A 4U13A 3JUOA 5KP4A 4HM0B 1EA2A 1ULIB 2GXFA 3IPTA 4X2HA 1OUNA 5CK6A 3LZAA 4XM4A 3MYTA 3JUQA 1OCVA 1O7GB 4PEJA 3HK4A 1JB4A 3B4OA 5CF1A 1E3RA 1GS3A 5KP3A 3FH1A 4HM4B 5IEOA 1JB5A 5HGRA 1Q40B 3STDA 4J8TA 3RGRA 2STDA 2YFJB 4MJDA 1O7PB 2BNGA 1QJGA 3FLJA 3EN1B 6STDA 1U5OA 2XSHB 5JPUA 4H3UA 2HMJB 3S5CA 1VZZA 3MHEA 3NUVA 5CLKA 5IG0A 4HM1B 1A2KA 1NWWA 4XDVA 1Z1SA 4HJLB 1DMQA 3E99A 3JUPA 4XDWA 3FZWA 3SEDA 5D83A 2K54A 2GBWB 1E97A 3M8CA 3EQQB 4HVNA 1K41A 2CKFB 7STDA 4HM3B 2QIYA 5BVBA 3UNLA 3DZLA 4FCJA 1ULJB 4J9AA 4STDA 3F8HA 3WMDA 3ER7A 3B8LA 1JKGB 5DREA 5IG3A 3GZRA 2HMKB 3EF8A 4I4KA 2HMOB 5TGNA 5FW5A 1GY7A 2RCDA 1O7MB 2RGQA 3I0YA 4HKVB 4FCMA 3B4PA 3CPOA 5IEPA 3CU3A 4HM2B 4R9LA 3F9SA 2YFIB 2OWPA 3RGAA 4K1UA 3HZPA 3KSPA 4IIAA 5AIFA 1OPYA 3KZTA 3SOYA 4N3VA 2F86B 3EBYA 2F98A 1W02A 4WP5A 1DMMA 3NM2A 3BB9A 1HKXA 3H3HA 3G8ZA 5G2GA 4R9KA 1TP6A 8CHOA 4L8OA 2HMLB 2B1XB 1AR0A 3T8UA 5IG4A 3HX8A
chains in the Genus database with same CATH superfamily
1GY5A 3FG1A 1TRPA 1X1XA 2IY2A 3EN8A 3CCS3 1B20A 4MMYB 3WA3A 1ZX2A 5KP1A 3MPHA 3X3XA 2L4VA 2FXTA 3KCHA 5BIRA 3F7XA 2A15A 4XBTA 2C4BA 1I8VA 1ZGXA 2CW9A 5HOHA 1UCLA 3WOEB 2F99A 2H0GA 4IT7A 4BTYA 3K5TA 4BU4A 4G1MB 4N6MA 3LYGA 1LNHA 3H51A 4TX4A 5LC7A 1UI7A 1ZO2A 2MF7A 3DGMA 2PNCA 1U8CB 1Q7HA 1JB2A 2CFGA 2ML5A 2I9WA 3OWSA 4HAAA 3GRDA 3SLUA 1YIJ3 3DUKA 4FMAA 1T3BA 2CFWA 2GBXB 2J8XB 4Q53A 2Y73A 5CXOA 1DE3A 2Z76A 4BL3A 3CC43 1K28A 3NV0A 1BGSA 1NU3A 3MKIA 1J2BA 3EX9A 1YIT3 1QMAA 2KF3A 3FF2A 3NXJA 1AV4A 2XFSA 2INXA 1S5AA 1WMNA 2KXGA 3CNMA 5M1AA 5JBSA 3I563 1R4CA 4L7KA 4HM5B 4CJNA 1MOLA 4LGQA 1E3VA 1BUQA 1BNGA 3EHCA 3NBRA 1C7HA 4N6UA 1BRIA 2QA43 3K0ZA 1VQM3 2BMRB 2QEX3 3Q90A 3X3ZA 1BNFA 3NBBA 4O3VA 3Q3FA 1OH0A 4CPKA 4RZMA 4KFFA 2YX9A 2BT3A 1UUVB 3AHSA 1RJOA 3X40A 3CD63 2OQEA 1BRJA 1RMSA 3FG3A 1JBSA 3IMAB 1BAOA 1BNSA 1OGZA 2CWUA 3HIIA 4MMXB 5IENA 1N8R4 4XBYA 1EG9B 3BLZA 1BRHA 3F14A 3JUNA 3LOYA 4J5KA 1YJ93 4HM7B 3T8NA 1DVCA 3S29A 3URPA 1I2GA 3G4S3 1SQWA 2KF5A 1A67A 2RSXA 3CC73 2GSPA 2GEXA 2HOHA 3I553 4HOHA 2CX1A 1CH0A 2R4IA 2XRXB 1V58A 3LT8A 1FUWA 3TDGA 1BSBA 3OWUA 5IW9A 1JBRA 2D42A 1I2FA 4GSPA 1Q824 3PS8A 1B2XA 1UCJA 3LH4A 4O2HA 1OGXA 3KE7A 3VGNA 1BOXA 2CFDA 2Z77A 3AMOB 1W5ZA 1B2ZA 1RN7A 3HI7A 5BU4A 1VQ83 2P38A 5DRVA 2BMOB 1NJI4 1JJ22 1YJN3 3D3LA 4IPBA 3CCV3 4R80A 2WOHA 3DXOA 2FNQA 1JN5A 4HM8B 1W6CA 1DETA 3Q2PA 4AKYA 3G16A 3CCL3 2WO0A 1FGOA 1STDA 3QK9A 1RNTA 1UGIA 1YJW3 1AY7A 3BIRA 2UGIA 4EW5A 7RNTA 2PZVA 1WQLB 2XSOB 1ISKA 5AEUB 1FGTA 3KN4A 1EUIC 1TU5A 1RGLA 3F7SA 3MG3A 1D6YA 2F56A 2L1SA 3BU4A 3MWZA 4N6NB 1UUGB 2K0MA 4CDLA 3SOAA 2CX0A 3VSYA 2OOVA 2IUJA 2HMMB 3GAXA 1LVNA 1OHOA 3B7CA 2XR8B 1MWTA 4WYKA 1US1A 3S67A 1YVSA 1W4NA 1D6ZA 1N9JA 1EEJA 2W6JH 4OK0A 2F5MA 1LOYA 2JDIH 2QGUA 2E2VA 3D4AA 4OVMA 1KC84 2W9PA 1S723 3DGLA 1MGWA 3X3YA 1OF5A 5IERA 3MSOA 2W03A 2RFRA 3EC9A 3HOHA 3DM8A 1G96A 2XGNA 1CEWI 3MG2A 1BIRA 8RNTA 3SX1A 3CXC2 3AHWA 1RRLA 3WHOA 4XBXA 2Z7AA 4AEQA 4LEHA 4FMDA 4WFOA 3D5IA 3GZBA 3N9HA 1GYBA 2Z6BA 1N5PA 2B24B 2ZA4A 3N8BA 3L0RA 4R4KA 1A90A 1BANA 1IT7A 2ZL8A 4L8PA 3DGNA 1GOUA 4ILFA 1T2IA 1L5GB 1IK3A 1PYLA 2CG0A 6RNTA 4HYZA 1FZUA 3KKGA 1YGEA 4K1VA 1GD4A 1MGRA 3GSPA 5G1KA 3KIIA 2JQ5A 3LTBA 5AIGA 5D82A 5JPPA 4XB5A 1FA3A 3FSDA 4LMIA 2P0MA 3X42A 1EKMA 1GMQA 3BNBA 3MG1A 2KRTA 5AEWB 3NV0B 1CQSA 1UCIA 7GSPA 1VQQA 2CWVA 2CHCA 3O8YA 2F4YA 1Q864 3DMCA 4KVHA 3HIGA 1LQGC 3KFQC 1VQN3 3JUMA 2XF3A 5FGOA 1BNEA 2KF6A 1IYYA 4WWUC 1OACA 5M19A 1N8QA 1Q42A 1I3IA 1TTOA 3LTCA 1ASKA 2GEYA 3S27A 1SJWA 1SARA 2P0XA 2OTJ3 1W2B2 3OXAA 4R1KA 1TUHA 3PCRA 1RGHA 4N6OB 3WOFB 2O3OA 1RNBA 1W00A 3UL6A 5IF6A 3CCR3 1GY6A 5M18A 1WTHA 3D79A 4HM6B 1BNJA 3EBTA 2CG1A 3G0KA 3JVCA 4BIRA 2GU3A 1T2HA 2BMQB 3DGOA 3IJEB 6GSPA 1BU4A 1B2SA 1FGMA 2AADA 1O7HB 3N54B 4N6V0 3UB1A 1UW1A 2CFLA 3G6E3 1LOWA 4EBGA 1Q40A 1N9EA 5AIHA 3UL5A 1VQP3 5STDA 4EYCA 3PCSA 4KFDA 2P05A 1BRSA 1GSPA 3F40A 3K7CA 3CCJ3 4ORLA 2C10A 4LYLB 2SARA 2W04A 1JN5B 2H0HA 3J7Yd 1UCKA 3GWRA 1NB5I 3AGNA 1FUSA 2IYJA 3NM7A 1SPUA 1X1WA 4K61A 2UX0A 1RN1A 1IV7A 2HMNB 1UUWB 1OHPA 4BTXA 1IT8A 3GZXB 1DVDA 1O7NB 1BVIA 3CNXA 3UJMA 3FKAA 2W56A 3VF1A 3NX0A 1A2VA 2IMJA 3S28A 5D81A 4O8SA 3CCE3 4LZIA 3OX9A 1LXEA 2LQVA 5LC6A 1O7WB 1WMOA 3ECFA 4RNZA 2WGOA 1LRAA 2W2CA 4WYKB 1D6UA 5EEOA 2MC8A 5BXQA 2BU4A 3PGBA 5AI1A 1DYUA 1OHSA 2ML6A 1Q7Y4 2BHMA 2SBLA 1FGRA 1LOXA 4NPBA 4HZ9B 3GZYB 1IU7A 2Q07A 1W6GA 2OCTA 1IV9A 1OF5B 2GU1A 4EV2A 1YHQ3 1JV2B 1SIHA 3U1WA 3EE1A 1KSIA 2KCDA 3A76A 5EVHA 1RGFA 3DGYA 1IDPA 4NREA 1W01A 2V1LA 3CPW2 1EQKA 3CCM3 2YFLB 1RCKA 5CF2A 3ROBA 4GB5A 2M7OA 3EB8A 2C11A 3F8XA 5GSPA 4FCZA 5I97A 1HYFA 1IQXA 4J5GA 5AIIA 4JRFA 1QVG2 1BNRA 1VQO3 3OV4A 1AVKA 1JNQA 2CFKA 3D9RA 1B2UA 5AYRB 1W6YA 1TJDA 5RNTA 2CK3H 1W7CA 1GOVA 3OW22 4OUQA 3OWYA 2LYXA 3FF0A 2WOFA 1IVWA 1JKGA 1B3SA 1I70A 1MWUA 4N6LA 1NDOB 1FUTA 1WNHA 1X1UA 3EJVA 3FCSB 3NHXA 3SVAA 1DMNA 2UUGC 1MNLA 1B2MA 3FGYA 1V74A 4HZBB 1PY3A 1Y4KA 4X2OA 1FYSA 1AQZA 5IG5A 2CIUA 3WODG 1B27A 4GL6A 2K3DA 4U13A 4CCVA 3JUOA 5KP4A 4RNYA 1IVUA 3FG4A 1G02A 1RDSA 2CC3A 4HM0B 1EA2A 2E2UA 1IQ8A 1VQK3 1ULIB 2GXFA 3X41A 3IPTA 4X2HA 1W2ZA 3NBJA 1JZOA 1OUNA 4GHOA 1TFKA 5CK6A 3RDEA 3LZAA 3LMLA 1VQ53 4N6TA 1Q814 1GMRA 4XM4A 1LNIA 1F8NA 3CME3 3MYTA 1ROVA 1BSCA 1OCVA 3JUQA 2FGTA 1O7GB 4LSOA 2RNTA 2XGLA 4PEJA 2W9QA 3BNCA 4QWTA 3G713 1CYUA 1BSEA 5ELJA 2P09A 3HK4A 2E2TA 1JB4A 3B4OA 3A5EA 3WA2X 1E3RA 5CF1A 1GS3A 5KP3A 1GMPA 3FH1A 4I5QA 3SXXA 4EC6A 3LTDA 1BRNL 4HM4B 5IEOA 3CMA3 2XFTA 1RGEA 1MWSA 1JB5A 5HGRA 1Q40B 2XEPA 3STDA 4J8TA 3RGRA 2STDA 2YFJB 3DH2A 4MJDA 3LXUX 1O7PB 2BNGA 1NO3A 2ZHXB 1QJGA 3FLJA 5EQLA 3EN1B 6STDA 4MEIA 1U5OA 3BNEA 2XSHB 1ZS7A 5JPUA 2D1WA 1GD3A 1TIJA 2HMJB 3NQYA 4H3UA 3S5CA 1VZZA 1TRQA 3AGOA 1I0XA 1R4YA 3MHEA 3NUVA 4KT3B 5CLKA 5IG0A 1FW7A 3WR2A 4HM1B 1A2KA 1I2EA 3DY5A 1UGHI 1NWWA 2OTL3 1PFPA 1SIIA 2RBIA 3CC23 4XDVA 1Q9EA 1RRHA 4BL2A 1Z1SA 2W0QA 1KD14 4HJLB 2W56B 1RTUA 4K90B 4FMCA 1BUJA 3BNDA 2IA7A 1BSAA 1DMQA 2BIRA 1YVBI 1BSDA 1IQYA 4NHFA 3ZG0A 3E99A 1VQ73 4O02B 4ZM8A 3V92A 3PZWA 5A0OB 1V57A 3JUPA 4XDWA 3QRDA 2OQEC 3FZWA 3SEDA 4EXRA 5D83A 1A2PA 2K54A 4H61A 4FMBA 1RLSA 1T5YA 1STFI 3KSED 1GOYA 1NB3I 1BNIA 2GBWB 1E97A 3M8CA 4WHAA 3EQQB 4HVNA 4RNTA 1K41A 1M9GA 2CKFB 7STDA 4DKIA 4HM3B 2QIYA 5BVBA 1IVVA 3UNLA 1FGQA 3DZLA 2F5WA 2R41A 4FCJA 1ULJB 2CH9A 4J9AA 1BRKA 1K734 4STDA 1LOVA 1YGWA 3F8HA 3WMDA 9RNTA 1BRGA 1ROAA 3ER7A 1YI23 1RCLA 3B8LA 2BO9B 1JKGB 3RNTA 5DREA 3ZFZA 2ZDJA 3SYUA 5IG3A 1VQ43 1QALA 1K8A4 5ELUA 3GZRA 2HMKB 3ALAA 1UDII 3K63A 3NQZA 3EF8A 4I4KA 1TFOA 2HMOB 5TGNA 1M1XB 4KFEA 1GY7A 2RCDA 5FW5A 1O7MB 2RGQA 3K9MC 2WGQA 3I0YA 1M904 4HBRA 4HKVB 3LT9A 4FCMA 3B4PA 4FR9A 1JRQA 1B21A 3WDGB 3U97A 4KZ1A 1N5HA 3CPOA 5IEPA 2OOVC 3CU3A 1G0TA 4HM2B 1UI8A 4R9LA 3F9SA 1WMPA 1VQ93 3AMOA 2YFIB 3V98A 2OWPA 1IVXA 3ZG5A 1JBTA 3RGAA 3PXMA 4K1UA 3HZPA 1AVLA 1VQ63 3KSPA 1RGCA 3D5GA 2KAAA 4IIAA 5IG4A 1PU4A 1K9M4 5AIFA 3LTAA 1OPYA 3PYJA 3Q1CA 3CCU3 3KZTA 1NNVA 3SOYA 4N3VA 1RGAA 2AAEA 2XH9A 1JZDA 2IUKA 2F86B 3EBYA 2F98A 4AKZA 1KQS2 1VQL3 1W02A 2KF4A 3V99A 1KWIA 1RN4A 1RSNA 4WP5A 1QAFA 4JF8A 2Y74A 1C54A 1DMMA 3NM2A 3BB9A 3T0UA 2CWTA 1I3FA 1RGGA 1MWRA 5AYSC 1CYVA 1RHLA 3CCQ3 1HKXA 1X1YA 3H3HA 1I0VA 1YNVX 3G8ZA 1QVF2 4RBNA 2H0IA 5G1LA 4BTWA 1HU9A 1HZ1A 4EV5A 1LQMB 5G2GA 4R9KA 2O9UX 1TP6A 8CHOA 2HMLB 4L8OA 2B1XB 1AR0A 1QAKA 1M1K4 4MMZB 3T8UA 1RKYA 1RGKA 3HX8A
chains in the Genus database with same CATH topology
1GY5A 3FG1A 3CCS3 3EN8A 4MMYB 3WA3A 1ZX2A 5KP1A 3MPHA 3X3XA 2L4VA 2FXTA 3F7XA 2A15A 4XBTA 2CW9A 3WOEB 2F99A 4IT7A 4BTYA 3K5TA 4G1MB 4N6MA 3LYGA 1LNHA 3H51A 4TX4A 5LC7A 1UI7A 1ZO2A 2MF7A 3DGMA 2PNCA 1U8CB 1JB2A 2CFGA 2ML5A 2I9WA 3OWSA 3SLUA 3GRDA 1YIJ3 3DUKA 4FMAA 2CFWA 2GBXB 4Q53A 2Y73A 5CXOA 2Z76A 3CC43 1K28A 3NV0A 1NU3A 3MKIA 1J2BA 3EX9A 1YIT3 1QMAA 3FF2A 3NXJA 1AV4A 2XFSA 2INXA 1S5AA 1WMNA 2KXGA 3CNMA 5JBSA 3I563 1R4CA 4L7KA 4HM5B 1MOLA 4LGQA 1E3VA 1BUQA 3EHCA 3NBRA 1C7HA 4N6UA 2QA43 3K0ZA 1VQM3 2BMRB 2QEX3 3Q90A 3X3ZA 3NBBA 4O3VA 1OH0A 4RZMA 4KFFA 2YX9A 2BT3A 1UUVB 3X40A 1RJOA 3CD63 2OQEA 3FG3A 3IMAB 1OGZA 2CWUA 3HIIA 4MMXB 5IENA 1N8R4 4XBYA 1EG9B 3BLZA 3JUNA 3F14A 3LOYA 1YJ93 4HM7B 3T8NA 1DVCA 3S29A 3G4S3 1SQWA 1A67A 2RSXA 3CC73 2GEXA 3I553 2R4IA 2XRXB 3LT8A 1FUWA 3TDGA 5IW9A 3OWUA 2D42A 1Q824 3PS8A 3LH4A 4O2HA 1OGXA 3KE7A 3VGNA 2Z77A 2CFDA 3AMOB 1W5ZA 1RN7A 3HI7A 1VQ83 2P38A 5DRVA 2BMOB 1NJI4 1JJ22 1YJN3 3D3LA 4IPBA 3CCV3 4R80A 2WOHA 3DXOA 2FNQA 1JN5A 4HM8B 1W6CA 3Q2PA 4AKYA 3G16A 3CCL3 2WO0A 1FGOA 1STDA 3QK9A 1YJW3 2PZVA 1WQLB 2XSOB 1ISKA 5AEUB 1FGTA 3KN4A 1TU5A 3MG3A 3F7SA 3MWZA 1D6YA 4N6NB 2K0MA 4CDLA 3SOAA 3VSYA 2OOVA 2IUJA 2HMMB 3GAXA 1LVNA 1OHOA 3B7CA 2XR8B 4WYKA 3S67A 1US1A 1W4NA 1D6ZA 1N9JA 2W6JH 4OK0A 2JDIH 2QGUA 2E2VA 1KC84 4OVMA 2W9PA 1S723 3DGLA 3X3YA 1OF5A 5IERA 3MSOA 2W03A 2RFRA 3EC9A 3MG2A 3DM8A 1G96A 2XGNA 1CEWI 3SX1A 3CXC2 1RRLA 4XBXA 2Z7AA 4AEQA 4LEHA 4FMDA 4WFOA 3GZBA 3N9HA 1GYBA 2Z6BA 1N5PA 2B24B 3N8BA 4R4KA 3L0RA 1A90A 1IT7A 2ZL8A 4L8PA 3DGNA 1L5GB 1IK3A 2CG0A 4HYZA 3KKGA 1YGEA 4K1VA 1GD4A 3KIIA 2JQ5A 3LTBA 5AIGA 5D82A 5JPPA 4XB5A 1FA3A 3FSDA 4LMIA 2P0MA 3X42A 1EKMA 3BNBA 3MG1A 2KRTA 5AEWB 3NV0B 1CQSA 2CWVA 2CHCA 3O8YA 1Q864 3DMCA 4KVHA 3HIGA 3KFQC 1VQN3 3JUMA 2XF3A 5FGOA 4WWUC 1OACA 1N8QA 1Q42A 3LTCA 1ASKA 2GEYA 3S27A 1SJWA 2P0XA 2OTJ3 1W2B2 3OXAA 4R1KA 1TUHA 3PCRA 4N6OB 3WOFB 2O3OA 1W00A 3UL6A 5IF6A 3CCR3 1GY6A 1WTHA 4HM6B 3EBTA 2CG1A 3G0KA 3JVCA 2GU3A 2BMQB 3DGOA 3IJEB 1FGMA 1O7HB 3N54B 4N6V0 3UB1A 1UW1A 2CFLA 3G6E3 4EBGA 1Q40A 1N9EA 5AIHA 3UL5A 1VQP3 5STDA 4EYCA 3PCSA 4KFDA 2P05A 3F40A 3K7CA 3CCJ3 4ORLA 2C10A 2W04A 1JN5B 3J7Yd 3GWRA 1NB5I 3NM7A 1SPUA 4K61A 2UX0A 1IV7A 2HMNB 1UUWB 1OHPA 4BTXA 1IT8A 3GZXB 1DVDA 1O7NB 3CNXA 3UJMA 3FKAA 2W56A 3VF1A 3NX0A 1A2VA 2IMJA 3S28A 5D81A 4O8SA 3CCE3 4LZIA 3OX9A 1LXEA 2LQVA 5LC6A 1O7WB 1WMOA 3ECFA 4RNZA 2WGOA 2W2CA 4WYKB 5EEOA 1D6UA 2MC8A 5BXQA 3PGBA 5AI1A 1Q7Y4 1DYUA 1OHSA 2ML6A 2BHMA 2SBLA 1FGRA 1LOXA 4HZ9B 3GZYB 1IU7A 2Q07A 1W6GA 2OCTA 1IV9A 1OF5B 2GU1A 4EV2A 1YHQ3 1JV2B 1SIHA 3U1WA 3EE1A 1KSIA 2KCDA 3A76A 5EVHA 4NREA 3CPW2 1IDPA 1EQKA 1W01A 2V1LA 3CCM3 2YFLB 5CF2A 3ROBA 4GB5A 2M7OA 3EB8A 2C11A 3F8XA 4FCZA 5I97A 5AIIA 1IQXA 4JRFA 1QVG2 1VQO3 3OV4A 1AVKA 1JNQA 2CFKA 3D9RA 5AYRB 1W6YA 2CK3H 1W7CA 3OW22 4OUQA 3OWYA 2LYXA 3FF0A 2WOFA 1IVWA 1JKGA 4N6LA 1NDOB 1WNHA 3EJVA 3FCSB 3NHXA 3SVAA 1DMNA 1MNLA 3FGYA 1V74A 4HZBB 1Y4KA 4X2OA 5IG5A 2CIUA 3WODG 4GL6A 4U13A 4CCVA 3JUOA 5KP4A 4RNYA 1IVUA 3FG4A 2CC3A 4HM0B 1EA2A 2E2UA 1IQ8A 1VQK3 1ULIB 2GXFA 3X41A 3IPTA 4X2HA 1W2ZA 3NBJA 1OUNA 1TFKA 5CK6A 3RDEA 3LZAA 3LMLA 1VQ53 4N6TA 1Q814 4XM4A 1F8NA 3CME3 3MYTA 1ROVA 3JUQA 1OCVA 2FGTA 1O7GB 4LSOA 2XGLA 4PEJA 2W9QA 3BNCA 4QWTA 3G713 1CYUA 5ELJA 2P09A 3HK4A 2E2TA 1JB4A 3B4OA 3WA2X 5CF1A 1E3RA 1GS3A 5KP3A 4EC6A 3FH1A 3SXXA 3LTDA 4HM4B 5IEOA 3CMA3 2XFTA 1JB5A 5HGRA 1Q40B 2XEPA 3STDA 4J8TA 3RGRA 2STDA 2YFJB 4MJDA 3LXUX 1O7PB 2BNGA 1NO3A 1QJGA 3FLJA 5EQLA 3EN1B 6STDA 4MEIA 1U5OA 3BNEA 2XSHB 5JPUA 2D1WA 1GD3A 1TIJA 2HMJB 3NQYA 4H3UA 3S5CA 1VZZA 3MHEA 3NUVA 5CLKA 5IG0A 4HM1B 1A2KA 3DY5A 1NWWA 2OTL3 1PFPA 1SIIA 3CC23 4XDVA 1RRHA 1Z1SA 2W0QA 1KD14 4HJLB 2W56B 4K90B 4FMCA 3BNDA 2IA7A 1DMQA 4NHFA 1YVBI 1VQ73 1IQYA 3E99A 4O02B 4ZM8A 3V92A 3PZWA 5A0OB 3JUPA 4XDWA 3QRDA 2OQEC 3FZWA 3SEDA 4EXRA 5D83A 2K54A 4H61A 4FMBA 1T5YA 1STFI 3KSED 1NB3I 2GBWB 1E97A 3M8CA 4WHAA 3EQQB 4HVNA 1K41A 1M9GA 2CKFB 7STDA 4HM3B 2QIYA 5BVBA 1IVVA 3UNLA 1FGQA 3DZLA 4FCJA 1ULJB 2CH9A 4J9AA 1K734 4STDA 3F8HA 3WMDA 1ROAA 3ER7A 1YI23 3B8LA 2BO9B 1JKGB 5DREA 2ZDJA 5IG3A 1VQ43 1QALA 1K8A4 5ELUA 3GZRA 2HMKB 3ALAA 3K63A 3NQZA 3EF8A 4I4KA 1TFOA 2HMOB 5TGNA 1M1XB 4KFEA 2RCDA 1GY7A 5FW5A 1O7MB 2RGQA 3K9MC 2WGQA 3I0YA 1M904 4HBRA 4HKVB 3LT9A 4FCMA 3B4PA 4FR9A 1JRQA 3WDGB 3U97A 4KZ1A 1N5HA 3CPOA 5IEPA 2OOVC 3CU3A 4HM2B 1UI8A 4R9LA 3F9SA 1WMPA 1VQ93 3AMOA 2YFIB 3V98A 2OWPA 1IVXA 3RGAA 3PXMA 4K1UA 3HZPA 1AVLA 1VQ63 3KSPA 1K9M4 4IIAA 1PU4A 5AIFA 3LTAA 1OPYA 3PYJA 3Q1CA 3CCU3 3KZTA 3SOYA 4N3VA 2XH9A 2IUKA 2F86B 3EBYA 2F98A 4AKZA 1KQS2 1VQL3 1W02A 3V99A 1KWIA 4WP5A 1QAFA 4JF8A 2Y74A 1DMMA 3NM2A 3BB9A 3T0UA 2CWTA 5AYSC 1CYVA 3CCQ3 1HKXA 3H3HA 3G8ZA 1QVF2 4RBNA 4BTWA 1HU9A 4EV5A 5G2GA 4R9KA 2O9UX 1TP6A 8CHOA 2HMLB 4L8OA 2B1XB 1AR0A 1QAKA 1M1K4 4MMZB 3T8UA 1RKYA 5IG4A 3HX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY5 A;  3EN8 A;  1ZX2 A;  5KP1 A;  3F7X A;  2A15 A;  4XBT A;  2F99 A;  3LYG A;  3H51 A;  1ZO2 A;  1JB2 A;  2I9W A;  3OWS A;  3GRD A;  3DUK A;  2GBX B;  4Q53 A;  5CXO A;  2Z76 A;  3NV0 A;  1NU3 A;  3MKI A;  3EX9 A;  1QMA A;  3FF2 A;  3NXJ A;  2INX A;  1S5A A;  3CNM A;  4L7K A;  4HM5 B;  4LGQ A;  1E3V A;  1BUQ A;  3EHC A;  3NBR A;  1C7H A;  3K0Z A;  2BMR B;  3Q90 A;  1OH0 A;  4RZM A;  1UUV B;  1OGZ A;  5IEN A;  4XBY A;  1EG9 B;  3BLZ A;  3JUN A;  3F14 A;  4HM7 B;  3T8N A;  2GEX A;  2R4I A;  2XRX B;  3OWU A;  1OGX A;  3KE7 A;  3VGN A;  2Z77 A;  5DRV A;  2BMO B;  3DXO A;  1JN5 A;  4HM8 B;  3G16 A;  1STD A;  2PZV A;  1WQL B;  2XSO B;  1ISK A;  5AEU B;  3MG3 A;  3F7S A;  4CDL A;  3SOA A;  3VSY A;  2HMM B;  4WYK A;  1OHO A;  3B7C A;  2XR8 B;  2QGU A;  4OVM A;  5IER A;  1OF5 A;  3MSO A;  2RFR A;  3EC9 A;  3MG2 A;  3DM8 A;  4XBX A;  2Z7A A;  4LEH A;  3GZB A;  1GYB A;  2B24 B;  4L8P A;  3KKG A;  4K1V A;  2JQ5 A;  5AIG A;  5D82 A;  5JPP A;  4XB5 A;  3FSD A;  4LMI A;  3MG1 A;  5AEW B;  3NV0 B;  1CQS A;  2CHC A;  3DMC A;  4KVH A;  3JUM A;  4WWU C;  1Q42 A;  1ASK A;  2GEY A;  1SJW A;  3OXA A;  4R1K A;  1TUH A;  1W00 A;  5IF6 A;  1GY6 A;  4HM6 B;  3EBT A;  3G0K A;  2BMQ B;  1O7H B;  1Q40 A;  5AIH A;  5STD A;  3F40 A;  3K7C A;  4ORL A;  1JN5 B;  3GWR A;  2UX0 A;  2HMN B;  1UUW B;  1OHP A;  3GZX B;  1O7N B;  3CNX A;  3UJM A;  3FKA A;  2IMJ A;  5D81 A;  3OX9 A;  1O7W B;  3ECF A;  2W2C A;  4WYK B;  5BXQ A;  5AI1 A;  1OHS A;  4HZ9 B;  3GZY B;  1OF5 B;  3A76 A;  5EVH A;  1IDP A;  1W01 A;  2YFL B;  5CF2 A;  3ROB A;  4GB5 A;  3F8X A;  5AII A;  3OV4 A;  3D9R A;  1W6Y A;  4OUQ A;  3OWY A;  3FF0 A;  1JKG A;  1NDO B;  3EJV A;  3NHX A;  1DMN A;  3FGY A;  4HZB B;  4X2O A;  5IG5 A;  4U13 A;  3JUO A;  5KP4 A;  4HM0 B;  1EA2 A;  1ULI B;  2GXF A;  3IPT A;  4X2H A;  1OUN A;  5CK6 A;  3LZA A;  4XM4 A;  3MYT A;  3JUQ A;  1OCV A;  1O7G B;  4PEJ A;  3HK4 A;  1JB4 A;  3B4O A;  5CF1 A;  1E3R A;  1GS3 A;  5KP3 A;  3FH1 A;  4HM4 B;  5IEO A;  1JB5 A;  5HGR A;  1Q40 B;  3STD A;  4J8T A;  3RGR A;  2STD A;  2YFJ B;  4MJD A;  1O7P B;  2BNG A;  1QJG A;  3FLJ A;  3EN1 B;  6STD A;  1U5O A;  2XSH B;  5JPU A;  4H3U A;  2HMJ B;  3S5C A;  1VZZ A;  3MHE A;  3NUV A;  5CLK A;  5IG0 A;  4HM1 B;  1A2K A;  1NWW A;  4XDV A;  1Z1S A;  4HJL B;  1DMQ A;  3E99 A;  3JUP A;  4XDW A;  3FZW A;  3SED A;  5D83 A;  2K54 A;  2GBW B;  1E97 A;  3M8C A;  3EQQ B;  4HVN A;  1K41 A;  2CKF B;  7STD A;  4HM3 B;  2QIY A;  5BVB A;  3UNL A;  3DZL A;  4FCJ A;  1ULJ B;  4J9A A;  4STD A;  3F8H A;  3WMD A;  3ER7 A;  3B8L A;  1JKG B;  5DRE A;  5IG3 A;  3GZR A;  2HMK B;  3EF8 A;  4I4K A;  2HMO B;  5TGN A;  5FW5 A;  1GY7 A;  2RCD A;  1O7M B;  2RGQ A;  3I0Y A;  4HKV B;  4FCM A;  3B4P A;  3CPO A;  5IEP A;  3CU3 A;  4HM2 B;  4R9L A;  3F9S A;  2YFI B;  2OWP A;  3RGA A;  4K1U A;  3HZP A;  3KSP A;  4IIA A;  5AIF A;  1OPY A;  3KZT A;  3SOY A;  4N3V A;  2F86 B;  3EBY A;  2F98 A;  1W02 A;  4WP5 A;  1DMM A;  3NM2 A;  3BB9 A;  1HKX A;  3H3H A;  3G8Z A;  5G2G A;  4R9K A;  1TP6 A;  8CHO A;  4L8O A;  2HML B;  2B1X B;  1AR0 A;  3T8U A;  5IG4 A;  3HX8 A; 
#chains in the Genus database with same CATH topology
 1GY5 A;  3FG1 A;  1TRP A;  1X1X A;  2IY2 A;  3EN8 A;  3CCS 3;  1B20 A;  4MMY B;  3WA3 A;  1ZX2 A;  5KP1 A;  3MPH A;  3X3X A;  2L4V A;  2FXT A;  3KCH A;  5BIR A;  3F7X A;  2A15 A;  4XBT A;  2C4B A;  1I8V A;  1ZGX A;  2CW9 A;  5HOH A;  1UCL A;  3WOE B;  2F99 A;  2H0G A;  4IT7 A;  4BTY A;  3K5T A;  4BU4 A;  4G1M B;  4N6M A;  3LYG A;  1LNH A;  3H51 A;  4TX4 A;  5LC7 A;  1UI7 A;  1ZO2 A;  2MF7 A;  3DGM A;  2PNC A;  1U8C B;  1Q7H A;  1JB2 A;  2CFG A;  2ML5 A;  2I9W A;  3OWS A;  4HAA A;  3GRD A;  3SLU A;  1YIJ 3;  3DUK A;  4FMA A;  1T3B A;  2CFW A;  2GBX B;  2J8X B;  4Q53 A;  2Y73 A;  5CXO A;  1DE3 A;  2Z76 A;  4BL3 A;  3CC4 3;  1K28 A;  3NV0 A;  1BGS A;  1NU3 A;  3MKI A;  1J2B A;  3EX9 A;  1YIT 3;  1QMA A;  2KF3 A;  3FF2 A;  3NXJ A;  1AV4 A;  2XFS A;  2INX A;  1S5A A;  1WMN A;  2KXG A;  3CNM A;  5M1A A;  5JBS A;  3I56 3;  1R4C A;  4L7K A;  4HM5 B;  4CJN A;  1MOL A;  4LGQ A;  1E3V A;  1BUQ A;  1BNG A;  3EHC A;  3NBR A;  1C7H A;  4N6U A;  1BRI A;  2QA4 3;  3K0Z A;  1VQM 3;  2BMR B;  2QEX 3;  3Q90 A;  3X3Z A;  1BNF A;  3NBB A;  4O3V A;  3Q3F A;  1OH0 A;  4CPK A;  4RZM A;  4KFF A;  2YX9 A;  2BT3 A;  1UUV B;  3AHS A;  1RJO A;  3X40 A;  3CD6 3;  2OQE A;  1BRJ A;  1RMS A;  3FG3 A;  1JBS A;  3IMA B;  1BAO A;  1BNS A;  1OGZ A;  2CWU A;  3HII A;  4MMX B;  5IEN A;  1N8R 4;  4XBY A;  1EG9 B;  3BLZ A;  1BRH A;  3F14 A;  3JUN A;  3LOY A;  4J5K A;  1YJ9 3;  4HM7 B;  3T8N A;  1DVC A;  3S29 A;  3URP A;  1I2G A;  3G4S 3;  1SQW A;  2KF5 A;  1A67 A;  2RSX A;  3CC7 3;  2GSP A;  2GEX A;  2HOH A;  3I55 3;  4HOH A;  2CX1 A;  1CH0 A;  2R4I A;  2XRX B;  1V58 A;  3LT8 A;  1FUW A;  3TDG A;  1BSB A;  3OWU A;  5IW9 A;  1JBR A;  2D42 A;  1I2F A;  4GSP A;  1Q82 4;  3PS8 A;  1B2X A;  1UCJ A;  3LH4 A;  4O2H A;  1OGX A;  3KE7 A;  3VGN A;  1BOX A;  2CFD A;  2Z77 A;  3AMO B;  1W5Z A;  1B2Z A;  1RN7 A;  3HI7 A;  5BU4 A;  1VQ8 3;  2P38 A;  5DRV A;  2BMO B;  1NJI 4;  1JJ2 2;  1YJN 3;  3D3L A;  4IPB A;  3CCV 3;  4R80 A;  2WOH A;  3DXO A;  2FNQ A;  1JN5 A;  4HM8 B;  1W6C A;  1DET A;  3Q2P A;  4AKY A;  3G16 A;  3CCL 3;  2WO0 A;  1FGO A;  1STD A;  3QK9 A;  1RNT A;  1UGI A;  1YJW 3;  1AY7 A;  3BIR A;  2UGI A;  4EW5 A;  7RNT A;  2PZV A;  1WQL B;  2XSO B;  1ISK A;  5AEU B;  1FGT A;  3KN4 A;  1EUI C;  1TU5 A;  1RGL A;  3F7S A;  3MG3 A;  1D6Y A;  2F56 A;  2L1S A;  3BU4 A;  3MWZ A;  4N6N B;  1UUG B;  2K0M A;  4CDL A;  3SOA A;  2CX0 A;  3VSY A;  2OOV A;  2IUJ A;  2HMM B;  3GAX A;  1LVN A;  1OHO A;  3B7C A;  2XR8 B;  1MWT A;  4WYK A;  1US1 A;  3S67 A;  1YVS A;  1W4N A;  1D6Z A;  1N9J A;  1EEJ A;  2W6J H;  4OK0 A;  2F5M A;  1LOY A;  2JDI H;  2QGU A;  2E2V A;  3D4A A;  4OVM A;  1KC8 4;  2W9P A;  1S72 3;  3DGL A;  1MGW A;  3X3Y A;  1OF5 A;  5IER A;  3MSO A;  2W03 A;  2RFR A;  3EC9 A;  3HOH A;  3DM8 A;  1G96 A;  2XGN A;  1CEW I;  3MG2 A;  1BIR A;  8RNT A;  3SX1 A;  3CXC 2;  3AHW A;  1RRL A;  3WHO A;  4XBX A;  2Z7A A;  4AEQ A;  4LEH A;  4FMD A;  4WFO A;  3D5I A;  3GZB A;  3N9H A;  1GYB A;  2Z6B A;  1N5P A;  2B24 B;  2ZA4 A;  3N8B A;  3L0R A;  4R4K A;  1A90 A;  1BAN A;  1IT7 A;  2ZL8 A;  4L8P A;  3DGN A;  1GOU A;  4ILF A;  1T2I A;  1L5G B;  1IK3 A;  1PYL A;  2CG0 A;  6RNT A;  4HYZ A;  1FZU A;  3KKG A;  1YGE A;  4K1V A;  1GD4 A;  1MGR A;  3GSP A;  5G1K A;  3KII A;  2JQ5 A;  3LTB A;  5AIG A;  5D82 A;  5JPP A;  4XB5 A;  1FA3 A;  3FSD A;  4LMI A;  2P0M A;  3X42 A;  1EKM A;  1GMQ A;  3BNB A;  3MG1 A;  2KRT A;  5AEW B;  3NV0 B;  1CQS A;  1UCI A;  7GSP A;  1VQQ A;  2CWV A;  2CHC A;  3O8Y A;  2F4Y A;  1Q86 4;  3DMC A;  4KVH A;  3HIG A;  1LQG C;  3KFQ C;  1VQN 3;  3JUM A;  2XF3 A;  5FGO A;  1BNE A;  2KF6 A;  1IYY A;  4WWU C;  1OAC A;  5M19 A;  1N8Q A;  1Q42 A;  1I3I A;  1TTO A;  3LTC A;  1ASK A;  2GEY A;  3S27 A;  1SJW A;  1SAR A;  2P0X A;  2OTJ 3;  1W2B 2;  3OXA A;  4R1K A;  1TUH A;  3PCR A;  1RGH A;  4N6O B;  3WOF B;  2O3O A;  1RNB A;  1W00 A;  3UL6 A;  5IF6 A;  3CCR 3;  1GY6 A;  5M18 A;  1WTH A;  3D79 A;  4HM6 B;  1BNJ A;  3EBT A;  2CG1 A;  3G0K A;  3JVC A;  4BIR A;  2GU3 A;  1T2H A;  2BMQ B;  3DGO A;  3IJE B;  6GSP A;  1BU4 A;  1B2S A;  1FGM A;  2AAD A;  1O7H B;  3N54 B;  4N6V 0;  3UB1 A;  1UW1 A;  2CFL A;  3G6E 3;  1LOW A;  4EBG A;  1Q40 A;  1N9E A;  5AIH A;  3UL5 A;  1VQP 3;  5STD A;  4EYC A;  3PCS A;  4KFD A;  2P05 A;  1BRS A;  1GSP A;  3F40 A;  3K7C A;  3CCJ 3;  4ORL A;  2C10 A;  4LYL B;  2SAR A;  2W04 A;  1JN5 B;  2H0H A;  3J7Y d;  1UCK A;  3GWR A;  1NB5 I;  3AGN A;  1FUS A;  2IYJ A;  3NM7 A;  1SPU A;  1X1W A;  4K61 A;  2UX0 A;  1RN1 A;  1IV7 A;  2HMN B;  1UUW B;  1OHP A;  4BTX A;  1IT8 A;  3GZX B;  1DVD A;  1O7N B;  1BVI A;  3CNX A;  3UJM A;  3FKA A;  2W56 A;  3VF1 A;  3NX0 A;  1A2V A;  2IMJ A;  3S28 A;  5D81 A;  4O8S A;  3CCE 3;  4LZI A;  3OX9 A;  1LXE A;  2LQV A;  5LC6 A;  1O7W B;  1WMO A;  3ECF A;  4RNZ A;  2WGO A;  1LRA A;  2W2C A;  4WYK B;  1D6U A;  5EEO A;  2MC8 A;  5BXQ A;  2BU4 A;  3PGB A;  5AI1 A;  1DYU A;  1OHS A;  2ML6 A;  1Q7Y 4;  2BHM A;  2SBL A;  1FGR A;  1LOX A;  4NPB A;  4HZ9 B;  3GZY B;  1IU7 A;  2Q07 A;  1W6G A;  2OCT A;  1IV9 A;  1OF5 B;  2GU1 A;  4EV2 A;  1YHQ 3;  1JV2 B;  1SIH A;  3U1W A;  3EE1 A;  1KSI A;  2KCD A;  3A76 A;  5EVH A;  1RGF A;  3DGY A;  1IDP A;  4NRE A;  1W01 A;  2V1L A;  3CPW 2;  1EQK A;  3CCM 3;  2YFL B;  1RCK A;  5CF2 A;  3ROB A;  4GB5 A;  2M7O A;  3EB8 A;  2C11 A;  3F8X A;  5GSP A;  4FCZ A;  5I97 A;  1HYF A;  1IQX A;  4J5G A;  5AII A;  4JRF A;  1QVG 2;  1BNR A;  1VQO 3;  3OV4 A;  1AVK A;  1JNQ A;  2CFK A;  3D9R A;  1B2U A;  5AYR B;  1W6Y A;  1TJD A;  5RNT A;  2CK3 H;  1W7C A;  1GOV A;  3OW2 2;  4OUQ A;  3OWY A;  2LYX A;  3FF0 A;  2WOF A;  1IVW A;  1JKG A;  1B3S A;  1I70 A;  1MWU A;  4N6L A;  1NDO B;  1FUT A;  1WNH A;  1X1U A;  3EJV A;  3FCS B;  3NHX A;  3SVA A;  1DMN A;  2UUG C;  1MNL A;  1B2M A;  3FGY A;  1V74 A;  4HZB B;  1PY3 A;  1Y4K A;  4X2O A;  1FYS A;  1AQZ A;  5IG5 A;  2CIU A;  3WOD G;  1B27 A;  4GL6 A;  2K3D A;  4U13 A;  4CCV A;  3JUO A;  5KP4 A;  4RNY A;  1IVU A;  3FG4 A;  1G02 A;  1RDS A;  2CC3 A;  4HM0 B;  1EA2 A;  2E2U A;  1IQ8 A;  1VQK 3;  1ULI B;  2GXF A;  3X41 A;  3IPT A;  4X2H A;  1W2Z A;  3NBJ A;  1JZO A;  1OUN A;  4GHO A;  1TFK A;  5CK6 A;  3RDE A;  3LZA A;  3LML A;  1VQ5 3;  4N6T A;  1Q81 4;  1GMR A;  4XM4 A;  1LNI A;  1F8N A;  3CME 3;  3MYT A;  1ROV A;  1BSC A;  1OCV A;  3JUQ A;  2FGT A;  1O7G B;  4LSO A;  2RNT A;  2XGL A;  4PEJ A;  2W9Q A;  3BNC A;  4QWT A;  3G71 3;  1CYU A;  1BSE A;  5ELJ A;  2P09 A;  3HK4 A;  2E2T A;  1JB4 A;  3B4O A;  3A5E A;  3WA2 X;  1E3R A;  5CF1 A;  1GS3 A;  5KP3 A;  1GMP A;  3FH1 A;  4I5Q A;  3SXX A;  4EC6 A;  3LTD A;  1BRN L;  4HM4 B;  5IEO A;  3CMA 3;  2XFT A;  1RGE A;  1MWS A;  1JB5 A;  5HGR A;  1Q40 B;  2XEP A;  3STD A;  4J8T A;  3RGR A;  2STD A;  2YFJ B;  3DH2 A;  4MJD A;  3LXU X;  1O7P B;  2BNG A;  1NO3 A;  2ZHX B;  1QJG A;  3FLJ A;  5EQL A;  3EN1 B;  6STD A;  4MEI A;  1U5O A;  3BNE A;  2XSH B;  1ZS7 A;  5JPU A;  2D1W A;  1GD3 A;  1TIJ A;  2HMJ B;  3NQY A;  4H3U A;  3S5C A;  1VZZ A;  1TRQ A;  3AGO A;  1I0X A;  1R4Y A;  3MHE A;  3NUV A;  4KT3 B;  5CLK A;  5IG0 A;  1FW7 A;  3WR2 A;  4HM1 B;  1A2K A;  1I2E A;  3DY5 A;  1UGH I;  1NWW A;  2OTL 3;  1PFP A;  1SII A;  2RBI A;  3CC2 3;  4XDV A;  1Q9E A;  1RRH A;  4BL2 A;  1Z1S A;  2W0Q A;  1KD1 4;  4HJL B;  2W56 B;  1RTU A;  4K90 B;  4FMC A;  1BUJ A;  3BND A;  2IA7 A;  1BSA A;  1DMQ A;  2BIR A;  1YVB I;  1BSD A;  1IQY A;  4NHF A;  3ZG0 A;  3E99 A;  1VQ7 3;  4O02 B;  4ZM8 A;  3V92 A;  3PZW A;  5A0O B;  1V57 A;  3JUP A;  4XDW A;  3QRD A;  2OQE C;  3FZW A;  3SED A;  4EXR A;  5D83 A;  1A2P A;  2K54 A;  4H61 A;  4FMB A;  1RLS A;  1T5Y A;  1STF I;  3KSE D;  1GOY A;  1NB3 I;  1BNI A;  2GBW B;  1E97 A;  3M8C A;  4WHA A;  3EQQ B;  4HVN A;  4RNT A;  1K41 A;  1M9G A;  2CKF B;  7STD A;  4DKI A;  4HM3 B;  2QIY A;  5BVB A;  1IVV A;  3UNL A;  1FGQ A;  3DZL A;  2F5W A;  2R41 A;  4FCJ A;  1ULJ B;  2CH9 A;  4J9A A;  1BRK A;  1K73 4;  4STD A;  1LOV A;  1YGW A;  3F8H A;  3WMD A;  9RNT A;  1BRG A;  1ROA A;  3ER7 A;  1YI2 3;  1RCL A;  3B8L A;  2BO9 B;  1JKG B;  3RNT A;  5DRE A;  3ZFZ A;  2ZDJ A;  3SYU A;  5IG3 A;  1VQ4 3;  1QAL A;  1K8A 4;  5ELU A;  3GZR A;  2HMK B;  3ALA A;  1UDI I;  3K63 A;  3NQZ A;  3EF8 A;  4I4K A;  1TFO A;  2HMO B;  5TGN A;  1M1X B;  4KFE A;  1GY7 A;  2RCD A;  5FW5 A;  1O7M B;  2RGQ A;  3K9M C;  2WGQ A;  3I0Y A;  1M90 4;  4HBR A;  4HKV B;  3LT9 A;  4FCM A;  3B4P A;  4FR9 A;  1JRQ A;  1B21 A;  3WDG B;  3U97 A;  4KZ1 A;  1N5H A;  3CPO A;  5IEP A;  2OOV C;  3CU3 A;  1G0T A;  4HM2 B;  1UI8 A;  4R9L A;  3F9S A;  1WMP A;  1VQ9 3;  3AMO A;  2YFI B;  3V98 A;  2OWP A;  1IVX A;  3ZG5 A;  1JBT A;  3RGA A;  3PXM A;  4K1U A;  3HZP A;  1AVL A;  1VQ6 3;  3KSP A;  1RGC A;  3D5G A;  2KAA A;  4IIA A;  5IG4 A;  1PU4 A;  1K9M 4;  5AIF A;  3LTA A;  1OPY A;  3PYJ A;  3Q1C A;  3CCU 3;  3KZT A;  1NNV A;  3SOY A;  4N3V A;  1RGA A;  2AAE A;  2XH9 A;  1JZD A;  2IUK A;  2F86 B;  3EBY A;  2F98 A;  4AKZ A;  1KQS 2;  1VQL 3;  1W02 A;  2KF4 A;  3V99 A;  1KWI A;  1RN4 A;  1RSN A;  4WP5 A;  1QAF A;  4JF8 A;  2Y74 A;  1C54 A;  1DMM A;  3NM2 A;  3BB9 A;  3T0U A;  2CWT A;  1I3F A;  1RGG A;  1MWR A;  5AYS C;  1CYV A;  1RHL A;  3CCQ 3;  1HKX A;  1X1Y A;  3H3H A;  1I0V A;  1YNV X;  3G8Z A;  1QVF 2;  4RBN A;  2H0I A;  5G1L A;  4BTW A;  1HU9 A;  1HZ1 A;  4EV5 A;  1LQM B;  5G2G A;  4R9K A;  2O9U X;  1TP6 A;  8CHO A;  2HML B;  4L8O A;  2B1X B;  1AR0 A;  1QAK A;  1M1K 4;  4MMZ B;  3T8U A;  1RKY A;  1RGK A;  3HX8 A; 
#chains in the Genus database with same CATH homology
 1GY5 A;  3FG1 A;  3CCS 3;  3EN8 A;  4MMY B;  3WA3 A;  1ZX2 A;  5KP1 A;  3MPH A;  3X3X A;  2L4V A;  2FXT A;  3F7X A;  2A15 A;  4XBT A;  2CW9 A;  3WOE B;  2F99 A;  4IT7 A;  4BTY A;  3K5T A;  4G1M B;  4N6M A;  3LYG A;  1LNH A;  3H51 A;  4TX4 A;  5LC7 A;  1UI7 A;  1ZO2 A;  2MF7 A;  3DGM A;  2PNC A;  1U8C B;  1JB2 A;  2CFG A;  2ML5 A;  2I9W A;  3OWS A;  3SLU A;  3GRD A;  1YIJ 3;  3DUK A;  4FMA A;  2CFW A;  2GBX B;  4Q53 A;  2Y73 A;  5CXO A;  2Z76 A;  3CC4 3;  1K28 A;  3NV0 A;  1NU3 A;  3MKI A;  1J2B A;  3EX9 A;  1YIT 3;  1QMA A;  3FF2 A;  3NXJ A;  1AV4 A;  2XFS A;  2INX A;  1S5A A;  1WMN A;  2KXG A;  3CNM A;  5JBS A;  3I56 3;  1R4C A;  4L7K A;  4HM5 B;  1MOL A;  4LGQ A;  1E3V A;  1BUQ A;  3EHC A;  3NBR A;  1C7H A;  4N6U A;  2QA4 3;  3K0Z A;  1VQM 3;  2BMR B;  2QEX 3;  3Q90 A;  3X3Z A;  3NBB A;  4O3V A;  1OH0 A;  4RZM A;  4KFF A;  2YX9 A;  2BT3 A;  1UUV B;  3X40 A;  1RJO A;  3CD6 3;  2OQE A;  3FG3 A;  3IMA B;  1OGZ A;  2CWU A;  3HII A;  4MMX B;  5IEN A;  1N8R 4;  4XBY A;  1EG9 B;  3BLZ A;  3JUN A;  3F14 A;  3LOY A;  1YJ9 3;  4HM7 B;  3T8N A;  1DVC A;  3S29 A;  3G4S 3;  1SQW A;  1A67 A;  2RSX A;  3CC7 3;  2GEX A;  3I55 3;  2R4I A;  2XRX B;  3LT8 A;  1FUW A;  3TDG A;  5IW9 A;  3OWU A;  2D42 A;  1Q82 4;  3PS8 A;  3LH4 A;  4O2H A;  1OGX A;  3KE7 A;  3VGN A;  2Z77 A;  2CFD A;  3AMO B;  1W5Z A;  1RN7 A;  3HI7 A;  1VQ8 3;  2P38 A;  5DRV A;  2BMO B;  1NJI 4;  1JJ2 2;  1YJN 3;  3D3L A;  4IPB A;  3CCV 3;  4R80 A;  2WOH A;  3DXO A;  2FNQ A;  1JN5 A;  4HM8 B;  1W6C A;  3Q2P A;  4AKY A;  3G16 A;  3CCL 3;  2WO0 A;  1FGO A;  1STD A;  3QK9 A;  1YJW 3;  2PZV A;  1WQL B;  2XSO B;  1ISK A;  5AEU B;  1FGT A;  3KN4 A;  1TU5 A;  3MG3 A;  3F7S A;  3MWZ A;  1D6Y A;  4N6N B;  2K0M A;  4CDL A;  3SOA A;  3VSY A;  2OOV A;  2IUJ A;  2HMM B;  3GAX A;  1LVN A;  1OHO A;  3B7C A;  2XR8 B;  4WYK A;  3S67 A;  1US1 A;  1W4N A;  1D6Z A;  1N9J A;  2W6J H;  4OK0 A;  2JDI H;  2QGU A;  2E2V A;  1KC8 4;  4OVM A;  2W9P A;  1S72 3;  3DGL A;  3X3Y A;  1OF5 A;  5IER A;  3MSO A;  2W03 A;  2RFR A;  3EC9 A;  3MG2 A;  3DM8 A;  1G96 A;  2XGN A;  1CEW I;  3SX1 A;  3CXC 2;  1RRL A;  4XBX A;  2Z7A A;  4AEQ A;  4LEH A;  4FMD A;  4WFO A;  3GZB A;  3N9H A;  1GYB A;  2Z6B A;  1N5P A;  2B24 B;  3N8B A;  4R4K A;  3L0R A;  1A90 A;  1IT7 A;  2ZL8 A;  4L8P A;  3DGN A;  1L5G B;  1IK3 A;  2CG0 A;  4HYZ A;  3KKG A;  1YGE A;  4K1V A;  1GD4 A;  3KII A;  2JQ5 A;  3LTB A;  5AIG A;  5D82 A;  5JPP A;  4XB5 A;  1FA3 A;  3FSD A;  4LMI A;  2P0M A;  3X42 A;  1EKM A;  3BNB A;  3MG1 A;  2KRT A;  5AEW B;  3NV0 B;  1CQS A;  2CWV A;  2CHC A;  3O8Y A;  1Q86 4;  3DMC A;  4KVH A;  3HIG A;  3KFQ C;  1VQN 3;  3JUM A;  2XF3 A;  5FGO A;  4WWU C;  1OAC A;  1N8Q A;  1Q42 A;  3LTC A;  1ASK A;  2GEY A;  3S27 A;  1SJW A;  2P0X A;  2OTJ 3;  1W2B 2;  3OXA A;  4R1K A;  1TUH A;  3PCR A;  4N6O B;  3WOF B;  2O3O A;  1W00 A;  3UL6 A;  5IF6 A;  3CCR 3;  1GY6 A;  1WTH A;  4HM6 B;  3EBT A;  2CG1 A;  3G0K A;  3JVC A;  2GU3 A;  2BMQ B;  3DGO A;  3IJE B;  1FGM A;  1O7H B;  3N54 B;  4N6V 0;  3UB1 A;  1UW1 A;  2CFL A;  3G6E 3;  4EBG A;  1Q40 A;  1N9E A;  5AIH A;  3UL5 A;  1VQP 3;  5STD A;  4EYC A;  3PCS A;  4KFD A;  2P05 A;  3F40 A;  3K7C A;  3CCJ 3;  4ORL A;  2C10 A;  2W04 A;  1JN5 B;  3J7Y d;  3GWR A;  1NB5 I;  3NM7 A;  1SPU A;  4K61 A;  2UX0 A;  1IV7 A;  2HMN B;  1UUW B;  1OHP A;  4BTX A;  1IT8 A;  3GZX B;  1DVD A;  1O7N B;  3CNX A;  3UJM A;  3FKA A;  2W56 A;  3VF1 A;  3NX0 A;  1A2V A;  2IMJ A;  3S28 A;  5D81 A;  4O8S A;  3CCE 3;  4LZI A;  3OX9 A;  1LXE A;  2LQV A;  5LC6 A;  1O7W B;  1WMO A;  3ECF A;  4RNZ A;  2WGO A;  2W2C A;  4WYK B;  5EEO A;  1D6U A;  2MC8 A;  5BXQ A;  3PGB A;  5AI1 A;  1Q7Y 4;  1DYU A;  1OHS A;  2ML6 A;  2BHM A;  2SBL A;  1FGR A;  1LOX A;  4HZ9 B;  3GZY B;  1IU7 A;  2Q07 A;  1W6G A;  2OCT A;  1IV9 A;  1OF5 B;  2GU1 A;  4EV2 A;  1YHQ 3;  1JV2 B;  1SIH A;  3U1W A;  3EE1 A;  1KSI A;  2KCD A;  3A76 A;  5EVH A;  4NRE A;  3CPW 2;  1IDP A;  1EQK A;  1W01 A;  2V1L A;  3CCM 3;  2YFL B;  5CF2 A;  3ROB A;  4GB5 A;  2M7O A;  3EB8 A;  2C11 A;  3F8X A;  4FCZ A;  5I97 A;  5AII A;  1IQX A;  4JRF A;  1QVG 2;  1VQO 3;  3OV4 A;  1AVK A;  1JNQ A;  2CFK A;  3D9R A;  5AYR B;  1W6Y A;  2CK3 H;  1W7C A;  3OW2 2;  4OUQ A;  3OWY A;  2LYX A;  3FF0 A;  2WOF A;  1IVW A;  1JKG A;  4N6L A;  1NDO B;  1WNH A;  3EJV A;  3FCS B;  3NHX A;  3SVA A;  1DMN A;  1MNL A;  3FGY A;  1V74 A;  4HZB B;  1Y4K A;  4X2O A;  5IG5 A;  2CIU A;  3WOD G;  4GL6 A;  4U13 A;  4CCV A;  3JUO A;  5KP4 A;  4RNY A;  1IVU A;  3FG4 A;  2CC3 A;  4HM0 B;  1EA2 A;  2E2U A;  1IQ8 A;  1VQK 3;  1ULI B;  2GXF A;  3X41 A;  3IPT A;  4X2H A;  1W2Z A;  3NBJ A;  1OUN A;  1TFK A;  5CK6 A;  3RDE A;  3LZA A;  3LML A;  1VQ5 3;  4N6T A;  1Q81 4;  4XM4 A;  1F8N A;  3CME 3;  3MYT A;  1ROV A;  3JUQ A;  1OCV A;  2FGT A;  1O7G B;  4LSO A;  2XGL A;  4PEJ A;  2W9Q A;  3BNC A;  4QWT A;  3G71 3;  1CYU A;  5ELJ A;  2P09 A;  3HK4 A;  2E2T A;  1JB4 A;  3B4O A;  3WA2 X;  5CF1 A;  1E3R A;  1GS3 A;  5KP3 A;  4EC6 A;  3FH1 A;  3SXX A;  3LTD A;  4HM4 B;  5IEO A;  3CMA 3;  2XFT A;  1JB5 A;  5HGR A;  1Q40 B;  2XEP A;  3STD A;  4J8T A;  3RGR A;  2STD A;  2YFJ B;  4MJD A;  3LXU X;  1O7P B;  2BNG A;  1NO3 A;  1QJG A;  3FLJ A;  5EQL A;  3EN1 B;  6STD A;  4MEI A;  1U5O A;  3BNE A;  2XSH B;  5JPU A;  2D1W A;  1GD3 A;  1TIJ A;  2HMJ B;  3NQY A;  4H3U A;  3S5C A;  1VZZ A;  3MHE A;  3NUV A;  5CLK A;  5IG0 A;  4HM1 B;  1A2K A;  3DY5 A;  1NWW A;  2OTL 3;  1PFP A;  1SII A;  3CC2 3;  4XDV A;  1RRH A;  1Z1S A;  2W0Q A;  1KD1 4;  4HJL B;  2W56 B;  4K90 B;  4FMC A;  3BND A;  2IA7 A;  1DMQ A;  4NHF A;  1YVB I;  1VQ7 3;  1IQY A;  3E99 A;  4O02 B;  4ZM8 A;  3V92 A;  3PZW A;  5A0O B;  3JUP A;  4XDW A;  3QRD A;  2OQE C;  3FZW A;  3SED A;  4EXR A;  5D83 A;  2K54 A;  4H61 A;  4FMB A;  1T5Y A;  1STF I;  3KSE D;  1NB3 I;  2GBW B;  1E97 A;  3M8C A;  4WHA A;  3EQQ B;  4HVN A;  1K41 A;  1M9G A;  2CKF B;  7STD A;  4HM3 B;  2QIY A;  5BVB A;  1IVV A;  3UNL A;  1FGQ A;  3DZL A;  4FCJ A;  1ULJ B;  2CH9 A;  4J9A A;  1K73 4;  4STD A;  3F8H A;  3WMD A;  1ROA A;  3ER7 A;  1YI2 3;  3B8L A;  2BO9 B;  1JKG B;  5DRE A;  2ZDJ A;  5IG3 A;  1VQ4 3;  1QAL A;  1K8A 4;  5ELU A;  3GZR A;  2HMK B;  3ALA A;  3K63 A;  3NQZ A;  3EF8 A;  4I4K A;  1TFO A;  2HMO B;  5TGN A;  1M1X B;  4KFE A;  2RCD A;  1GY7 A;  5FW5 A;  1O7M B;  2RGQ A;  3K9M C;  2WGQ A;  3I0Y A;  1M90 4;  4HBR A;  4HKV B;  3LT9 A;  4FCM A;  3B4P A;  4FR9 A;  1JRQ A;  3WDG B;  3U97 A;  4KZ1 A;  1N5H A;  3CPO A;  5IEP A;  2OOV C;  3CU3 A;  4HM2 B;  1UI8 A;  4R9L A;  3F9S A;  1WMP A;  1VQ9 3;  3AMO A;  2YFI B;  3V98 A;  2OWP A;  1IVX A;  3RGA A;  3PXM A;  4K1U A;  3HZP A;  1AVL A;  1VQ6 3;  3KSP A;  1K9M 4;  4IIA A;  1PU4 A;  5AIF A;  3LTA A;  1OPY A;  3PYJ A;  3Q1C A;  3CCU 3;  3KZT A;  3SOY A;  4N3V A;  2XH9 A;  2IUK A;  2F86 B;  3EBY A;  2F98 A;  4AKZ A;  1KQS 2;  1VQL 3;  1W02 A;  3V99 A;  1KWI A;  4WP5 A;  1QAF A;  4JF8 A;  2Y74 A;  1DMM A;  3NM2 A;  3BB9 A;  3T0U A;  2CWT A;  5AYS C;  1CYV A;  3CCQ 3;  1HKX A;  3H3H A;  3G8Z A;  1QVF 2;  4RBN A;  4BTW A;  1HU9 A;  4EV5 A;  5G2G A;  4R9K A;  2O9U X;  1TP6 A;  8CHO A;  2HML B;  4L8O A;  2B1X B;  1AR0 A;  1QAK A;  1M1K 4;  4MMZ B;  3T8U A;  1RKY A;  5IG4 A;  3HX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...