5D83A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y32(cl-y)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
125
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Delta(5)-3-ketosteroid isomerase
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 29
structure length 125
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d83A00
4HM2B 1BUQA 3SOYA 3ROBA 1OPYA 3JUPA 3MG3A 3EX9A 2Z76A 1S5AA 3KE7A 3EN1B 3RGAA 1O7PB 3JUOA 3FSDA 3EBTA 4LEHA 1DMNA 3UNLA 3CPOA 2BMOB 3STDA 4HM3B 4XM4A 2QIYA 4K1UA 5IF6A 3MSOA 3MHEA 3KKGA 4U13A 2PZVA 5D82A 1DMMA 1ZO2A 5AIFA 5HGRA 3E99A 3OWYA 4K1VA 2YFLB 4LMIA 1OHSA 3KSPA 4OUQA 5BXQA 2Z7AA 5IERA 4X2OA 1O7HB 4L8PA 4N3VA 1O7WB 3SEDA 3UJMA 3NUVA 3HZPA 2HMKB 4OVMA 2CHCA 3H51A 3CU3A 2YFIB 3MG1A 1HKXA 2GXFA 4KVHA 5IG5A 3RGRA 3DM8A 3DXOA 5KP3A 1ZX2A 2HMNB 4R9LA 3EF8A 4HM6B 4J9AA 1JB2A 1OH0A 4HM4B 1JN5A 4GB5A 1OGZA 5TGNA 5AI1A 1JB5A 1OGXA 2F98A 5AEUB 3FF2A 3NV0B 5STDA 1C7HA 3JUQA 3VGNA 1W00A 3VSYA 1NDOB 1O7NB 5CF1A 4R1KA 5AIGA 2HMOB 4WYKA 1Z1SA 5JPUA 3WMDA 3FKAA 3OXAA 5IEPA 3ER7A 3F7XA 1O7GB 1WQLB 1IDPA 1U5OA 5FW5A 5D81A 1GY5A 2INXA 1GYBA 3GZXB 1OCVA 3ECFA 1ASKA 1W02A 4HJLB 4L7KA 3DMCA 3JUNA 3MYTA 3CNMA 1K41A 5IG0A 2Z77A 4ORLA 3LZAA 1O7MB 2IMJA 3F7SA 4HM7B 3FZWA 1CQSA 3NBRA 3NXJA 1AR0A 5AIHA 3DZLA 3B7CA 4Q53A 1OF5B 3FGYA 4HM0B 8CHOA 3NHXA 1Q40B 5IENA 1UUVB 4H3UA 4R9KA 1OUNA 2OWPA 2A15A 4XB5A 1GY6A 5JPPA 5G2GA 3F9SA 5KP4A 5AEWB 1ULJB 2B1XB 2XSOB 3EHCA 3DUKA 3F8XA 3MG2A 1EA2A 2K54A 3BLZA 3GRDA 4MJDA 3T8NA 2CKFB 3G0KA 1GS3A 1ULIB 1A2KA 2HMMB 3A76A 1QJGA 3GZYB 1STDA 4I4KA 4WP5A 4HM5B 3KZTA 3NV0A 4XBYA 5IG3A 2HMJB 3OX9A 2I9WA 1JKGB 1OHOA 3GZRA 3GZBA 2XR8B 3IPTA 1W01A 5EVHA 5DRVA 2XSHB 3EQQB 3JUMA 4RZMA 2GEYA 2RFRA 5D83A 2GEXA 3EJVA 3NM2A 2STDA 5DREA 1NWWA 4LGQA 7STDA 3CNXA 2BNGA 4FCJA 3B4PA 4X2HA 1JB4A 3MKIA 2QGUA 1W6YA 2BMQB 3EC9A 2BMRB 3HX8A 3D9RA 4HM1B 1E3VA 6STDA 4HKVB 4XDWA 3FLJA 2R4IA 4PEJA 1SJWA 3B8LA 3FH1A 2UX0A 4IIAA 3Q90A 2W2CA 5BVBA 3GWRA 3LYGA 1OF5A 1E3RA 1Q42A 2F99A 3OV4A 1Q40A 3BB9A 4L8OA 4HZ9B 4CDLA 3K0ZA 4HM8B 3F8HA 1UUWB 2GBXB 1VZZA 4WWUC 2RCDA 5CK6A 4XBXA 4STDA 3FF0A 3F14A 4XDVA 1TP6A 1TUHA 1EG9B 3EN8A 4J8TA 3I0YA 1JN5B 3G8ZA 1ISKA 5IEOA 4HZBB 3OWUA 2B24B 1OHPA 3OWSA 5CF2A 2GBWB 5IG4A 1E97A 4FCMA 2XRXB 3B4OA 1JKGA 2F86B 2RGQA 5AIIA 3G16A 3M8CA 3T8UA 1NU3A 4WYKB 3K7CA 2HMLB 5CXOA 3SOAA 4HVNA 2JQ5A 4XBTA 1GY7A 3H3HA 1DMQA 3S5CA 1QMAA 3HK4A 5CLKA 3F40A 2YFJB 3EBYA 5KP1A
chains in the Genus database with same CATH superfamily
4HM2B 3X3ZA 5HOHA 1RGHA 1BUQA 1CYUA 1SPUA 2OOVC 1L5GB 3SOYA 3ROBA 3PYJA 1RGLA 1OPYA 3CCQ3 3JUPA 1AVLA 1B2XA 3MG3A 4MMZB 1TRQA 2ZL8A 3EX9A 2Z76A 1S5AA 3LTCA 3WODG 1YJW3 1RHLA 3KE7A 5M18A 1DE3A 2CH9A 3NX0A 4HYZA 4O8SA 3WA3A 2YX9A 3EN1B 3RGAA 1O7PB 3JUOA 1MGWA 4EV5A 7GSPA 2QEX3 3FSDA 1UCKA 3CCR3 3EBTA 1BNFA 4LEHA 1W6GA 1MWTA 2CWUA 1CH0A 1LQMB 2UUGC 3SVAA 3UL6A 4I5QA 3K9MC 1DMNA 3UNLA 2ZDJA 2KF3A 2Z6BA 1ROAA 2BMOB 1W5ZA 1BSDA 1T3BA 1RJOA 3CPOA 1TFOA 2CW9A 2QIYA 4HM3B 4XM4A 5G1KA 4RNZA 1BRKA 2ZHXB 1FZUA 1S723 4K1UA 5IF6A 3MSOA 2J8XB 3MHEA 1FUSA 1NJI4 3KKGA 3X3XA 1R4CA 3PCSA 4O02B 9RNTA 5G1LA 1M1K4 1OACA 4GHOA 4U13A 3S29A 3DGMA 2GU3A 4H61A 2PZVA 5D82A 1DMMA 1ZO2A 4ILFA 1BIRA 5AIFA 1RRLA 1BGSA 5HGRA 4R80A 3E99A 1BNEA 1YJN3 3OWYA 1GMRA 1X1XA 3SYUA 2W6JH 1JBSA 2IA7A 1BSEA 3DGYA 2L1SA 1RGEA 2YFLB 2AADA 4K1VA 3I553 4LMIA 4RNYA 1OHSA 3AGNA 3KSPA 4OUQA 3L0RA 3LTAA 1IK3A 1Q824 1NO3A 5BXQA 2WGQA 1GOYA 4EW5A 2Z7AA 1QVG2 2C10A 5IERA 1RN7A 1I0XA 1LOVA 2H0GA 3AHWA 4X2OA 3S67A 2CX0A 1IU7A 2XFSA 4EC6A 4WFOA 1RNBA 2F5MA 1O7HB 1A2VA 2XGNA 5RNTA 4L8PA 1RGFA 4N3VA 5I97A 1O7WB 3SEDA 1HYFA 3UJMA 5EEOA 3NUVA 3BU4A 3BIRA 3HZPA 1RGGA 2HMKB 4OVMA 2CHCA 4HOHA 3H51A 1KD14 1BRGA 3CU3A 1RTUA 3K5TA 2YFIB 1J2BA 1NB5I 1RN4A 1LQGC 4GSPA 3FCSB 2FXTA 3MG1A 1HKXA 3QK9A 3O8YA 2GXFA 2GU1A 4KVHA 1A67A 2JDIH 3V92A 3NM7A 3S28A 2OQEA 5IG5A 3RGRA 3DM8A 2KF5A 4HBRA 1BU4A 2E2UA 1I2GA 1T2HA 2P0XA 3D4AA 3FG1A 3NQYA 3CC73 1FGRA 3DGNA 3MPHA 3DXOA 1TRPA 3N54B 2CWTA 2KRTA 3LOYA 3NQZA 4CCVA 2W9QA 5KP3A 2OQEC 1ZX2A 2HMNB 4R9LA 1VQ43 3A5EA 3EF8A 4HM6B 4J9AA 1JB2A 1G02A 5FGOA 1BANA 1OH0A 4HM4B 1JN5A 1SARA 4GB5A 1BRIA 1VQ73 1PY3A 2IYJA 1YI23 1OGZA 1I2EA 1LNIA 1GMPA 5AI1A 3D79A 1RGKA 5ELJA 5TGNA 5BIRA 2LYXA 1I70A 1RN1A 4O2HA 3URPA 4IT7A 3BNCA 3SX1A 5AYSC 2CFLA 1JB5A 1FUTA 1PFPA 1OGXA 3CPW2 1N9JA 1IVXA 2F98A 3AGOA 4G1MB 5AEUB 4N6MA 3FF2A 3T0UA 2E2VA 3NV0B 3CC23 5STDA 1C7HA 3N9HA 5BU4A 3CCS3 3CCJ3 3JUQA 3VGNA 1W00A 3VSYA 3ZG5A 3I563 1NDOB 1SIHA 1O7NB 4HAAA 5CF1A 3LT8A 4J5GA 4KZ1A 1BOXA 2BU4A 4R1KA 1LOWA 3LXUX 5AIGA 1MWUA 2HMOB 2WOFA 1N5PA 2BO9B 4WYKA 2CWVA 1FGMA 1Z1SA 2WO0A 2WOHA 1TFKA 1K9M4 5JPUA 1VQO3 3WMDA 3KCHA 3FKAA 1UW1A 1GD4A 1FGOA 3OXAA 3CME3 5ELUA 4FMAA 3WDGB 5IEPA 3CCU3 1UGHI 1MGRA 3ER7A 5M1AA 2CIUA 3X41A 1B2UA 4N6OB 3IJEB 3F7XA 1YNVX 4JRFA 1O7GB 3EB8A 1WQLB 2K0MA 1FW7A 1IDPA 1U5OA 3CCM3 3TDGA 1Q9EA 3NBBA 3U97A 1D6UA 1V57A 5FW5A 5D81A 2L4VA 1GY5A 2INXA 1GYBA 1RCLA 3GZXB 4AEQA 5EQLA 1OCVA 5LC7A 3ECFA 1ASKA 1W02A 2P05A 2R41A 4HJLB 1IT7A 1KWIA 2P09A 2UGIA 4N6V0 4L7KA 1F8NA 3D5IA 3DMCA 3JUNA 4EYCA 2ZA4A 3MYTA 3D5GA 2ML5A 4MMYB 2MF7A 4BU4A 3CNMA 1HZ1A 1IQYA 2KF6A 1K41A 5IG0A 2Z77A 2BHMA 2AAEA 1YVSA 4ORLA 3LZAA 1AY7A 3N8BA 3LTBA 1BSAA 1JZDA 6GSPA 1I0VA 2CFWA 4NHFA 2C11A 1O7MB 1B2SA 2IMJA 3IMAB 1FA3A 2O9UX 1U8CB 2CC3A 1CEWI 3F7SA 4HM7B 3J7Yd 7RNTA 1LNHA 4CPKA 1TJDA 3FZWA 1RKYA 1CQSA 1N9EA 1WTHA 1B27A 3NBRA 3BNDA 3NXJA 1AR0A 4NPBA 3RDEA 5AIHA 1YVBI 1BNIA 1N8QA 1VQM3 2RBIA 2W9PA 1C54A 3DZLA 3B7CA 3GAXA 3BNEA 3HIGA 4Q53A 1VQ53 2CK3H 3JVCA 1IQ8A 1OF5B 1UDII 3FGYA 1BNSA 1MNLA 4HM0B 8CHOA 3NHXA 2P38A 1Q40B 1IV9A 2HOHA 5IENA 3V99A 1UUVB 3AMOB 1RMSA 4FR9A 1ZS7A 1RCKA 1GOVA 4H3UA 4KT3B 1YJ93 4QWTA 1RGAA 1YIJ3 4R9KA 2OTL3 1BRHA 1OUNA 1VQK3 2ML6A 4EBGA 2OWPA 2KCDA 3WA2X 8RNTA 1YHQ3 2H0HA 4EV2A 1BNGA 1MWSA 2A15A 1X1WA 1DETA 4IPBA 4LZIA 2V1LA 4N6LA 4XB5A 1BVIA 1GY6A 2XFTA 1LVNA 5JPPA 5G2GA 3F9SA 5KP4A 1B2MA 5AEWB 1ULJB 2B1XB 1Y4KA 2XSOB 1NNVA 1BRSA 3EHCA 3DUKA 3F8XA 3MG2A 1T2IA 1EA2A 2K54A 3BLZA 3FG3A 3GRDA 1I3FA 3X40A 3KFQC 1W2B2 1KC84 2W56B 3SLUA 3OW22 3CC43 3LT9A 4MJDA 3T8NA 2CKFB 2RNTA 4N6UA 1A2PA 3G0KA 1GS3A 4BTWA 1PU4A 3CCE3 1EEJA 1ULIB 1JBTA 5GSPA 4TX4A 1WMOA 1QVF2 1G96A 1LRAA 1M904 1A2KA 2HMMB 4BIRA 2Q07A 3V98A 3A76A 1VQP3 1BAOA 4GL6A 3CMA3 1BSCA 3DGOA 1QJGA 1SIIA 3GZYB 3Q1CA 1K734 1STDA 3BNBA 4I4KA 3ZFZA 1BRNL 4WP5A 4HM5B 5JBSA 3KZTA 3NV0A 4XBYA 1N8R4 1UGIA 3Q3FA 4BL3A 5IG3A 2HMJB 3OX9A 4EXRA 2FGTA 2I9WA 2W0QA 1JKGB 1B3SA 1OHOA 3AHSA 3GZRA 3GZBA 3CXC2 2XR8B 3LTDA 2IUKA 3IPTA 3D3LA 4LYLB 4AKZA 1W01A 1MWRA 1YGWA 3DH2A 1JV2B 1NB3I 3UL5A 2XH9A 4FMDA 4K90B 5DRVA 5EVHA 2XSHB 1RGCA 3EQQB 3JUMA 3LH4A 3PS8A 1IYYA 4RZMA 2GEYA 1B2ZA 1X1UA 2RFRA 1I3IA 1IVUA 1RSNA 4FMCA 2LQVA 5D83A 3WOEB 1RNTA 2GEXA 3K63A 1FYSA 3LMLA 2D42A 2Y73A 3X3YA 2CFKA 1IVVA 3EJVA 1YGEA 3NM2A 2STDA 1AV4A 4OK0A 1SQWA 3CCL3 4KFFA 5DREA 3WOFB 1VQ93 1Q814 3UB1A 3FG4A 3EE1A 2P0MA 4K61A 2MC8A 1NWWA 4LGQA 1FUWA 7STDA 1D6YA 2CFGA 3HI7A 3CNXA 1EKMA 2O3OA 1MOLA 2BNGA 4NREA 3KN4A 2CX1A 4FCJA 3CCV3 4MMXB 1TU5A 1A90A 3VF1A 1G0TA 3MWZA 4R4KA 3B4PA 4FCZA 1RDSA 4X2HA 1IV7A 1JB4A 3MKIA 2QGUA 1WMNA 1W6YA 2BMQB 3EC9A 2QA43 1Q7Y4 2BMRB 1W2ZA 3HX8A 1T5YA 3D9RA 2F5WA 1W7CA 3DGLA 4HM1B 1B21A 2XEPA 1E3VA 6STDA 2IUJA 2E2TA 1US1A 3PZWA 1ZGXA 1KQS2 4FMBA 4HKVB 3ZG0A 4XDWA 2F4YA 4O3VA 3FLJA 2R4IA 4PEJA 4RNTA 3S27A 5M19A 1TTOA 3PGBA 1JRQA 1UCLA 4BTYA 1VQ63 2PNCA 1SJWA 3B8LA 3FH1A 1IQXA 2UX0A 2RSXA 4IIAA 3Q90A 3U1WA 2W2CA 5BVBA 1JJ22 1DVCA 3GWRA 2CFDA 2H0IA 4J5KA 1EQKA 1V58A 1LXEA 3HIIA 1WNHA 1AVKA 2W04A 4RBNA 1CYVA 1EUIC 2KXGA 3LYGA 3WHOA 1OF5A 1E3RA 1Q42A 1GOUA 2F99A 5LC6A 1N5HA 1I2FA 1Q7HA 1BUJA 3OV4A 1Q40A 1UUGB 1JBRA 4AKYA 3BB9A 4L8OA 2OTJ3 4HZ9B 1IT8A 3GSPA 3AMOA 1DYUA 1YIT3 1DVDA 4ZM8A 4CDLA 1M9GA 3K0ZA 1BSBA 3KSED 3F8HA 4HM8B 4CJNA 4DKIA 4WHAA 3PCRA 4KFDA 2FNQA 1QAKA 1UUWB 2KAAA 4MEIA 2GBXB 4BL2A 1FGQA 1W6CA 1R4YA 2BIRA 1VZZA 2CG0A 3QRDA 4WWUC 1ROVA 2RCDA 2XF3A 5CK6A 1VQL3 4XBXA 2IY2A 4JF8A 1K8A4 4N6NB 2W03A 3ALAA 5A0OB 2OCTA 3FF0A 4STDA 3RNTA 3F14A 2XGLA 1BNRA 1LOYA 4XDVA 1I8VA 3KIIA 1VQN3 1PYLA 1GMQA 1TP6A 2W56A 1TUHA 1BNJA 1EG9B 3EN8A 2GSPA 1HU9A 4J8TA 3X42A 1X1YA 2K3DA 2M7OA 1JN5B 1K28A 3G8ZA 3I0YA 3G6E3 1ISKA 5IEOA 4HZBB 1D6ZA 3OWUA 2WGOA 2B24B 1W4NA 1OHPA 3OWSA 3WR2A 1BRJA 5CF2A 6RNTA 3NBJA 1V74A 1VQ83 1STFI 2F56A 4BTXA 3CD63 1QALA 2GBWB 1KSIA 1IVWA 1AQZA 5IG4A 1UI8A 1E97A 4LSOA 4FCMA 2SARA 3Q2PA 2KF4A 1LOXA 2XRXB 3DY5A 3HOHA 3B4OA 2CG1A 2D1WA 1UCIA 1JKGA 1B20A 2F86B 2RGQA 3SXXA 1GSPA 1FGTA 5AIIA 1TIJA 2BT3A 3G16A 3PXMA 2C4BA 1UI7A 3M8CA 1JZOA 1NU3A 1M1XB 4WYKB 3T8UA 3K7CA 1UCJA 2HMLB 3G713 5CXOA 1GD3A 1RLSA 2Y74A 3SOAA 1WMPA 5IW9A 3G4S3 4HVNA 1RRHA 2OOVA 2JQ5A 1JNQA 1GY7A 1VQQA 3H3HA 4XBTA 4KFEA 1DMQA 5AYRB 4N6TA 3S5CA 1QMAA 1QAFA 3HK4A 1Q864 2SBLA 5CLKA 3F40A 2YFJB 3EBYA 5KP1A 3STDA
chains in the Genus database with same CATH topology
4HM2B 3X3ZA 1BUQA 1CYUA 1SPUA 2OOVC 1L5GB 3SOYA 3ROBA 3PYJA 3CCQ3 1OPYA 3JUPA 1AVLA 3MG3A 4MMZB 2ZL8A 3EX9A 2Z76A 1S5AA 3LTCA 3WODG 1YJW3 3KE7A 2CH9A 3NX0A 4HYZA 4O8SA 3WA3A 2YX9A 3EN1B 3RGAA 1O7PB 3JUOA 4EV5A 2QEX3 3CCR3 3FSDA 3EBTA 4LEHA 1W6GA 2CWUA 3UL6A 3SVAA 3K9MC 1DMNA 3UNLA 2ZDJA 2Z6BA 1ROAA 2BMOB 1W5ZA 3CPOA 3STDA 1RJOA 4HM3B 1TFOA 2CW9A 2QIYA 4XM4A 4RNZA 1S723 4K1UA 5IF6A 3MSOA 3MHEA 1NJI4 3KKGA 3X3XA 1R4CA 3PCSA 4O02B 1M1K4 1OACA 4U13A 3S29A 3DGMA 2GU3A 4H61A 2PZVA 5D82A 1DMMA 1ZO2A 5AIFA 1RRLA 5HGRA 4R80A 3E99A 1YJN3 3OWYA 2W6JH 2IA7A 4K1VA 3I553 2YFLB 4LMIA 4RNYA 1OHSA 3KSPA 4OUQA 3L0RA 3LTAA 1IK3A 1Q824 1NO3A 5BXQA 2WGQA 2Z7AA 1QVG2 2C10A 5IERA 1RN7A 4X2OA 3S67A 2XFSA 1IU7A 4EC6A 4WFOA 1O7HB 1A2VA 2XGNA 4L8PA 5I97A 4N3VA 1O7WB 3SEDA 3UJMA 5EEOA 3NUVA 3HZPA 2HMKB 4OVMA 2CHCA 3H51A 1KD14 3CU3A 3K5TA 2YFIB 1J2BA 1NB5I 3FCSB 2FXTA 3MG1A 1HKXA 3QK9A 3O8YA 2GXFA 2GU1A 4KVHA 1A67A 2JDIH 3V92A 3NM7A 3S28A 2OQEA 5IG5A 3RGRA 3DM8A 4HBRA 2E2UA 2P0XA 3NQYA 3FG1A 3CC73 1FGRA 3DGNA 3MPHA 3DXOA 3N54B 2CWTA 2KRTA 3LOYA 3NQZA 4CCVA 2W9QA 5KP3A 2OQEC 1ZX2A 2HMNB 4R9LA 1VQ43 3EF8A 4HM6B 4J9AA 1JB2A 5FGOA 1OH0A 4HM4B 1JN5A 4GB5A 1VQ73 1YI23 1OGZA 5ELJA 5TGNA 5AI1A 1YHQ3 2LYXA 4O2HA 1K734 4IT7A 3BNCA 3SX1A 5AYSC 2CFLA 1JB5A 1PFPA 1OGXA 3CPW2 1N9JA 1IVXA 2F98A 4G1MB 5AEUB 4N6MA 3FF2A 3T0UA 2E2VA 3NV0B 3CC23 5STDA 1C7HA 3N9HA 3CCS3 3CCJ3 3JUQA 3VGNA 1W00A 3VSYA 3I563 1NDOB 1SIHA 1O7NB 5CF1A 3LT8A 4KZ1A 4R1KA 5AIGA 3LXUX 2HMOB 2WOFA 1N5PA 2BO9B 4WYKA 2CWVA 1FGMA 1Z1SA 2WO0A 2WOHA 1TFKA 1K9M4 5JPUA 1VQO3 3WMDA 3FKAA 1UW1A 1GD4A 1FGOA 3OXAA 3CME3 5ELUA 4FMAA 3WDGB 5IEPA 3CCU3 3ER7A 2CIUA 3X41A 4N6OB 3IJEB 3F7XA 4JRFA 1O7GB 3EB8A 1WQLB 2K0MA 1IDPA 1U5OA 3CCM3 3TDGA 3NBBA 3U97A 1D6UA 5FW5A 5D81A 2L4VA 1GY5A 2INXA 1GYBA 3GZXB 4AEQA 5EQLA 1OCVA 5LC7A 3ECFA 1ASKA 1W02A 2P05A 4HJLB 1IT7A 1KWIA 2P09A 4N6V0 4L7KA 1F8NA 3DMCA 3JUNA 4EYCA 3MYTA 4MMYB 2ML5A 2MF7A 3CNMA 1IQYA 1K41A 5IG0A 2Z77A 2BHMA 4ORLA 3LZAA 3N8BA 3LTBA 4NHFA 2CFWA 1FA3A 2C11A 1O7MB 2IMJA 3IMAB 2O9UX 1U8CB 2CC3A 1CEWI 3F7SA 4HM7B 3J7Yd 1LNHA 3FZWA 1RKYA 1CQSA 1N9EA 1WTHA 3NBRA 3BNDA 3NXJA 1AR0A 3RDEA 5AIHA 1YVBI 1N8QA 1VQM3 2W9PA 3DZLA 3B7CA 3GAXA 3BNEA 3HIGA 4Q53A 1VQ53 2CK3H 3JVCA 1IQ8A 1OF5B 3FGYA 1MNLA 4HM0B 8CHOA 3NHXA 2P38A 1Q40B 1IV9A 5IENA 3V99A 1UUVB 3AMOB 4FR9A 4H3UA 1YJ93 4QWTA 1YIJ3 4R9KA 2OTL3 1OUNA 1VQK3 2ML6A 4EBGA 2OWPA 2KCDA 3WA2X 4EV2A 2A15A 4IPBA 4LZIA 2V1LA 4N6LA 4XB5A 1GY6A 2XFTA 1LVNA 5JPPA 5G2GA 3F9SA 5KP4A 5AEWB 1ULJB 2B1XB 1Y4KA 2XSOB 3EHCA 3DUKA 3F8XA 3MG2A 1EA2A 2K54A 3BLZA 3FG3A 3GRDA 3X40A 3KFQC 1W2B2 1KC84 2W56B 3SLUA 3OW22 3CC43 3LT9A 4MJDA 3T8NA 2CKFB 4N6UA 3G0KA 1GS3A 4BTWA 1PU4A 3CCE3 1ULIB 4TX4A 1WMOA 1QVF2 1G96A 1M904 1A2KA 2HMMB 2Q07A 3V98A 3A76A 1VQP3 3CMA3 4GL6A 3DGOA 3Q1CA 1QJGA 1SIIA 3GZYB 1STDA 3BNBA 4I4KA 4WP5A 4HM5B 5JBSA 3KZTA 3NV0A 4XBYA 1N8R4 5IG3A 2HMJB 3OX9A 4EXRA 2FGTA 2I9WA 2W0QA 1JKGB 1OHOA 3GZRA 3GZBA 3CXC2 2XR8B 3LTDA 2IUKA 3IPTA 3D3LA 4AKZA 1W01A 1JV2B 1NB3I 3UL5A 2XH9A 4FMDA 4K90B 5DRVA 5EVHA 2XSHB 3EQQB 3JUMA 3LH4A 3PS8A 4RZMA 2GEYA 2RFRA 1IVUA 4FMCA 2LQVA 5D83A 3WOEB 2GEXA 3K63A 3LMLA 2D42A 2Y73A 3X3YA 2CFKA 1IVVA 3EJVA 1YGEA 3NM2A 2STDA 1AV4A 4OK0A 1SQWA 3CCL3 4KFFA 5DREA 3WOFB 1VQ93 1Q814 3UB1A 3FG4A 3EE1A 2P0MA 4K61A 2MC8A 1NWWA 4LGQA 1FUWA 7STDA 1D6YA 2CFGA 3HI7A 3CNXA 1EKMA 2O3OA 1MOLA 2BNGA 4NREA 3KN4A 4FCJA 3CCV3 4MMXB 1TU5A 1A90A 3VF1A 3MWZA 4R4KA 3B4PA 4FCZA 4X2HA 1IV7A 1JB4A 3MKIA 2QGUA 1WMNA 1W6YA 2BMQB 3EC9A 2QA43 1Q7Y4 2BMRB 1W2ZA 3HX8A 1T5YA 3D9RA 1W7CA 3DGLA 4HM1B 2XEPA 1E3VA 6STDA 2IUJA 2E2TA 1US1A 3PZWA 1KQS2 4FMBA 4HKVB 4XDWA 4O3VA 3FLJA 2R4IA 4PEJA 3S27A 3PGBA 1JRQA 4BTYA 1VQ63 2PNCA 1SJWA 3B8LA 3FH1A 1IQXA 2UX0A 2RSXA 4IIAA 3Q90A 3U1WA 2W2CA 5BVBA 1JJ22 1DVCA 3GWRA 2CFDA 1EQKA 1LXEA 3HIIA 1WNHA 1AVKA 2W04A 4RBNA 1CYVA 2KXGA 3LYGA 1OF5A 1E3RA 1Q42A 2F99A 5LC6A 1N5HA 3OV4A 1Q40A 2OTJ3 4AKYA 3BB9A 4L8OA 4HZ9B 1IT8A 3AMOA 1DYUA 1YIT3 1DVDA 4ZM8A 4CDLA 1M9GA 3K0ZA 3KSED 3F8HA 4HM8B 4WHAA 3PCRA 4KFDA 2FNQA 1QAKA 1UUWB 4MEIA 2GBXB 1FGQA 1W6CA 1VZZA 2CG0A 3QRDA 4WWUC 2XF3A 1ROVA 2RCDA 5CK6A 1VQL3 4XBXA 4JF8A 1K8A4 4N6NB 2W03A 3ALAA 5A0OB 2OCTA 3FF0A 4STDA 3F14A 2XGLA 4XDVA 3KIIA 1VQN3 1TP6A 2W56A 1TUHA 1EG9B 3EN8A 1HU9A 4J8TA 3X42A 2M7OA 3I0YA 1JN5B 1K28A 3G8ZA 3G6E3 1ISKA 5IEOA 4HZBB 1D6ZA 3OWUA 2WGOA 2B24B 1W4NA 1OHPA 3OWSA 5CF2A 3NBJA 1V74A 1VQ83 1STFI 4BTXA 3CD63 1QALA 2GBWB 1KSIA 1IVWA 5IG4A 1UI8A 1E97A 4LSOA 4FCMA 3Q2PA 2XRXB 1LOXA 3DY5A 2CG1A 3B4OA 2D1WA 1JKGA 2F86B 2RGQA 3SXXA 1FGTA 5AIIA 1TIJA 2BT3A 3G16A 3PXMA 3M8CA 1UI7A 3T8UA 1NU3A 1M1XB 4WYKB 3K7CA 2HMLB 3G713 5CXOA 1GD3A 2Y74A 3SOAA 1WMPA 5IW9A 3G4S3 4HVNA 1RRHA 2OOVA 2JQ5A 1JNQA 1GY7A 3H3HA 4XBTA 4KFEA 1DMQA 5AYRB 4N6TA 3S5CA 1QMAA 1QAFA 3HK4A 1Q864 2SBLA 5CLKA 3F40A 2YFJB 3EBYA 5KP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM2 B;  1BUQ A;  3SOY A;  3ROB A;  1OPY A;  3JUP A;  3MG3 A;  3EX9 A;  2Z76 A;  1S5A A;  3KE7 A;  3EN1 B;  3RGA A;  1O7P B;  3JUO A;  3FSD A;  3EBT A;  4LEH A;  1DMN A;  3UNL A;  3CPO A;  2BMO B;  3STD A;  4HM3 B;  4XM4 A;  2QIY A;  4K1U A;  5IF6 A;  3MSO A;  3MHE A;  3KKG A;  4U13 A;  2PZV A;  5D82 A;  1DMM A;  1ZO2 A;  5AIF A;  5HGR A;  3E99 A;  3OWY A;  4K1V A;  2YFL B;  4LMI A;  1OHS A;  3KSP A;  4OUQ A;  5BXQ A;  2Z7A A;  5IER A;  4X2O A;  1O7H B;  4L8P A;  4N3V A;  1O7W B;  3SED A;  3UJM A;  3NUV A;  3HZP A;  2HMK B;  4OVM A;  2CHC A;  3H51 A;  3CU3 A;  2YFI B;  3MG1 A;  1HKX A;  2GXF A;  4KVH A;  5IG5 A;  3RGR A;  3DM8 A;  3DXO A;  5KP3 A;  1ZX2 A;  2HMN B;  4R9L A;  3EF8 A;  4HM6 B;  4J9A A;  1JB2 A;  1OH0 A;  4HM4 B;  1JN5 A;  4GB5 A;  1OGZ A;  5TGN A;  5AI1 A;  1JB5 A;  1OGX A;  2F98 A;  5AEU B;  3FF2 A;  3NV0 B;  5STD A;  1C7H A;  3JUQ A;  3VGN A;  1W00 A;  3VSY A;  1NDO B;  1O7N B;  5CF1 A;  4R1K A;  5AIG A;  2HMO B;  4WYK A;  1Z1S A;  5JPU A;  3WMD A;  3FKA A;  3OXA A;  5IEP A;  3ER7 A;  3F7X A;  1O7G B;  1WQL B;  1IDP A;  1U5O A;  5FW5 A;  5D81 A;  1GY5 A;  2INX A;  1GYB A;  3GZX B;  1OCV A;  3ECF A;  1ASK A;  1W02 A;  4HJL B;  4L7K A;  3DMC A;  3JUN A;  3MYT A;  3CNM A;  1K41 A;  5IG0 A;  2Z77 A;  4ORL A;  3LZA A;  1O7M B;  2IMJ A;  3F7S A;  4HM7 B;  3FZW A;  1CQS A;  3NBR A;  3NXJ A;  1AR0 A;  5AIH A;  3DZL A;  3B7C A;  4Q53 A;  1OF5 B;  3FGY A;  4HM0 B;  8CHO A;  3NHX A;  1Q40 B;  5IEN A;  1UUV B;  4H3U A;  4R9K A;  1OUN A;  2OWP A;  2A15 A;  4XB5 A;  1GY6 A;  5JPP A;  5G2G A;  3F9S A;  5KP4 A;  5AEW B;  1ULJ B;  2B1X B;  2XSO B;  3EHC A;  3DUK A;  3F8X A;  3MG2 A;  1EA2 A;  2K54 A;  3BLZ A;  3GRD A;  4MJD A;  3T8N A;  2CKF B;  3G0K A;  1GS3 A;  1ULI B;  1A2K A;  2HMM B;  3A76 A;  1QJG A;  3GZY B;  1STD A;  4I4K A;  4WP5 A;  4HM5 B;  3KZT A;  3NV0 A;  4XBY A;  5IG3 A;  2HMJ B;  3OX9 A;  2I9W A;  1JKG B;  1OHO A;  3GZR A;  3GZB A;  2XR8 B;  3IPT A;  1W01 A;  5EVH A;  5DRV A;  2XSH B;  3EQQ B;  3JUM A;  4RZM A;  2GEY A;  2RFR A;  5D83 A;  2GEX A;  3EJV A;  3NM2 A;  2STD A;  5DRE A;  1NWW A;  4LGQ A;  7STD A;  3CNX A;  2BNG A;  4FCJ A;  3B4P A;  4X2H A;  1JB4 A;  3MKI A;  2QGU A;  1W6Y A;  2BMQ B;  3EC9 A;  2BMR B;  3HX8 A;  3D9R A;  4HM1 B;  1E3V A;  6STD A;  4HKV B;  4XDW A;  3FLJ A;  2R4I A;  4PEJ A;  1SJW A;  3B8L A;  3FH1 A;  2UX0 A;  4IIA A;  3Q90 A;  2W2C A;  5BVB A;  3GWR A;  3LYG A;  1OF5 A;  1E3R A;  1Q42 A;  2F99 A;  3OV4 A;  1Q40 A;  3BB9 A;  4L8O A;  4HZ9 B;  4CDL A;  3K0Z A;  4HM8 B;  3F8H A;  1UUW B;  2GBX B;  1VZZ A;  4WWU C;  2RCD A;  5CK6 A;  4XBX A;  4STD A;  3FF0 A;  3F14 A;  4XDV A;  1TP6 A;  1TUH A;  1EG9 B;  3EN8 A;  4J8T A;  3I0Y A;  1JN5 B;  3G8Z A;  1ISK A;  5IEO A;  4HZB B;  3OWU A;  2B24 B;  1OHP A;  3OWS A;  5CF2 A;  2GBW B;  5IG4 A;  1E97 A;  4FCM A;  2XRX B;  3B4O A;  1JKG A;  2F86 B;  2RGQ A;  5AII A;  3G16 A;  3M8C A;  3T8U A;  1NU3 A;  4WYK B;  3K7C A;  2HML B;  5CXO A;  3SOA A;  4HVN A;  2JQ5 A;  4XBT A;  1GY7 A;  3H3H A;  1DMQ A;  3S5C A;  1QMA A;  3HK4 A;  5CLK A;  3F40 A;  2YFJ B;  3EBY A;  5KP1 A; 
#chains in the Genus database with same CATH topology
 4HM2 B;  3X3Z A;  5HOH A;  1RGH A;  1BUQ A;  1CYU A;  1SPU A;  2OOV C;  1L5G B;  3SOY A;  3ROB A;  3PYJ A;  1RGL A;  1OPY A;  3CCQ 3;  3JUP A;  1AVL A;  1B2X A;  3MG3 A;  4MMZ B;  1TRQ A;  2ZL8 A;  3EX9 A;  2Z76 A;  1S5A A;  3LTC A;  3WOD G;  1YJW 3;  1RHL A;  3KE7 A;  5M18 A;  1DE3 A;  2CH9 A;  3NX0 A;  4HYZ A;  4O8S A;  3WA3 A;  2YX9 A;  3EN1 B;  3RGA A;  1O7P B;  3JUO A;  1MGW A;  4EV5 A;  7GSP A;  2QEX 3;  3FSD A;  1UCK A;  3CCR 3;  3EBT A;  1BNF A;  4LEH A;  1W6G A;  1MWT A;  2CWU A;  1CH0 A;  1LQM B;  2UUG C;  3SVA A;  3UL6 A;  4I5Q A;  3K9M C;  1DMN A;  3UNL A;  2ZDJ A;  2KF3 A;  2Z6B A;  1ROA A;  2BMO B;  1W5Z A;  1BSD A;  1T3B A;  1RJO A;  3CPO A;  1TFO A;  2CW9 A;  2QIY A;  4HM3 B;  4XM4 A;  5G1K A;  4RNZ A;  1BRK A;  2ZHX B;  1FZU A;  1S72 3;  4K1U A;  5IF6 A;  3MSO A;  2J8X B;  3MHE A;  1FUS A;  1NJI 4;  3KKG A;  3X3X A;  1R4C A;  3PCS A;  4O02 B;  9RNT A;  5G1L A;  1M1K 4;  1OAC A;  4GHO A;  4U13 A;  3S29 A;  3DGM A;  2GU3 A;  4H61 A;  2PZV A;  5D82 A;  1DMM A;  1ZO2 A;  4ILF A;  1BIR A;  5AIF A;  1RRL A;  1BGS A;  5HGR A;  4R80 A;  3E99 A;  1BNE A;  1YJN 3;  3OWY A;  1GMR A;  1X1X A;  3SYU A;  2W6J H;  1JBS A;  2IA7 A;  1BSE A;  3DGY A;  2L1S A;  1RGE A;  2YFL B;  2AAD A;  4K1V A;  3I55 3;  4LMI A;  4RNY A;  1OHS A;  3AGN A;  3KSP A;  4OUQ A;  3L0R A;  3LTA A;  1IK3 A;  1Q82 4;  1NO3 A;  5BXQ A;  2WGQ A;  1GOY A;  4EW5 A;  2Z7A A;  1QVG 2;  2C10 A;  5IER A;  1RN7 A;  1I0X A;  1LOV A;  2H0G A;  3AHW A;  4X2O A;  3S67 A;  2CX0 A;  1IU7 A;  2XFS A;  4EC6 A;  4WFO A;  1RNB A;  2F5M A;  1O7H B;  1A2V A;  2XGN A;  5RNT A;  4L8P A;  1RGF A;  4N3V A;  5I97 A;  1O7W B;  3SED A;  1HYF A;  3UJM A;  5EEO A;  3NUV A;  3BU4 A;  3BIR A;  3HZP A;  1RGG A;  2HMK B;  4OVM A;  2CHC A;  4HOH A;  3H51 A;  1KD1 4;  1BRG A;  3CU3 A;  1RTU A;  3K5T A;  2YFI B;  1J2B A;  1NB5 I;  1RN4 A;  1LQG C;  4GSP A;  3FCS B;  2FXT A;  3MG1 A;  1HKX A;  3QK9 A;  3O8Y A;  2GXF A;  2GU1 A;  4KVH A;  1A67 A;  2JDI H;  3V92 A;  3NM7 A;  3S28 A;  2OQE A;  5IG5 A;  3RGR A;  3DM8 A;  2KF5 A;  4HBR A;  1BU4 A;  2E2U A;  1I2G A;  1T2H A;  2P0X A;  3D4A A;  3FG1 A;  3NQY A;  3CC7 3;  1FGR A;  3DGN A;  3MPH A;  3DXO A;  1TRP A;  3N54 B;  2CWT A;  2KRT A;  3LOY A;  3NQZ A;  4CCV A;  2W9Q A;  5KP3 A;  2OQE C;  1ZX2 A;  2HMN B;  4R9L A;  1VQ4 3;  3A5E A;  3EF8 A;  4HM6 B;  4J9A A;  1JB2 A;  1G02 A;  5FGO A;  1BAN A;  1OH0 A;  4HM4 B;  1JN5 A;  1SAR A;  4GB5 A;  1BRI A;  1VQ7 3;  1PY3 A;  2IYJ A;  1YI2 3;  1OGZ A;  1I2E A;  1LNI A;  1GMP A;  5AI1 A;  3D79 A;  1RGK A;  5ELJ A;  5TGN A;  5BIR A;  2LYX A;  1I70 A;  1RN1 A;  4O2H A;  3URP A;  4IT7 A;  3BNC A;  3SX1 A;  5AYS C;  2CFL A;  1JB5 A;  1FUT A;  1PFP A;  1OGX A;  3CPW 2;  1N9J A;  1IVX A;  2F98 A;  3AGO A;  4G1M B;  5AEU B;  4N6M A;  3FF2 A;  3T0U A;  2E2V A;  3NV0 B;  3CC2 3;  5STD A;  1C7H A;  3N9H A;  5BU4 A;  3CCS 3;  3CCJ 3;  3JUQ A;  3VGN A;  1W00 A;  3VSY A;  3ZG5 A;  3I56 3;  1NDO B;  1SIH A;  1O7N B;  4HAA A;  5CF1 A;  3LT8 A;  4J5G A;  4KZ1 A;  1BOX A;  2BU4 A;  4R1K A;  1LOW A;  3LXU X;  5AIG A;  1MWU A;  2HMO B;  2WOF A;  1N5P A;  2BO9 B;  4WYK A;  2CWV A;  1FGM A;  1Z1S A;  2WO0 A;  2WOH A;  1TFK A;  1K9M 4;  5JPU A;  1VQO 3;  3WMD A;  3KCH A;  3FKA A;  1UW1 A;  1GD4 A;  1FGO A;  3OXA A;  3CME 3;  5ELU A;  4FMA A;  3WDG B;  5IEP A;  3CCU 3;  1UGH I;  1MGR A;  3ER7 A;  5M1A A;  2CIU A;  3X41 A;  1B2U A;  4N6O B;  3IJE B;  3F7X A;  1YNV X;  4JRF A;  1O7G B;  3EB8 A;  1WQL B;  2K0M A;  1FW7 A;  1IDP A;  1U5O A;  3CCM 3;  3TDG A;  1Q9E A;  3NBB A;  3U97 A;  1D6U A;  1V57 A;  5FW5 A;  5D81 A;  2L4V A;  1GY5 A;  2INX A;  1GYB A;  1RCL A;  3GZX B;  4AEQ A;  5EQL A;  1OCV A;  5LC7 A;  3ECF A;  1ASK A;  1W02 A;  2P05 A;  2R41 A;  4HJL B;  1IT7 A;  1KWI A;  2P09 A;  2UGI A;  4N6V 0;  4L7K A;  1F8N A;  3D5I A;  3DMC A;  3JUN A;  4EYC A;  2ZA4 A;  3MYT A;  3D5G A;  2ML5 A;  4MMY B;  2MF7 A;  4BU4 A;  3CNM A;  1HZ1 A;  1IQY A;  2KF6 A;  1K41 A;  5IG0 A;  2Z77 A;  2BHM A;  2AAE A;  1YVS A;  4ORL A;  3LZA A;  1AY7 A;  3N8B A;  3LTB A;  1BSA A;  1JZD A;  6GSP A;  1I0V A;  2CFW A;  4NHF A;  2C11 A;  1O7M B;  1B2S A;  2IMJ A;  3IMA B;  1FA3 A;  2O9U X;  1U8C B;  2CC3 A;  1CEW I;  3F7S A;  4HM7 B;  3J7Y d;  7RNT A;  1LNH A;  4CPK A;  1TJD A;  3FZW A;  1RKY A;  1CQS A;  1N9E A;  1WTH A;  1B27 A;  3NBR A;  3BND A;  3NXJ A;  1AR0 A;  4NPB A;  3RDE A;  5AIH A;  1YVB I;  1BNI A;  1N8Q A;  1VQM 3;  2RBI A;  2W9P A;  1C54 A;  3DZL A;  3B7C A;  3GAX A;  3BNE A;  3HIG A;  4Q53 A;  1VQ5 3;  2CK3 H;  3JVC A;  1IQ8 A;  1OF5 B;  1UDI I;  3FGY A;  1BNS A;  1MNL A;  4HM0 B;  8CHO A;  3NHX A;  2P38 A;  1Q40 B;  1IV9 A;  2HOH A;  5IEN A;  3V99 A;  1UUV B;  3AMO B;  1RMS A;  4FR9 A;  1ZS7 A;  1RCK A;  1GOV A;  4H3U A;  4KT3 B;  1YJ9 3;  4QWT A;  1RGA A;  1YIJ 3;  4R9K A;  2OTL 3;  1BRH A;  1OUN A;  1VQK 3;  2ML6 A;  4EBG A;  2OWP A;  2KCD A;  3WA2 X;  8RNT A;  1YHQ 3;  2H0H A;  4EV2 A;  1BNG A;  1MWS A;  2A15 A;  1X1W A;  1DET A;  4IPB A;  4LZI A;  2V1L A;  4N6L A;  4XB5 A;  1BVI A;  1GY6 A;  2XFT A;  1LVN A;  5JPP A;  5G2G A;  3F9S A;  5KP4 A;  1B2M A;  5AEW B;  1ULJ B;  2B1X B;  1Y4K A;  2XSO B;  1NNV A;  1BRS A;  3EHC A;  3DUK A;  3F8X A;  3MG2 A;  1T2I A;  1EA2 A;  2K54 A;  3BLZ A;  3FG3 A;  3GRD A;  1I3F A;  3X40 A;  3KFQ C;  1W2B 2;  1KC8 4;  2W56 B;  3SLU A;  3OW2 2;  3CC4 3;  3LT9 A;  4MJD A;  3T8N A;  2CKF B;  2RNT A;  4N6U A;  1A2P A;  3G0K A;  1GS3 A;  4BTW A;  1PU4 A;  3CCE 3;  1EEJ A;  1ULI B;  1JBT A;  5GSP A;  4TX4 A;  1WMO A;  1QVF 2;  1G96 A;  1LRA A;  1M90 4;  1A2K A;  2HMM B;  4BIR A;  2Q07 A;  3V98 A;  3A76 A;  1VQP 3;  1BAO A;  4GL6 A;  3CMA 3;  1BSC A;  3DGO A;  1QJG A;  1SII A;  3GZY B;  3Q1C A;  1K73 4;  1STD A;  3BNB A;  4I4K A;  3ZFZ A;  1BRN L;  4WP5 A;  4HM5 B;  5JBS A;  3KZT A;  3NV0 A;  4XBY A;  1N8R 4;  1UGI A;  3Q3F A;  4BL3 A;  5IG3 A;  2HMJ B;  3OX9 A;  4EXR A;  2FGT A;  2I9W A;  2W0Q A;  1JKG B;  1B3S A;  1OHO A;  3AHS A;  3GZR A;  3GZB A;  3CXC 2;  2XR8 B;  3LTD A;  2IUK A;  3IPT A;  3D3L A;  4LYL B;  4AKZ A;  1W01 A;  1MWR A;  1YGW A;  3DH2 A;  1JV2 B;  1NB3 I;  3UL5 A;  2XH9 A;  4FMD A;  4K90 B;  5DRV A;  5EVH A;  2XSH B;  1RGC A;  3EQQ B;  3JUM A;  3LH4 A;  3PS8 A;  1IYY A;  4RZM A;  2GEY A;  1B2Z A;  1X1U A;  2RFR A;  1I3I A;  1IVU A;  1RSN A;  4FMC A;  2LQV A;  5D83 A;  3WOE B;  1RNT A;  2GEX A;  3K63 A;  1FYS A;  3LML A;  2D42 A;  2Y73 A;  3X3Y A;  2CFK A;  1IVV A;  3EJV A;  1YGE A;  3NM2 A;  2STD A;  1AV4 A;  4OK0 A;  1SQW A;  3CCL 3;  4KFF A;  5DRE A;  3WOF B;  1VQ9 3;  1Q81 4;  3UB1 A;  3FG4 A;  3EE1 A;  2P0M A;  4K61 A;  2MC8 A;  1NWW A;  4LGQ A;  1FUW A;  7STD A;  1D6Y A;  2CFG A;  3HI7 A;  3CNX A;  1EKM A;  2O3O A;  1MOL A;  2BNG A;  4NRE A;  3KN4 A;  2CX1 A;  4FCJ A;  3CCV 3;  4MMX B;  1TU5 A;  1A90 A;  3VF1 A;  1G0T A;  3MWZ A;  4R4K A;  3B4P A;  4FCZ A;  1RDS A;  4X2H A;  1IV7 A;  1JB4 A;  3MKI A;  2QGU A;  1WMN A;  1W6Y A;  2BMQ B;  3EC9 A;  2QA4 3;  1Q7Y 4;  2BMR B;  1W2Z A;  3HX8 A;  1T5Y A;  3D9R A;  2F5W A;  1W7C A;  3DGL A;  4HM1 B;  1B21 A;  2XEP A;  1E3V A;  6STD A;  2IUJ A;  2E2T A;  1US1 A;  3PZW A;  1ZGX A;  1KQS 2;  4FMB A;  4HKV B;  3ZG0 A;  4XDW A;  2F4Y A;  4O3V A;  3FLJ A;  2R4I A;  4PEJ A;  4RNT A;  3S27 A;  5M19 A;  1TTO A;  3PGB A;  1JRQ A;  1UCL A;  4BTY A;  1VQ6 3;  2PNC A;  1SJW A;  3B8L A;  3FH1 A;  1IQX A;  2UX0 A;  2RSX A;  4IIA A;  3Q90 A;  3U1W A;  2W2C A;  5BVB A;  1JJ2 2;  1DVC A;  3GWR A;  2CFD A;  2H0I A;  4J5K A;  1EQK A;  1V58 A;  1LXE A;  3HII A;  1WNH A;  1AVK A;  2W04 A;  4RBN A;  1CYV A;  1EUI C;  2KXG A;  3LYG A;  3WHO A;  1OF5 A;  1E3R A;  1Q42 A;  1GOU A;  2F99 A;  5LC6 A;  1N5H A;  1I2F A;  1Q7H A;  1BUJ A;  3OV4 A;  1Q40 A;  1UUG B;  1JBR A;  4AKY A;  3BB9 A;  4L8O A;  2OTJ 3;  4HZ9 B;  1IT8 A;  3GSP A;  3AMO A;  1DYU A;  1YIT 3;  1DVD A;  4ZM8 A;  4CDL A;  1M9G A;  3K0Z A;  1BSB A;  3KSE D;  3F8H A;  4HM8 B;  4CJN A;  4DKI A;  4WHA A;  3PCR A;  4KFD A;  2FNQ A;  1QAK A;  1UUW B;  2KAA A;  4MEI A;  2GBX B;  4BL2 A;  1FGQ A;  1W6C A;  1R4Y A;  2BIR A;  1VZZ A;  2CG0 A;  3QRD A;  4WWU C;  1ROV A;  2RCD A;  2XF3 A;  5CK6 A;  1VQL 3;  4XBX A;  2IY2 A;  4JF8 A;  1K8A 4;  4N6N B;  2W03 A;  3ALA A;  5A0O B;  2OCT A;  3FF0 A;  4STD A;  3RNT A;  3F14 A;  2XGL A;  1BNR A;  1LOY A;  4XDV A;  1I8V A;  3KII A;  1VQN 3;  1PYL A;  1GMQ A;  1TP6 A;  2W56 A;  1TUH A;  1BNJ A;  1EG9 B;  3EN8 A;  2GSP A;  1HU9 A;  4J8T A;  3X42 A;  1X1Y A;  2K3D A;  2M7O A;  1JN5 B;  1K28 A;  3G8Z A;  3I0Y A;  3G6E 3;  1ISK A;  5IEO A;  4HZB B;  1D6Z A;  3OWU A;  2WGO A;  2B24 B;  1W4N A;  1OHP A;  3OWS A;  3WR2 A;  1BRJ A;  5CF2 A;  6RNT A;  3NBJ A;  1V74 A;  1VQ8 3;  1STF I;  2F56 A;  4BTX A;  3CD6 3;  1QAL A;  2GBW B;  1KSI A;  1IVW A;  1AQZ A;  5IG4 A;  1UI8 A;  1E97 A;  4LSO A;  4FCM A;  2SAR A;  3Q2P A;  2KF4 A;  1LOX A;  2XRX B;  3DY5 A;  3HOH A;  3B4O A;  2CG1 A;  2D1W A;  1UCI A;  1JKG A;  1B20 A;  2F86 B;  2RGQ A;  3SXX A;  1GSP A;  1FGT A;  5AII A;  1TIJ A;  2BT3 A;  3G16 A;  3PXM A;  2C4B A;  1UI7 A;  3M8C A;  1JZO A;  1NU3 A;  1M1X B;  4WYK B;  3T8U A;  3K7C A;  1UCJ A;  2HML B;  3G71 3;  5CXO A;  1GD3 A;  1RLS A;  2Y74 A;  3SOA A;  1WMP A;  5IW9 A;  3G4S 3;  4HVN A;  1RRH A;  2OOV A;  2JQ5 A;  1JNQ A;  1GY7 A;  1VQQ A;  3H3H A;  4XBT A;  4KFE A;  1DMQ A;  5AYR B;  4N6T A;  3S5C A;  1QMA A;  1QAF A;  3HK4 A;  1Q86 4;  2SBL A;  5CLK A;  3F40 A;  2YFJ B;  3EBY A;  5KP1 A;  3STD A; 
#chains in the Genus database with same CATH homology
 4HM2 B;  3X3Z A;  1BUQ A;  1CYU A;  1SPU A;  2OOV C;  1L5G B;  3SOY A;  3ROB A;  3PYJ A;  3CCQ 3;  1OPY A;  3JUP A;  1AVL A;  3MG3 A;  4MMZ B;  2ZL8 A;  3EX9 A;  2Z76 A;  1S5A A;  3LTC A;  3WOD G;  1YJW 3;  3KE7 A;  2CH9 A;  3NX0 A;  4HYZ A;  4O8S A;  3WA3 A;  2YX9 A;  3EN1 B;  3RGA A;  1O7P B;  3JUO A;  4EV5 A;  2QEX 3;  3CCR 3;  3FSD A;  3EBT A;  4LEH A;  1W6G A;  2CWU A;  3UL6 A;  3SVA A;  3K9M C;  1DMN A;  3UNL A;  2ZDJ A;  2Z6B A;  1ROA A;  2BMO B;  1W5Z A;  3CPO A;  3STD A;  1RJO A;  4HM3 B;  1TFO A;  2CW9 A;  2QIY A;  4XM4 A;  4RNZ A;  1S72 3;  4K1U A;  5IF6 A;  3MSO A;  3MHE A;  1NJI 4;  3KKG A;  3X3X A;  1R4C A;  3PCS A;  4O02 B;  1M1K 4;  1OAC A;  4U13 A;  3S29 A;  3DGM A;  2GU3 A;  4H61 A;  2PZV A;  5D82 A;  1DMM A;  1ZO2 A;  5AIF A;  1RRL A;  5HGR A;  4R80 A;  3E99 A;  1YJN 3;  3OWY A;  2W6J H;  2IA7 A;  4K1V A;  3I55 3;  2YFL B;  4LMI A;  4RNY A;  1OHS A;  3KSP A;  4OUQ A;  3L0R A;  3LTA A;  1IK3 A;  1Q82 4;  1NO3 A;  5BXQ A;  2WGQ A;  2Z7A A;  1QVG 2;  2C10 A;  5IER A;  1RN7 A;  4X2O A;  3S67 A;  2XFS A;  1IU7 A;  4EC6 A;  4WFO A;  1O7H B;  1A2V A;  2XGN A;  4L8P A;  5I97 A;  4N3V A;  1O7W B;  3SED A;  3UJM A;  5EEO A;  3NUV A;  3HZP A;  2HMK B;  4OVM A;  2CHC A;  3H51 A;  1KD1 4;  3CU3 A;  3K5T A;  2YFI B;  1J2B A;  1NB5 I;  3FCS B;  2FXT A;  3MG1 A;  1HKX A;  3QK9 A;  3O8Y A;  2GXF A;  2GU1 A;  4KVH A;  1A67 A;  2JDI H;  3V92 A;  3NM7 A;  3S28 A;  2OQE A;  5IG5 A;  3RGR A;  3DM8 A;  4HBR A;  2E2U A;  2P0X A;  3NQY A;  3FG1 A;  3CC7 3;  1FGR A;  3DGN A;  3MPH A;  3DXO A;  3N54 B;  2CWT A;  2KRT A;  3LOY A;  3NQZ A;  4CCV A;  2W9Q A;  5KP3 A;  2OQE C;  1ZX2 A;  2HMN B;  4R9L A;  1VQ4 3;  3EF8 A;  4HM6 B;  4J9A A;  1JB2 A;  5FGO A;  1OH0 A;  4HM4 B;  1JN5 A;  4GB5 A;  1VQ7 3;  1YI2 3;  1OGZ A;  5ELJ A;  5TGN A;  5AI1 A;  1YHQ 3;  2LYX A;  4O2H A;  1K73 4;  4IT7 A;  3BNC A;  3SX1 A;  5AYS C;  2CFL A;  1JB5 A;  1PFP A;  1OGX A;  3CPW 2;  1N9J A;  1IVX A;  2F98 A;  4G1M B;  5AEU B;  4N6M A;  3FF2 A;  3T0U A;  2E2V A;  3NV0 B;  3CC2 3;  5STD A;  1C7H A;  3N9H A;  3CCS 3;  3CCJ 3;  3JUQ A;  3VGN A;  1W00 A;  3VSY A;  3I56 3;  1NDO B;  1SIH A;  1O7N B;  5CF1 A;  3LT8 A;  4KZ1 A;  4R1K A;  5AIG A;  3LXU X;  2HMO B;  2WOF A;  1N5P A;  2BO9 B;  4WYK A;  2CWV A;  1FGM A;  1Z1S A;  2WO0 A;  2WOH A;  1TFK A;  1K9M 4;  5JPU A;  1VQO 3;  3WMD A;  3FKA A;  1UW1 A;  1GD4 A;  1FGO A;  3OXA A;  3CME 3;  5ELU A;  4FMA A;  3WDG B;  5IEP A;  3CCU 3;  3ER7 A;  2CIU A;  3X41 A;  4N6O B;  3IJE B;  3F7X A;  4JRF A;  1O7G B;  3EB8 A;  1WQL B;  2K0M A;  1IDP A;  1U5O A;  3CCM 3;  3TDG A;  3NBB A;  3U97 A;  1D6U A;  5FW5 A;  5D81 A;  2L4V A;  1GY5 A;  2INX A;  1GYB A;  3GZX B;  4AEQ A;  5EQL A;  1OCV A;  5LC7 A;  3ECF A;  1ASK A;  1W02 A;  2P05 A;  4HJL B;  1IT7 A;  1KWI A;  2P09 A;  4N6V 0;  4L7K A;  1F8N A;  3DMC A;  3JUN A;  4EYC A;  3MYT A;  4MMY B;  2ML5 A;  2MF7 A;  3CNM A;  1IQY A;  1K41 A;  5IG0 A;  2Z77 A;  2BHM A;  4ORL A;  3LZA A;  3N8B A;  3LTB A;  4NHF A;  2CFW A;  1FA3 A;  2C11 A;  1O7M B;  2IMJ A;  3IMA B;  2O9U X;  1U8C B;  2CC3 A;  1CEW I;  3F7S A;  4HM7 B;  3J7Y d;  1LNH A;  3FZW A;  1RKY A;  1CQS A;  1N9E A;  1WTH A;  3NBR A;  3BND A;  3NXJ A;  1AR0 A;  3RDE A;  5AIH A;  1YVB I;  1N8Q A;  1VQM 3;  2W9P A;  3DZL A;  3B7C A;  3GAX A;  3BNE A;  3HIG A;  4Q53 A;  1VQ5 3;  2CK3 H;  3JVC A;  1IQ8 A;  1OF5 B;  3FGY A;  1MNL A;  4HM0 B;  8CHO A;  3NHX A;  2P38 A;  1Q40 B;  1IV9 A;  5IEN A;  3V99 A;  1UUV B;  3AMO B;  4FR9 A;  4H3U A;  1YJ9 3;  4QWT A;  1YIJ 3;  4R9K A;  2OTL 3;  1OUN A;  1VQK 3;  2ML6 A;  4EBG A;  2OWP A;  2KCD A;  3WA2 X;  4EV2 A;  2A15 A;  4IPB A;  4LZI A;  2V1L A;  4N6L A;  4XB5 A;  1GY6 A;  2XFT A;  1LVN A;  5JPP A;  5G2G A;  3F9S A;  5KP4 A;  5AEW B;  1ULJ B;  2B1X B;  1Y4K A;  2XSO B;  3EHC A;  3DUK A;  3F8X A;  3MG2 A;  1EA2 A;  2K54 A;  3BLZ A;  3FG3 A;  3GRD A;  3X40 A;  3KFQ C;  1W2B 2;  1KC8 4;  2W56 B;  3SLU A;  3OW2 2;  3CC4 3;  3LT9 A;  4MJD A;  3T8N A;  2CKF B;  4N6U A;  3G0K A;  1GS3 A;  4BTW A;  1PU4 A;  3CCE 3;  1ULI B;  4TX4 A;  1WMO A;  1QVF 2;  1G96 A;  1M90 4;  1A2K A;  2HMM B;  2Q07 A;  3V98 A;  3A76 A;  1VQP 3;  3CMA 3;  4GL6 A;  3DGO A;  3Q1C A;  1QJG A;  1SII A;  3GZY B;  1STD A;  3BNB A;  4I4K A;  4WP5 A;  4HM5 B;  5JBS A;  3KZT A;  3NV0 A;  4XBY A;  1N8R 4;  5IG3 A;  2HMJ B;  3OX9 A;  4EXR A;  2FGT A;  2I9W A;  2W0Q A;  1JKG B;  1OHO A;  3GZR A;  3GZB A;  3CXC 2;  2XR8 B;  3LTD A;  2IUK A;  3IPT A;  3D3L A;  4AKZ A;  1W01 A;  1JV2 B;  1NB3 I;  3UL5 A;  2XH9 A;  4FMD A;  4K90 B;  5DRV A;  5EVH A;  2XSH B;  3EQQ B;  3JUM A;  3LH4 A;  3PS8 A;  4RZM A;  2GEY A;  2RFR A;  1IVU A;  4FMC A;  2LQV A;  5D83 A;  3WOE B;  2GEX A;  3K63 A;  3LML A;  2D42 A;  2Y73 A;  3X3Y A;  2CFK A;  1IVV A;  3EJV A;  1YGE A;  3NM2 A;  2STD A;  1AV4 A;  4OK0 A;  1SQW A;  3CCL 3;  4KFF A;  5DRE A;  3WOF B;  1VQ9 3;  1Q81 4;  3UB1 A;  3FG4 A;  3EE1 A;  2P0M A;  4K61 A;  2MC8 A;  1NWW A;  4LGQ A;  1FUW A;  7STD A;  1D6Y A;  2CFG A;  3HI7 A;  3CNX A;  1EKM A;  2O3O A;  1MOL A;  2BNG A;  4NRE A;  3KN4 A;  4FCJ A;  3CCV 3;  4MMX B;  1TU5 A;  1A90 A;  3VF1 A;  3MWZ A;  4R4K A;  3B4P A;  4FCZ A;  4X2H A;  1IV7 A;  1JB4 A;  3MKI A;  2QGU A;  1WMN A;  1W6Y A;  2BMQ B;  3EC9 A;  2QA4 3;  1Q7Y 4;  2BMR B;  1W2Z A;  3HX8 A;  1T5Y A;  3D9R A;  1W7C A;  3DGL A;  4HM1 B;  2XEP A;  1E3V A;  6STD A;  2IUJ A;  2E2T A;  1US1 A;  3PZW A;  1KQS 2;  4FMB A;  4HKV B;  4XDW A;  4O3V A;  3FLJ A;  2R4I A;  4PEJ A;  3S27 A;  3PGB A;  1JRQ A;  4BTY A;  1VQ6 3;  2PNC A;  1SJW A;  3B8L A;  3FH1 A;  1IQX A;  2UX0 A;  2RSX A;  4IIA A;  3Q90 A;  3U1W A;  2W2C A;  5BVB A;  1JJ2 2;  1DVC A;  3GWR A;  2CFD A;  1EQK A;  1LXE A;  3HII A;  1WNH A;  1AVK A;  2W04 A;  4RBN A;  1CYV A;  2KXG A;  3LYG A;  1OF5 A;  1E3R A;  1Q42 A;  2F99 A;  5LC6 A;  1N5H A;  3OV4 A;  1Q40 A;  2OTJ 3;  4AKY A;  3BB9 A;  4L8O A;  4HZ9 B;  1IT8 A;  3AMO A;  1DYU A;  1YIT 3;  1DVD A;  4ZM8 A;  4CDL A;  1M9G A;  3K0Z A;  3KSE D;  3F8H A;  4HM8 B;  4WHA A;  3PCR A;  4KFD A;  2FNQ A;  1QAK A;  1UUW B;  4MEI A;  2GBX B;  1FGQ A;  1W6C A;  1VZZ A;  2CG0 A;  3QRD A;  4WWU C;  2XF3 A;  1ROV A;  2RCD A;  5CK6 A;  1VQL 3;  4XBX A;  4JF8 A;  1K8A 4;  4N6N B;  2W03 A;  3ALA A;  5A0O B;  2OCT A;  3FF0 A;  4STD A;  3F14 A;  2XGL A;  4XDV A;  3KII A;  1VQN 3;  1TP6 A;  2W56 A;  1TUH A;  1EG9 B;  3EN8 A;  1HU9 A;  4J8T A;  3X42 A;  2M7O A;  3I0Y A;  1JN5 B;  1K28 A;  3G8Z A;  3G6E 3;  1ISK A;  5IEO A;  4HZB B;  1D6Z A;  3OWU A;  2WGO A;  2B24 B;  1W4N A;  1OHP A;  3OWS A;  5CF2 A;  3NBJ A;  1V74 A;  1VQ8 3;  1STF I;  4BTX A;  3CD6 3;  1QAL A;  2GBW B;  1KSI A;  1IVW A;  5IG4 A;  1UI8 A;  1E97 A;  4LSO A;  4FCM A;  3Q2P A;  2XRX B;  1LOX A;  3DY5 A;  2CG1 A;  3B4O A;  2D1W A;  1JKG A;  2F86 B;  2RGQ A;  3SXX A;  1FGT A;  5AII A;  1TIJ A;  2BT3 A;  3G16 A;  3PXM A;  3M8C A;  1UI7 A;  3T8U A;  1NU3 A;  1M1X B;  4WYK B;  3K7C A;  2HML B;  3G71 3;  5CXO A;  1GD3 A;  2Y74 A;  3SOA A;  1WMP A;  5IW9 A;  3G4S 3;  4HVN A;  1RRH A;  2OOV A;  2JQ5 A;  1JNQ A;  1GY7 A;  3H3H A;  4XBT A;  4KFE A;  1DMQ A;  5AYR B;  4N6T A;  3S5C A;  1QMA A;  1QAF A;  3HK4 A;  1Q86 4;  2SBL A;  5CLK A;  3F40 A;  2YFJ B;  3EBY A;  5KP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...