3SVAA

Crystal structure of v57d mutant of human cystatin c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIDAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
publication title Structural characterization of V57D and V57P mutants of human cystatin C, an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3svaA00
3L0RA 1IV7A 1DVCA 1WNHA 2W9PA 5LC6A 1G96A 1IV9A 4N6NB 3PYJA 1N5HA 4IT7A 4CCVA 4N6LA 3SVAA 1LXEA 4N6OB 1GD3A 1R4CA 1CEWI 3NX0A 1KWIA 2O9UX 1ROAA 1GD4A 1STFI 1A67A 3Q2PA 4EYCA 1NB5I 1PFPA 3LH4A 1N9JA 2CH9A 3UL5A 2KXGA 4N6V0 5EQLA 3IMAB 2OCTA 3KFQC 1A90A 3MWZA 2W9QA 4N6UA 1FA3A 2BO9B 4TX4A 3K9MC 3QRDA 3GAXA 1MOLA 1DVDA 3KSED 4ZM8A 3PS8A 1CYVA 1M9GA 1CYUA 1TIJA 4LZIA 1FUWA 1MNLA 1EQKA 1NB3I 1N5PA 5ELJA 4N6MA 1RN7A 3S67A 4N6TA 5ELUA 5LC7A 1YVBI 3PXMA 5A0OB 3UL6A
chains in the Genus database with same CATH superfamily
1IU7A 1E3VA 4L7KA 1RDSA 2P38A 1IV7A 5D83A 1WNHA 1VQ53 1GMQA 2IUJA 1O7WB 2W9PA 2WGOA 3KSPA 3FZWA 3EX9A 2B1XB 1IQXA 5LC6A 3EN8A 4Q53A 2K54A 2QA43 1BAOA 2XFTA 5EVHA 2HMOB 1M1K4 3DUKA 1GYBA 4RNTA 3B8LA 1UCKA 3ZFZA 3CCV3 1JB5A 4PEJA 2BT3A 1YVSA 1LXEA 1RGAA 1BSCA 3G16A 4LGQA 1RN1A 5G1KA 3CCL3 1VQL3 1VQ73 1PY3A 2HMNB 2K3DA 2PZVA 2WO0A 3CMA3 2ML5A 1CEWI 1I8VA 1OACA 3F8XA 4MMXB 2IA7A 5IG0A 3SYUA 1ULJB 3N54B 5CF2A 3DM8A 5JBSA 1GD4A 1NO3A 3LYGA 3D4AA 3OX9A 1RGLA 5IEPA 2C10A 2OQEC 3WOFB 3LT8A 2V1LA 3LTBA 1OHSA 1PFPA 3LTAA 1W00A 4FMDA 3PCSA 2HMLB 5M1AA 3NXJA 1JNQA 2KXGA 2JDIH 5DREA 3AGNA 3WR2A 1D6ZA 4JF8A 3AHSA 4CJNA 4FCMA 4HYZA 3PCRA 2RBIA 1BNJA 3CCU3 1W2ZA 1Q40A 1X1XA 2OWPA 2Y73A 4LMIA 2W9QA 1RTUA 2E2UA 3HOHA 1RLSA 1RSNA 4KZ1A 2BNGA 2W56A 1BSBA 1B2ZA 4N6UA 2IYJA 3V98A 4BL3A 3PGBA 1DMQA 4TX4A 5KP4A 4O8SA 4WP5A 5IG5A 2B24B 2OTL3 1B21A 1C54A 3JUMA 5EEOA 4LYLB 1Q7HA 4CPKA 3GZYB 1Q42A 2GSPA 1UCIA 2WGQA 4FMBA 1QVG2 5JPPA 2W2CA 4IPBA 3CC73 3S28A 1BUJA 1DVDA 3F7SA 4LEHA 2CFDA 4ZM8A 1B20A 2F5MA 1OUNA 1EKMA 1FGOA 1OCVA 1IVXA 2XFSA 3BIRA 1W6GA 2UUGC 3BB9A 3F14A 3F8HA 2BHMA 5DRVA 2INXA 4LZIA 1B2UA 2XEPA 3DGLA 4HAAA 1FUWA 1MNLA 3X41A 3UB1A 4HBRA 3IJEB 3HK4A 3CXC2 2GXFA 2H0IA 4HKVB 3CCE3 1LRAA 1ZX2A 1BRGA 2WOHA 4GHOA 1T5YA 5BIRA 3MYTA 3FG4A 5GSPA 3LT9A 1BUQA 5M18A 1RRHA 2CFLA 2GU3A 2XH9A 4I5QA 2FGTA 4WFOA 5STDA 3FSDA 4K90B 1VQN3 1ISKA 1WMPA 1Q40B 1CQSA 2CFWA 1BU4A 4J5GA 3WA2X 3TDGA 1BNIA 4HOHA 1G0TA 1MWTA 4RZMA 4HM2B 2GBXB 2W56B 2STDA 3NM7A 5BU4A 2BU4A 1YI23 2F86B 4HM6B 1V58A 4J8TA 1J2BA 4J9AA 4X2OA 1FGTA 1YIT3 2QEX3 1D6YA 4MMZB 4BTYA 4L8PA 3EJVA 1OH0A 5D82A 1IQ8A 1ZS7A 1U5OA 3CPOA 5FW5A 5I97A 5HGRA 4FMCA 2F4YA 3DXOA 3JUPA 2FNQA 4J5KA 3HZPA 1GMRA 1V57A 5IW9A 1Q9EA 3WHOA 1G96A 1EA2A 2A15A 4R9LA 1O7PB 1HYFA 1S723 2GU1A 4N6NB 1U8CB 1IDPA 3PYJA 3S29A 1AVLA 1WQLB 1I0VA 1QALA 2R41A 1DETA 2CG0A 3Q1CA 2CG1A 3VSYA 3V99A 1K734 2I9WA 2CX0A 1B2SA 2F5WA 5TGNA 4N6LA 1FYSA 2BMRB 8RNTA 1QAKA 4N6OB 3D79A 3F7XA 4HM8B 1W2B2 4LSOA 4WHAA 1IQYA 1LOXA 3URPA 1YNVX 1JZOA 7GSPA 2XSOB 2LYXA 4HZ9B 1QMAA 1KWIA 1YHQ3 1MWRA 3FLJA 2UX0A 1PYLA 3DGMA 2F98A 3HI7A 3X3XA 1KD14 3X3YA 3N8BA 2CWUA 1BOXA 3ROBA 1A67A 2QIYA 4HM1B 4K1VA 4X2HA 3Q2PA 2AADA 2HMKB 1X1WA 1JBTA 3GZRA 1NB5I 3CNMA 1Q7Y4 1N9JA 1SPUA 1EG9B 2CH9A 3LZAA 4N6V0 3I0YA 1W02A 3F9SA 1AVKA 2HMJB 1BNSA 4H3UA 1RMSA 2CX1A 4H61A 1RGCA 1SIIA 3N9HA 3OWYA 6GSPA 5IERA 1DYUA 1JZDA 1VQK3 4HM5B 3I553 1SARA 1YGEA 3E99A 1STDA 1TU5A 3DGYA 2XSHB 1FUSA 3DZLA 3NUVA 1T3BA 2H0HA 4HM7B 4K61A 1FA3A 3DGOA 2BO9B 1O7NB 1S5AA 4XBYA 5AI1A 3H51A 3CCS3 4AKZA 1Q864 4R4KA 1IT7A 5AIGA 1CH0A 2KF6A 3GAXA 1PU4A 2RSXA 1MOLA 1QJGA 3RGAA 3Q90A 2KF5A 1BNFA 1L5GB 4MEIA 1RGFA 1YJN3 3JVCA 7RNTA 2XGNA 1BANA 1ASKA 1Q824 3ZG5A 1NU3A 2GEXA 3PS8A 3K63A 1OHOA 4KT3B 4DKIA 1BRSA 3HX8A 1CYUA 6RNTA 3FKAA 1TFOA 1TIJA 1W4NA 1TTOA 4I4KA 1N9EA 4GB5A 1AQZA 4XBXA 1KSIA 3FF0A 1K28A 4HVNA 3FGYA 2E2TA 3JUQA 1RGHA 5AEUB 1RHLA 2W03A 1M904 2FXTA 1MGRA 4AKYA 1LOYA 1RN7A 3CCM3 3G0KA 5FGOA 3SX1A 5CF1A 4XM4A 1TUHA 1RRLA 4FCJA 4XDVA 1B2MA 2H0GA 3DMCA 3D9RA 2K0MA 4N3VA 1FGQA 4N6TA 1ZO2A 2RCDA 2E2VA 3T0UA 2CFKA 3PXMA 1O7GB 1M1XB 1LNIA 3BNBA 4G1MB 4STDA 5A0OB 6STDA 2YX9A 4U13A 5G2GA 3SXXA 3CU3A 4HM3B 2KCDA 3SOAA 1UCLA 3L0RA 1W5ZA 2P09A 1RJOA 3EB8A 3NBRA 1BNEA 3NV0A 2IY2A 1UUGB 3DGNA 3H3HA 3A76A 3GWRA 1B3SA 4O2HA 3JUOA 1JJ22 1IV9A 1UI7A 4FCZA 3WOEB 5JPUA 2OQEA 3T8UA 1MGWA 1VQ93 2O3OA 5HOHA 3AGOA 1N5HA 1TRPA 7STDA 3GZXB 1LOVA 1DMNA 1TRQA 2OOVC 2YFIB 4FR9A 2ZL8A 4CCVA 4BU4A 3LOYA 5AIHA 3SVAA 1UUVB 2MC8A 4OUQA 1GD3A 3EHCA 8CHOA 1B2XA 2L1SA 1RCKA 2HMMB 2IUKA 1IYYA 1R4CA 1ZGXA 3CCR3 1YJ93 1GY6A 1BSAA 4RNZA 3GZBA 2F56A 1RN4A 3QK9A 1Q814 1ROVA 3BNEA 1BRHA 4XDWA 1ROAA 2JQ5A 3SLUA 1NNVA 3CPW2 1N8R4 1BNRA 1SQWA 2W04A 1STFI 4NHFA 3EBYA 3NQZA 1UW1A 3GSPA 5IF6A 4KFEA 1UGIA 2KAAA 4EBGA 9RNTA 1VQM3 3S5CA 1YIJ3 1O7MB 3GRDA 1JB4A 3LH4A 2UGIA 2Z7AA 4FMAA 1HU9A 1IVWA 3UL5A 1C7HA 4CDLA 3OV4A 2XF3A 3IMAB 2CHCA 4MJDA 1BRKA 2OCTA 1IVUA 3NBJA 3MSOA 4NPBA 3EF8A 3CC43 3KFQC 1EEJA 4XBTA 1ULIB 3ZG0A 1A90A 3HIGA 3NV0B 3X3ZA 2Z77A 1EUIC 2GBWB 3KE7A 1D6UA 4BTWA 3M8CA 3BLZA 1RKYA 3ER7A 5AIIA 1BRJA 4GSPA 3EE1A 1TFKA 1Y4KA 2CC3A 3A5EA 2KRTA 1LOWA 3K9MC 2Q07A 1US1A 2YFJB 3X40A 1VQ63 1JBRA 3QRDA 2KF4A 4O02B 4BIRA 1BNGA 4QWTA 3MHEA 3I563 2C4BA 1I3FA 4MMYB 1WMNA 1VQO3 3G4S3 2ZHXB 5AIFA 2CWVA 3WODG 1BSEA 1W01A 1VZZA 1X1YA 3O8YA 3MKIA 4K1UA 4EW5A 2LQVA 2XGLA 3B4OA 5CK6A 2W6JH 3G8ZA 4WYKA 2XR8B 1F8NA 2P05A 1GOVA 4EC6A 1AV4A 4R80A 1RNBA 1VQ43 1IVVA 5CLKA 4EV2A 3CC23 4XB5A 1DE3A 3BNDA 1JRQA 3WDGB 4OVMA 5ELJA 4N6MA 1W7CA 2XRXB 3U97A 3WMDA 3CCJ3 1GMPA 1RGKA 4KFDA 1MWSA 3S67A 3CD63 1GY7A 2IMJA 1BGSA 1FGRA 3KCHA 1RGEA 3FCSB 3SEDA 4WWUC 1N8QA 1QVF2 1OPYA 4OK0A 4ILFA 2CWTA 4EV5A 1SIHA 1YVBI 3D3LA 3UJMA 1A2KA 3WA3A 1WMOA 2ML6A 1BRNL 1FW7A 2CK3H 3FH1A 3OWSA 1UDII 4L8OA 1BIRA 3AMOA 3Q3FA 3NBBA 2PNCA 1DVCA 1K41A 1JKGA 3D5GA 4RBNA 2P0MA 2ZDJA 1IT8A 1R4YA 3J7Yd 1A2PA 2Z76A 4IIAA 1BSDA 1UGHI 3ECFA 1T2HA 1OF5A 1LVNA 3HIIA 1G02A 1Z1SA 2RGQA 4KFFA 1AY7A 1BRIA 1OGXA 1W6YA 4IT7A 3KKGA 1K9M4 2AAEA 2F99A 2Z6BA 3OXAA 4WYKB 3LTDA 2M7OA 1I2EA 3U1WA 4R1KA 3ALAA 3RGRA 2SARA 1VQQA 3B4PA 5AEWB 5KP3A 2YFLB 3K5TA 5IG3A 3K7CA 3NX0A 3LMLA 1JB2A 3CNXA 2O9UX 3LTCA 1WTHA 3MG3A 3MPHA 1AR0A 4HZBB 4EYCA 1I70A 3KIIA 1TJDA 1LQGC 2KF3A 3B7CA 4O3VA 1I0XA 3NHXA 2WOFA 1GOYA 1UCJA 5IEOA 3RNTA 4BTXA 1K8A4 5AYSC 1VQ83 3BNCA 4HJLB 3OWUA 4AEQA 5EQLA 1VQP3 4JRFA 1JN5A 1LNHA 3AMOB 3PZWA 5BVBA 3OW22 2OTJ3 1NJI4 2R4IA 1JKGB 1I3IA 3IPTA 5M19A 1YGWA 1QAFA 2C11A 3K0ZA 4KVHA 3EQQB 3FG1A 1GY5A 3MWZA 5IG4A 1OF5B 2Y74A 3EBTA 1KQS2 5D81A 1NWWA 4BL2A 2D1WA 2RFRA 5CXOA 5AYRB 1FZUA 3EC9A 4GL6A 3VF1A 3LXUX 1GS3A 1DMMA 1KC84 3FF2A 1I2GA 1TP6A 1UUWB 2BIRA 2SBLA 5G1LA 3MG2A 1I2FA 2GEYA 3X42A 1HKXA 2ZA4A 1YJW3 3UNLA 1T2IA 2RNTA 3SOYA 1GSPA 3KSED 1MWUA 3NQYA 3G6E3 3CCQ3 3T8NA 1OHPA 1RCLA 5KP1A 1CYVA 1SJWA 1FUTA 1M9GA 3AHWA 3MG1A 3DH2A 1E3RA 3F40A 3KZTA 4EXRA 1W6CA 5RNTA 2L4VA 3G713 1X1UA 3CME3 3S27A 3EN1B 4RNYA 2CIUA 3RDEA 5BXQA 3V92A 3BU4A 4HM4B 2BMOB 2W0QA 3NM2A 5IENA 2CW9A 3DY5A 1JN5B 1NB3I 2QGUA 3KN4A 1EQKA 1N5PA 1HZ1A 1V74A 1FGMA 2MF7A 3JUNA 1E97A 1O7HB 1B27A 2HOHA 3FG3A 2J8XB 4R9KA 2CFGA 2D42A 1GOUA 1OGZA 4ORLA 5ELUA 1RNTA 2OOVA 5LC7A 4HM0B 3D5IA 1A2VA 1NDOB 1RGGA 3VGNA 1BVIA 2P0XA 2CKFB 1JBSA 3STDA 1LQMB 1UI8A 2BMQB 3UL6A 1IK3A 1JV2B 4NREA
chains in the Genus database with same CATH topology
1IU7A 1E3VA 4L7KA 2P38A 1IV7A 5D83A 1WNHA 1VQ53 2IUJA 1O7WB 2W9PA 2WGOA 3KSPA 3FZWA 3EX9A 2B1XB 1IQXA 5LC6A 3EN8A 4Q53A 2K54A 2QA43 2XFTA 5EVHA 2HMOB 1M1K4 3DUKA 1GYBA 3B8LA 3CCV3 1JB5A 4PEJA 2BT3A 1LXEA 3G16A 4LGQA 3CCL3 1VQL3 1VQ73 2HMNB 2PZVA 2WO0A 3CMA3 2ML5A 1CEWI 1OACA 3F8XA 4MMXB 2IA7A 5IG0A 1ULJB 3N54B 5CF2A 3DM8A 5JBSA 1GD4A 1NO3A 3LYGA 3OX9A 5IEPA 2C10A 2OQEC 3WOFB 3LT8A 2V1LA 3LTBA 1OHSA 1PFPA 3LTAA 1W00A 4FMDA 3PCSA 2HMLB 3NXJA 1JNQA 2KXGA 2JDIH 5DREA 1D6ZA 4JF8A 4FCMA 4HYZA 3PCRA 3CCU3 1W2ZA 1Q40A 2OWPA 2Y73A 4LMIA 2W9QA 2E2UA 4KZ1A 4N6UA 2BNGA 2W56A 3V98A 3PGBA 1DMQA 4TX4A 5KP4A 4O8SA 4WP5A 5IG5A 2B24B 2OTL3 3JUMA 5EEOA 3GZYB 1Q42A 4FMBA 1QVG2 2WGQA 1DVDA 5JPPA 2W2CA 4IPBA 3CC73 3S28A 3F7SA 4LEHA 2CFDA 4ZM8A 1OUNA 1EKMA 1FGOA 1OCVA 1IVXA 2XFSA 3F14A 1W6GA 3BB9A 3F8HA 2BHMA 5DRVA 2INXA 4LZIA 2XEPA 3DGLA 1FUWA 1MNLA 3X41A 3UB1A 4HBRA 3IJEB 3HK4A 3CXC2 2GXFA 4HKVB 3CCE3 1ZX2A 2WOHA 1T5YA 3MYTA 3FG4A 3LT9A 1BUQA 1RRHA 2CFLA 2GU3A 2XH9A 2FGTA 4WFOA 5STDA 3FSDA 4K90B 1VQN3 1ISKA 1WMPA 1Q40B 1CQSA 2CFWA 3WA2X 3TDGA 4RZMA 1YI23 4HM2B 2GBXB 2W56B 2STDA 3NM7A 2F86B 4HM6B 4J8TA 1J2BA 4J9AA 4X2OA 1FGTA 1YIT3 2QEX3 1D6YA 4MMZB 4BTYA 4L8PA 3EJVA 1OH0A 5D82A 1IQ8A 1U5OA 3CPOA 5FW5A 5I97A 5HGRA 4FMCA 3DXOA 3JUPA 2FNQA 3HZPA 5IW9A 1G96A 1EA2A 2A15A 4R9LA 1O7PB 1S723 2GU1A 4N6NB 1U8CB 1IDPA 3PYJA 3S29A 1AVLA 1WQLB 1QALA 3X3ZA 2CG0A 3Q1CA 2CG1A 3VSYA 3V99A 1K734 2I9WA 5TGNA 3CCM3 4N6LA 2BMRB 1QAKA 4N6OB 1W2B2 3F7XA 4HM8B 4LSOA 4WHAA 1IQYA 1LOXA 2XSOB 2LYXA 4HZ9B 1QMAA 1KWIA 1YHQ3 3FLJA 2UX0A 3DGMA 2F98A 3HI7A 3X3XA 1KD14 3X3YA 3N8BA 2CWUA 3ROBA 1A67A 2QIYA 4HM1B 4K1VA 4X2HA 3Q2PA 2HMKB 3GZRA 1NB5I 3CNMA 1Q7Y4 1N9JA 1SPUA 1EG9B 2CH9A 3LZAA 4N6V0 3I0YA 1W02A 3F9SA 1AVKA 2HMJB 4H3UA 4H61A 1SIIA 3N9HA 3OWYA 5IERA 1VQK3 1DYUA 4HM5B 3I553 1YGEA 3E99A 1STDA 1TU5A 2XSHB 3DZLA 3NUVA 4HM7B 4K61A 1FA3A 3DGOA 2BO9B 1O7NB 1S5AA 4XBYA 5AI1A 3H51A 3CCS3 4AKZA 1Q864 4R4KA 1IT7A 5AIGA 3GAXA 1PU4A 2RSXA 1MOLA 1QJGA 3RGAA 3Q90A 1L5GB 4MEIA 1YJN3 3JVCA 2XGNA 1ASKA 1Q824 1NU3A 2GEXA 3PS8A 3K63A 1OHOA 3HX8A 1CYUA 3FKAA 1TFOA 1TIJA 1W4NA 4I4KA 1N9EA 4GB5A 4XBXA 1KSIA 3FF0A 1K28A 4HVNA 3FGYA 2E2TA 3JUQA 5AEUB 2W03A 1M904 2FXTA 4AKYA 1RN7A 3G0KA 5FGOA 3SX1A 5CF1A 4XM4A 1TUHA 1RRLA 4FCJA 4XDVA 3DMCA 3D9RA 2K0MA 4N3VA 1FGQA 4N6TA 1ZO2A 2RCDA 2E2VA 3T0UA 2CFKA 3PXMA 1O7GB 1M1XB 3BNBA 5A0OB 4G1MB 4STDA 6STDA 2YX9A 4U13A 5G2GA 3SXXA 3CU3A 4HM3B 2KCDA 3SOAA 3L0RA 1W5ZA 2P09A 1RJOA 3EB8A 3NBRA 3NV0A 3H3HA 3DGNA 1JJ22 3A76A 3GWRA 4O2HA 3JUOA 1IV9A 1UI7A 4FCZA 3WOEB 5JPUA 2OQEA 3T8UA 1VQ93 2O3OA 1N5HA 7STDA 3GZXB 2OOVC 1DMNA 2YFIB 4FR9A 2ZL8A 4CCVA 3LOYA 5AIHA 3SVAA 1UUVB 2MC8A 4OUQA 1GD3A 3EHCA 8CHOA 2HMMB 2IUKA 1R4CA 1YJ93 3CCR3 1GY6A 4RNZA 3GZBA 3QK9A 1Q814 1ROVA 3BNEA 4XDWA 1ROAA 2JQ5A 3SLUA 3CPW2 1N8R4 1SQWA 2W04A 1STFI 4NHFA 3EBYA 3NQZA 1UW1A 5IF6A 4KFEA 4EBGA 1VQM3 3S5CA 1YIJ3 1O7MB 3GRDA 1JB4A 3LH4A 2Z7AA 4FMAA 1HU9A 1IVWA 3UL5A 1C7HA 4CDLA 3OV4A 2XF3A 3IMAB 2CHCA 4MJDA 2OCTA 1IVUA 3NBJA 3MSOA 3CC43 3EF8A 3KFQC 4XBTA 1ULIB 1A90A 3HIGA 3NV0B 2Z77A 2GBWB 3KE7A 1D6UA 4BTWA 3M8CA 3BLZA 1RKYA 3ER7A 5AIIA 3EE1A 1TFKA 1Y4KA 2CC3A 2KRTA 3K9MC 2Q07A 1US1A 2YFJB 3X40A 1VQ63 3QRDA 4O02B 4QWTA 3MHEA 3I563 4MMYB 1WMNA 1VQO3 3G4S3 5AIFA 3WODG 2CWVA 1W01A 1VZZA 3O8YA 3MKIA 4K1UA 2LQVA 2XGLA 3B4OA 5CK6A 2W6JH 3G8ZA 4WYKA 2XR8B 1F8NA 2P05A 4EC6A 1VQ43 1AV4A 4R80A 1IVVA 5CLKA 4EV2A 3CC23 4XB5A 3BNDA 1JRQA 3WDGB 4OVMA 5ELJA 4N6MA 1W7CA 2XRXB 3U97A 3WMDA 3CCJ3 3S67A 4KFDA 3CD63 1GY7A 2IMJA 1FGRA 3FCSB 3SEDA 4WWUC 1N8QA 1QVF2 1OPYA 4OK0A 2CWTA 4EV5A 1SIHA 1YVBI 3D3LA 3UJMA 1A2KA 3WA3A 1WMOA 2ML6A 2CK3H 3FH1A 3OWSA 4L8OA 3AMOA 3NBBA 2PNCA 1DVCA 1K41A 1JKGA 4RBNA 2P0MA 2ZDJA 1IT8A 3J7Yd 2Z76A 4IIAA 3ECFA 1OF5A 1LVNA 3HIIA 1Z1SA 2RGQA 4KFFA 1OGXA 1W6YA 4IT7A 3KKGA 1K9M4 2F99A 2Z6BA 3OXAA 4WYKB 3LTDA 2M7OA 3U1WA 4R1KA 3ALAA 3RGRA 3B4PA 5AEWB 5KP3A 2YFLB 3K5TA 5IG3A 3K7CA 3NX0A 3LMLA 1JB2A 3CNXA 2O9UX 3LTCA 1WTHA 3MG3A 3MPHA 1AR0A 4HZBB 4EYCA 3KIIA 3B7CA 4O3VA 3NHXA 5IEOA 2WOFA 4BTXA 1K8A4 5AYSC 1VQ83 3BNCA 4HJLB 3OWUA 4AEQA 5EQLA 1VQP3 4JRFA 1JN5A 1LNHA 3AMOB 3PZWA 5BVBA 3OW22 2OTJ3 1NJI4 2R4IA 1JKGB 3IPTA 1QAFA 2C11A 3K0ZA 4KVHA 3EQQB 3FG1A 1GY5A 3MWZA 5IG4A 1OF5B 2Y74A 3EBTA 1KQS2 5D81A 1NWWA 2D1WA 2RFRA 5CXOA 5AYRB 3EC9A 4GL6A 3VF1A 3LXUX 1GS3A 1DMMA 1KC84 3FF2A 1TP6A 1UUWB 2SBLA 3MG2A 2GEYA 3X42A 1HKXA 1YJW3 3UNLA 3SOYA 3KSED 3NQYA 3G6E3 3CCQ3 3T8NA 1OHPA 5KP1A 1CYVA 1SJWA 3MG1A 1M9GA 1E3RA 3F40A 3KZTA 4EXRA 1W6CA 2L4VA 3G713 3CME3 3S27A 3EN1B 4RNYA 2CIUA 3RDEA 5BXQA 3V92A 4HM4B 2BMOB 2W0QA 3NM2A 5IENA 2CW9A 3DY5A 1JN5B 1NB3I 2QGUA 3KN4A 1EQKA 1N5PA 1V74A 1FGMA 2MF7A 3JUNA 1E97A 1O7HB 3FG3A 4R9KA 2CFGA 2D42A 1OGZA 4ORLA 5ELUA 2OOVA 5LC7A 4HM0B 1A2VA 1NDOB 3VGNA 2P0XA 2CKFB 3STDA 3UL6A 1UI8A 2BMQB 1IK3A 1JV2B 4NREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0R A;  1IV7 A;  1DVC A;  1WNH A;  2W9P A;  5LC6 A;  1G96 A;  1IV9 A;  4N6N B;  3PYJ A;  1N5H A;  4IT7 A;  4CCV A;  4N6L A;  3SVA A;  1LXE A;  4N6O B;  1GD3 A;  1R4C A;  1CEW I;  3NX0 A;  1KWI A;  2O9U X;  1ROA A;  1GD4 A;  1STF I;  1A67 A;  3Q2P A;  4EYC A;  1NB5 I;  1PFP A;  3LH4 A;  1N9J A;  2CH9 A;  3UL5 A;  2KXG A;  4N6V 0;  5EQL A;  3IMA B;  2OCT A;  3KFQ C;  1A90 A;  3MWZ A;  2W9Q A;  4N6U A;  1FA3 A;  2BO9 B;  4TX4 A;  3K9M C;  3QRD A;  3GAX A;  1MOL A;  1DVD A;  3KSE D;  4ZM8 A;  3PS8 A;  1CYV A;  1M9G A;  1CYU A;  1TIJ A;  4LZI A;  1FUW A;  1MNL A;  1EQK A;  1NB3 I;  1N5P A;  5ELJ A;  4N6M A;  1RN7 A;  3S67 A;  4N6T A;  5ELU A;  5LC7 A;  1YVB I;  3PXM A;  5A0O B;  3UL6 A; 
#chains in the Genus database with same CATH topology
 1IU7 A;  1E3V A;  4L7K A;  1RDS A;  2P38 A;  1IV7 A;  5D83 A;  1WNH A;  1VQ5 3;  1GMQ A;  2IUJ A;  1O7W B;  2W9P A;  2WGO A;  3KSP A;  3FZW A;  3EX9 A;  2B1X B;  1IQX A;  5LC6 A;  3EN8 A;  4Q53 A;  2K54 A;  2QA4 3;  1BAO A;  2XFT A;  5EVH A;  2HMO B;  1M1K 4;  3DUK A;  1GYB A;  4RNT A;  3B8L A;  1UCK A;  3ZFZ A;  3CCV 3;  1JB5 A;  4PEJ A;  2BT3 A;  1YVS A;  1LXE A;  1RGA A;  1BSC A;  3G16 A;  4LGQ A;  1RN1 A;  5G1K A;  3CCL 3;  1VQL 3;  1VQ7 3;  1PY3 A;  2HMN B;  2K3D A;  2PZV A;  2WO0 A;  3CMA 3;  2ML5 A;  1CEW I;  1I8V A;  1OAC A;  3F8X A;  4MMX B;  2IA7 A;  5IG0 A;  3SYU A;  1ULJ B;  3N54 B;  5CF2 A;  3DM8 A;  5JBS A;  1GD4 A;  1NO3 A;  3LYG A;  3D4A A;  3OX9 A;  1RGL A;  5IEP A;  2C10 A;  2OQE C;  3WOF B;  3LT8 A;  2V1L A;  3LTB A;  1OHS A;  1PFP A;  3LTA A;  1W00 A;  4FMD A;  3PCS A;  2HML B;  5M1A A;  3NXJ A;  1JNQ A;  2KXG A;  2JDI H;  5DRE A;  3AGN A;  3WR2 A;  1D6Z A;  4JF8 A;  3AHS A;  4CJN A;  4FCM A;  4HYZ A;  3PCR A;  2RBI A;  1BNJ A;  3CCU 3;  1W2Z A;  1Q40 A;  1X1X A;  2OWP A;  2Y73 A;  4LMI A;  2W9Q A;  1RTU A;  2E2U A;  3HOH A;  1RLS A;  1RSN A;  4KZ1 A;  2BNG A;  2W56 A;  1BSB A;  1B2Z A;  4N6U A;  2IYJ A;  3V98 A;  4BL3 A;  3PGB A;  1DMQ A;  4TX4 A;  5KP4 A;  4O8S A;  4WP5 A;  5IG5 A;  2B24 B;  2OTL 3;  1B21 A;  1C54 A;  3JUM A;  5EEO A;  4LYL B;  1Q7H A;  4CPK A;  3GZY B;  1Q42 A;  2GSP A;  1UCI A;  2WGQ A;  4FMB A;  1QVG 2;  5JPP A;  2W2C A;  4IPB A;  3CC7 3;  3S28 A;  1BUJ A;  1DVD A;  3F7S A;  4LEH A;  2CFD A;  4ZM8 A;  1B20 A;  2F5M A;  1OUN A;  1EKM A;  1FGO A;  1OCV A;  1IVX A;  2XFS A;  3BIR A;  1W6G A;  2UUG C;  3BB9 A;  3F14 A;  3F8H A;  2BHM A;  5DRV A;  2INX A;  4LZI A;  1B2U A;  2XEP A;  3DGL A;  4HAA A;  1FUW A;  1MNL A;  3X41 A;  3UB1 A;  4HBR A;  3IJE B;  3HK4 A;  3CXC 2;  2GXF A;  2H0I A;  4HKV B;  3CCE 3;  1LRA A;  1ZX2 A;  1BRG A;  2WOH A;  4GHO A;  1T5Y A;  5BIR A;  3MYT A;  3FG4 A;  5GSP A;  3LT9 A;  1BUQ A;  5M18 A;  1RRH A;  2CFL A;  2GU3 A;  2XH9 A;  4I5Q A;  2FGT A;  4WFO A;  5STD A;  3FSD A;  4K90 B;  1VQN 3;  1ISK A;  1WMP A;  1Q40 B;  1CQS A;  2CFW A;  1BU4 A;  4J5G A;  3WA2 X;  3TDG A;  1BNI A;  4HOH A;  1G0T A;  1MWT A;  4RZM A;  4HM2 B;  2GBX B;  2W56 B;  2STD A;  3NM7 A;  5BU4 A;  2BU4 A;  1YI2 3;  2F86 B;  4HM6 B;  1V58 A;  4J8T A;  1J2B A;  4J9A A;  4X2O A;  1FGT A;  1YIT 3;  2QEX 3;  1D6Y A;  4MMZ B;  4BTY A;  4L8P A;  3EJV A;  1OH0 A;  5D82 A;  1IQ8 A;  1ZS7 A;  1U5O A;  3CPO A;  5FW5 A;  5I97 A;  5HGR A;  4FMC A;  2F4Y A;  3DXO A;  3JUP A;  2FNQ A;  4J5K A;  3HZP A;  1GMR A;  1V57 A;  5IW9 A;  1Q9E A;  3WHO A;  1G96 A;  1EA2 A;  2A15 A;  4R9L A;  1O7P B;  1HYF A;  1S72 3;  2GU1 A;  4N6N B;  1U8C B;  1IDP A;  3PYJ A;  3S29 A;  1AVL A;  1WQL B;  1I0V A;  1QAL A;  2R41 A;  1DET A;  2CG0 A;  3Q1C A;  2CG1 A;  3VSY A;  3V99 A;  1K73 4;  2I9W A;  2CX0 A;  1B2S A;  2F5W A;  5TGN A;  4N6L A;  1FYS A;  2BMR B;  8RNT A;  1QAK A;  4N6O B;  3D79 A;  3F7X A;  4HM8 B;  1W2B 2;  4LSO A;  4WHA A;  1IQY A;  1LOX A;  3URP A;  1YNV X;  1JZO A;  7GSP A;  2XSO B;  2LYX A;  4HZ9 B;  1QMA A;  1KWI A;  1YHQ 3;  1MWR A;  3FLJ A;  2UX0 A;  1PYL A;  3DGM A;  2F98 A;  3HI7 A;  3X3X A;  1KD1 4;  3X3Y A;  3N8B A;  2CWU A;  1BOX A;  3ROB A;  1A67 A;  2QIY A;  4HM1 B;  4K1V A;  4X2H A;  3Q2P A;  2AAD A;  2HMK B;  1X1W A;  1JBT A;  3GZR A;  1NB5 I;  3CNM A;  1Q7Y 4;  1N9J A;  1SPU A;  1EG9 B;  2CH9 A;  3LZA A;  4N6V 0;  3I0Y A;  1W02 A;  3F9S A;  1AVK A;  2HMJ B;  1BNS A;  4H3U A;  1RMS A;  2CX1 A;  4H61 A;  1RGC A;  1SII A;  3N9H A;  3OWY A;  6GSP A;  5IER A;  1DYU A;  1JZD A;  1VQK 3;  4HM5 B;  3I55 3;  1SAR A;  1YGE A;  3E99 A;  1STD A;  1TU5 A;  3DGY A;  2XSH B;  1FUS A;  3DZL A;  3NUV A;  1T3B A;  2H0H A;  4HM7 B;  4K61 A;  1FA3 A;  3DGO A;  2BO9 B;  1O7N B;  1S5A A;  4XBY A;  5AI1 A;  3H51 A;  3CCS 3;  4AKZ A;  1Q86 4;  4R4K A;  1IT7 A;  5AIG A;  1CH0 A;  2KF6 A;  3GAX A;  1PU4 A;  2RSX A;  1MOL A;  1QJG A;  3RGA A;  3Q90 A;  2KF5 A;  1BNF A;  1L5G B;  4MEI A;  1RGF A;  1YJN 3;  3JVC A;  7RNT A;  2XGN A;  1BAN A;  1ASK A;  1Q82 4;  3ZG5 A;  1NU3 A;  2GEX A;  3PS8 A;  3K63 A;  1OHO A;  4KT3 B;  4DKI A;  1BRS A;  3HX8 A;  1CYU A;  6RNT A;  3FKA A;  1TFO A;  1TIJ A;  1W4N A;  1TTO A;  4I4K A;  1N9E A;  4GB5 A;  1AQZ A;  4XBX A;  1KSI A;  3FF0 A;  1K28 A;  4HVN A;  3FGY A;  2E2T A;  3JUQ A;  1RGH A;  5AEU B;  1RHL A;  2W03 A;  1M90 4;  2FXT A;  1MGR A;  4AKY A;  1LOY A;  1RN7 A;  3CCM 3;  3G0K A;  5FGO A;  3SX1 A;  5CF1 A;  4XM4 A;  1TUH A;  1RRL A;  4FCJ A;  4XDV A;  1B2M A;  2H0G A;  3DMC A;  3D9R A;  2K0M A;  4N3V A;  1FGQ A;  4N6T A;  1ZO2 A;  2RCD A;  2E2V A;  3T0U A;  2CFK A;  3PXM A;  1O7G B;  1M1X B;  1LNI A;  3BNB A;  4G1M B;  4STD A;  5A0O B;  6STD A;  2YX9 A;  4U13 A;  5G2G A;  3SXX A;  3CU3 A;  4HM3 B;  2KCD A;  3SOA A;  1UCL A;  3L0R A;  1W5Z A;  2P09 A;  1RJO A;  3EB8 A;  3NBR A;  1BNE A;  3NV0 A;  2IY2 A;  1UUG B;  3DGN A;  3H3H A;  3A76 A;  3GWR A;  1B3S A;  4O2H A;  3JUO A;  1JJ2 2;  1IV9 A;  1UI7 A;  4FCZ A;  3WOE B;  5JPU A;  2OQE A;  3T8U A;  1MGW A;  1VQ9 3;  2O3O A;  5HOH A;  3AGO A;  1N5H A;  1TRP A;  7STD A;  3GZX B;  1LOV A;  1DMN A;  1TRQ A;  2OOV C;  2YFI B;  4FR9 A;  2ZL8 A;  4CCV A;  4BU4 A;  3LOY A;  5AIH A;  3SVA A;  1UUV B;  2MC8 A;  4OUQ A;  1GD3 A;  3EHC A;  8CHO A;  1B2X A;  2L1S A;  1RCK A;  2HMM B;  2IUK A;  1IYY A;  1R4C A;  1ZGX A;  3CCR 3;  1YJ9 3;  1GY6 A;  1BSA A;  4RNZ A;  3GZB A;  2F56 A;  1RN4 A;  3QK9 A;  1Q81 4;  1ROV A;  3BNE A;  1BRH A;  4XDW A;  1ROA A;  2JQ5 A;  3SLU A;  1NNV A;  3CPW 2;  1N8R 4;  1BNR A;  1SQW A;  2W04 A;  1STF I;  4NHF A;  3EBY A;  3NQZ A;  1UW1 A;  3GSP A;  5IF6 A;  4KFE A;  1UGI A;  2KAA A;  4EBG A;  9RNT A;  1VQM 3;  3S5C A;  1YIJ 3;  1O7M B;  3GRD A;  1JB4 A;  3LH4 A;  2UGI A;  2Z7A A;  4FMA A;  1HU9 A;  1IVW A;  3UL5 A;  1C7H A;  4CDL A;  3OV4 A;  2XF3 A;  3IMA B;  2CHC A;  4MJD A;  1BRK A;  2OCT A;  1IVU A;  3NBJ A;  3MSO A;  4NPB A;  3EF8 A;  3CC4 3;  3KFQ C;  1EEJ A;  4XBT A;  1ULI B;  3ZG0 A;  1A90 A;  3HIG A;  3NV0 B;  3X3Z A;  2Z77 A;  1EUI C;  2GBW B;  3KE7 A;  1D6U A;  4BTW A;  3M8C A;  3BLZ A;  1RKY A;  3ER7 A;  5AII A;  1BRJ A;  4GSP A;  3EE1 A;  1TFK A;  1Y4K A;  2CC3 A;  3A5E A;  2KRT A;  1LOW A;  3K9M C;  2Q07 A;  1US1 A;  2YFJ B;  3X40 A;  1VQ6 3;  1JBR A;  3QRD A;  2KF4 A;  4O02 B;  4BIR A;  1BNG A;  4QWT A;  3MHE A;  3I56 3;  2C4B A;  1I3F A;  4MMY B;  1WMN A;  1VQO 3;  3G4S 3;  2ZHX B;  5AIF A;  2CWV A;  3WOD G;  1BSE A;  1W01 A;  1VZZ A;  1X1Y A;  3O8Y A;  3MKI A;  4K1U A;  4EW5 A;  2LQV A;  2XGL A;  3B4O A;  5CK6 A;  2W6J H;  3G8Z A;  4WYK A;  2XR8 B;  1F8N A;  2P05 A;  1GOV A;  4EC6 A;  1AV4 A;  4R80 A;  1RNB A;  1VQ4 3;  1IVV A;  5CLK A;  4EV2 A;  3CC2 3;  4XB5 A;  1DE3 A;  3BND A;  1JRQ A;  3WDG B;  4OVM A;  5ELJ A;  4N6M A;  1W7C A;  2XRX B;  3U97 A;  3WMD A;  3CCJ 3;  1GMP A;  1RGK A;  4KFD A;  1MWS A;  3S67 A;  3CD6 3;  1GY7 A;  2IMJ A;  1BGS A;  1FGR A;  3KCH A;  1RGE A;  3FCS B;  3SED A;  4WWU C;  1N8Q A;  1QVF 2;  1OPY A;  4OK0 A;  4ILF A;  2CWT A;  4EV5 A;  1SIH A;  1YVB I;  3D3L A;  3UJM A;  1A2K A;  3WA3 A;  1WMO A;  2ML6 A;  1BRN L;  1FW7 A;  2CK3 H;  3FH1 A;  3OWS A;  1UDI I;  4L8O A;  1BIR A;  3AMO A;  3Q3F A;  3NBB A;  2PNC A;  1DVC A;  1K41 A;  1JKG A;  3D5G A;  4RBN A;  2P0M A;  2ZDJ A;  1IT8 A;  1R4Y A;  3J7Y d;  1A2P A;  2Z76 A;  4IIA A;  1BSD A;  1UGH I;  3ECF A;  1T2H A;  1OF5 A;  1LVN A;  3HII A;  1G02 A;  1Z1S A;  2RGQ A;  4KFF A;  1AY7 A;  1BRI A;  1OGX A;  1W6Y A;  4IT7 A;  3KKG A;  1K9M 4;  2AAE A;  2F99 A;  2Z6B A;  3OXA A;  4WYK B;  3LTD A;  2M7O A;  1I2E A;  3U1W A;  4R1K A;  3ALA A;  3RGR A;  2SAR A;  1VQQ A;  3B4P A;  5AEW B;  5KP3 A;  2YFL B;  3K5T A;  5IG3 A;  3K7C A;  3NX0 A;  3LML A;  1JB2 A;  3CNX A;  2O9U X;  3LTC A;  1WTH A;  3MG3 A;  3MPH A;  1AR0 A;  4HZB B;  4EYC A;  1I70 A;  3KII A;  1TJD A;  1LQG C;  2KF3 A;  3B7C A;  4O3V A;  1I0X A;  3NHX A;  2WOF A;  1GOY A;  1UCJ A;  5IEO A;  3RNT A;  4BTX A;  1K8A 4;  5AYS C;  1VQ8 3;  3BNC A;  4HJL B;  3OWU A;  4AEQ A;  5EQL A;  1VQP 3;  4JRF A;  1JN5 A;  1LNH A;  3AMO B;  3PZW A;  5BVB A;  3OW2 2;  2OTJ 3;  1NJI 4;  2R4I A;  1JKG B;  1I3I A;  3IPT A;  5M19 A;  1YGW A;  1QAF A;  2C11 A;  3K0Z A;  4KVH A;  3EQQ B;  3FG1 A;  1GY5 A;  3MWZ A;  5IG4 A;  1OF5 B;  2Y74 A;  3EBT A;  1KQS 2;  5D81 A;  1NWW A;  4BL2 A;  2D1W A;  2RFR A;  5CXO A;  5AYR B;  1FZU A;  3EC9 A;  4GL6 A;  3VF1 A;  3LXU X;  1GS3 A;  1DMM A;  1KC8 4;  3FF2 A;  1I2G A;  1TP6 A;  1UUW B;  2BIR A;  2SBL A;  5G1L A;  3MG2 A;  1I2F A;  2GEY A;  3X42 A;  1HKX A;  2ZA4 A;  1YJW 3;  3UNL A;  1T2I A;  2RNT A;  3SOY A;  1GSP A;  3KSE D;  1MWU A;  3NQY A;  3G6E 3;  3CCQ 3;  3T8N A;  1OHP A;  1RCL A;  5KP1 A;  1CYV A;  1SJW A;  1FUT A;  1M9G A;  3AHW A;  3MG1 A;  3DH2 A;  1E3R A;  3F40 A;  3KZT A;  4EXR A;  1W6C A;  5RNT A;  2L4V A;  3G71 3;  1X1U A;  3CME 3;  3S27 A;  3EN1 B;  4RNY A;  2CIU A;  3RDE A;  5BXQ A;  3V92 A;  3BU4 A;  4HM4 B;  2BMO B;  2W0Q A;  3NM2 A;  5IEN A;  2CW9 A;  3DY5 A;  1JN5 B;  1NB3 I;  2QGU A;  3KN4 A;  1EQK A;  1N5P A;  1HZ1 A;  1V74 A;  1FGM A;  2MF7 A;  3JUN A;  1E97 A;  1O7H B;  1B27 A;  2HOH A;  3FG3 A;  2J8X B;  4R9K A;  2CFG A;  2D42 A;  1GOU A;  1OGZ A;  4ORL A;  5ELU A;  1RNT A;  2OOV A;  5LC7 A;  4HM0 B;  3D5I A;  1A2V A;  1NDO B;  1RGG A;  3VGN A;  1BVI A;  2P0X A;  2CKF B;  1JBS A;  3STD A;  1LQM B;  1UI8 A;  2BMQ B;  3UL6 A;  1IK3 A;  1JV2 B;  4NRE A; 
#chains in the Genus database with same CATH homology
 1IU7 A;  1E3V A;  4L7K A;  2P38 A;  1IV7 A;  5D83 A;  1WNH A;  1VQ5 3;  2IUJ A;  1O7W B;  2W9P A;  2WGO A;  3KSP A;  3FZW A;  3EX9 A;  2B1X B;  1IQX A;  5LC6 A;  3EN8 A;  4Q53 A;  2K54 A;  2QA4 3;  2XFT A;  5EVH A;  2HMO B;  1M1K 4;  3DUK A;  1GYB A;  3B8L A;  3CCV 3;  1JB5 A;  4PEJ A;  2BT3 A;  1LXE A;  3G16 A;  4LGQ A;  3CCL 3;  1VQL 3;  1VQ7 3;  2HMN B;  2PZV A;  2WO0 A;  3CMA 3;  2ML5 A;  1CEW I;  1OAC A;  3F8X A;  4MMX B;  2IA7 A;  5IG0 A;  1ULJ B;  3N54 B;  5CF2 A;  3DM8 A;  5JBS A;  1GD4 A;  1NO3 A;  3LYG A;  3OX9 A;  5IEP A;  2C10 A;  2OQE C;  3WOF B;  3LT8 A;  2V1L A;  3LTB A;  1OHS A;  1PFP A;  3LTA A;  1W00 A;  4FMD A;  3PCS A;  2HML B;  3NXJ A;  1JNQ A;  2KXG A;  2JDI H;  5DRE A;  1D6Z A;  4JF8 A;  4FCM A;  4HYZ A;  3PCR A;  3CCU 3;  1W2Z A;  1Q40 A;  2OWP A;  2Y73 A;  4LMI A;  2W9Q A;  2E2U A;  4KZ1 A;  4N6U A;  2BNG A;  2W56 A;  3V98 A;  3PGB A;  1DMQ A;  4TX4 A;  5KP4 A;  4O8S A;  4WP5 A;  5IG5 A;  2B24 B;  2OTL 3;  3JUM A;  5EEO A;  3GZY B;  1Q42 A;  4FMB A;  1QVG 2;  2WGQ A;  1DVD A;  5JPP A;  2W2C A;  4IPB A;  3CC7 3;  3S28 A;  3F7S A;  4LEH A;  2CFD A;  4ZM8 A;  1OUN A;  1EKM A;  1FGO A;  1OCV A;  1IVX A;  2XFS A;  3F14 A;  1W6G A;  3BB9 A;  3F8H A;  2BHM A;  5DRV A;  2INX A;  4LZI A;  2XEP A;  3DGL A;  1FUW A;  1MNL A;  3X41 A;  3UB1 A;  4HBR A;  3IJE B;  3HK4 A;  3CXC 2;  2GXF A;  4HKV B;  3CCE 3;  1ZX2 A;  2WOH A;  1T5Y A;  3MYT A;  3FG4 A;  3LT9 A;  1BUQ A;  1RRH A;  2CFL A;  2GU3 A;  2XH9 A;  2FGT A;  4WFO A;  5STD A;  3FSD A;  4K90 B;  1VQN 3;  1ISK A;  1WMP A;  1Q40 B;  1CQS A;  2CFW A;  3WA2 X;  3TDG A;  4RZM A;  1YI2 3;  4HM2 B;  2GBX B;  2W56 B;  2STD A;  3NM7 A;  2F86 B;  4HM6 B;  4J8T A;  1J2B A;  4J9A A;  4X2O A;  1FGT A;  1YIT 3;  2QEX 3;  1D6Y A;  4MMZ B;  4BTY A;  4L8P A;  3EJV A;  1OH0 A;  5D82 A;  1IQ8 A;  1U5O A;  3CPO A;  5FW5 A;  5I97 A;  5HGR A;  4FMC A;  3DXO A;  3JUP A;  2FNQ A;  3HZP A;  5IW9 A;  1G96 A;  1EA2 A;  2A15 A;  4R9L A;  1O7P B;  1S72 3;  2GU1 A;  4N6N B;  1U8C B;  1IDP A;  3PYJ A;  3S29 A;  1AVL A;  1WQL B;  1QAL A;  3X3Z A;  2CG0 A;  3Q1C A;  2CG1 A;  3VSY A;  3V99 A;  1K73 4;  2I9W A;  5TGN A;  3CCM 3;  4N6L A;  2BMR B;  1QAK A;  4N6O B;  1W2B 2;  3F7X A;  4HM8 B;  4LSO A;  4WHA A;  1IQY A;  1LOX A;  2XSO B;  2LYX A;  4HZ9 B;  1QMA A;  1KWI A;  1YHQ 3;  3FLJ A;  2UX0 A;  3DGM A;  2F98 A;  3HI7 A;  3X3X A;  1KD1 4;  3X3Y A;  3N8B A;  2CWU A;  3ROB A;  1A67 A;  2QIY A;  4HM1 B;  4K1V A;  4X2H A;  3Q2P A;  2HMK B;  3GZR A;  1NB5 I;  3CNM A;  1Q7Y 4;  1N9J A;  1SPU A;  1EG9 B;  2CH9 A;  3LZA A;  4N6V 0;  3I0Y A;  1W02 A;  3F9S A;  1AVK A;  2HMJ B;  4H3U A;  4H61 A;  1SII A;  3N9H A;  3OWY A;  5IER A;  1VQK 3;  1DYU A;  4HM5 B;  3I55 3;  1YGE A;  3E99 A;  1STD A;  1TU5 A;  2XSH B;  3DZL A;  3NUV A;  4HM7 B;  4K61 A;  1FA3 A;  3DGO A;  2BO9 B;  1O7N B;  1S5A A;  4XBY A;  5AI1 A;  3H51 A;  3CCS 3;  4AKZ A;  1Q86 4;  4R4K A;  1IT7 A;  5AIG A;  3GAX A;  1PU4 A;  2RSX A;  1MOL A;  1QJG A;  3RGA A;  3Q90 A;  1L5G B;  4MEI A;  1YJN 3;  3JVC A;  2XGN A;  1ASK A;  1Q82 4;  1NU3 A;  2GEX A;  3PS8 A;  3K63 A;  1OHO A;  3HX8 A;  1CYU A;  3FKA A;  1TFO A;  1TIJ A;  1W4N A;  4I4K A;  1N9E A;  4GB5 A;  4XBX A;  1KSI A;  3FF0 A;  1K28 A;  4HVN A;  3FGY A;  2E2T A;  3JUQ A;  5AEU B;  2W03 A;  1M90 4;  2FXT A;  4AKY A;  1RN7 A;  3G0K A;  5FGO A;  3SX1 A;  5CF1 A;  4XM4 A;  1TUH A;  1RRL A;  4FCJ A;  4XDV A;  3DMC A;  3D9R A;  2K0M A;  4N3V A;  1FGQ A;  4N6T A;  1ZO2 A;  2RCD A;  2E2V A;  3T0U A;  2CFK A;  3PXM A;  1O7G B;  1M1X B;  3BNB A;  5A0O B;  4G1M B;  4STD A;  6STD A;  2YX9 A;  4U13 A;  5G2G A;  3SXX A;  3CU3 A;  4HM3 B;  2KCD A;  3SOA A;  3L0R A;  1W5Z A;  2P09 A;  1RJO A;  3EB8 A;  3NBR A;  3NV0 A;  3H3H A;  3DGN A;  1JJ2 2;  3A76 A;  3GWR A;  4O2H A;  3JUO A;  1IV9 A;  1UI7 A;  4FCZ A;  3WOE B;  5JPU A;  2OQE A;  3T8U A;  1VQ9 3;  2O3O A;  1N5H A;  7STD A;  3GZX B;  2OOV C;  1DMN A;  2YFI B;  4FR9 A;  2ZL8 A;  4CCV A;  3LOY A;  5AIH A;  3SVA A;  1UUV B;  2MC8 A;  4OUQ A;  1GD3 A;  3EHC A;  8CHO A;  2HMM B;  2IUK A;  1R4C A;  1YJ9 3;  3CCR 3;  1GY6 A;  4RNZ A;  3GZB A;  3QK9 A;  1Q81 4;  1ROV A;  3BNE A;  4XDW A;  1ROA A;  2JQ5 A;  3SLU A;  3CPW 2;  1N8R 4;  1SQW A;  2W04 A;  1STF I;  4NHF A;  3EBY A;  3NQZ A;  1UW1 A;  5IF6 A;  4KFE A;  4EBG A;  1VQM 3;  3S5C A;  1YIJ 3;  1O7M B;  3GRD A;  1JB4 A;  3LH4 A;  2Z7A A;  4FMA A;  1HU9 A;  1IVW A;  3UL5 A;  1C7H A;  4CDL A;  3OV4 A;  2XF3 A;  3IMA B;  2CHC A;  4MJD A;  2OCT A;  1IVU A;  3NBJ A;  3MSO A;  3CC4 3;  3EF8 A;  3KFQ C;  4XBT A;  1ULI B;  1A90 A;  3HIG A;  3NV0 B;  2Z77 A;  2GBW B;  3KE7 A;  1D6U A;  4BTW A;  3M8C A;  3BLZ A;  1RKY A;  3ER7 A;  5AII A;  3EE1 A;  1TFK A;  1Y4K A;  2CC3 A;  2KRT A;  3K9M C;  2Q07 A;  1US1 A;  2YFJ B;  3X40 A;  1VQ6 3;  3QRD A;  4O02 B;  4QWT A;  3MHE A;  3I56 3;  4MMY B;  1WMN A;  1VQO 3;  3G4S 3;  5AIF A;  3WOD G;  2CWV A;  1W01 A;  1VZZ A;  3O8Y A;  3MKI A;  4K1U A;  2LQV A;  2XGL A;  3B4O A;  5CK6 A;  2W6J H;  3G8Z A;  4WYK A;  2XR8 B;  1F8N A;  2P05 A;  4EC6 A;  1VQ4 3;  1AV4 A;  4R80 A;  1IVV A;  5CLK A;  4EV2 A;  3CC2 3;  4XB5 A;  3BND A;  1JRQ A;  3WDG B;  4OVM A;  5ELJ A;  4N6M A;  1W7C A;  2XRX B;  3U97 A;  3WMD A;  3CCJ 3;  3S67 A;  4KFD A;  3CD6 3;  1GY7 A;  2IMJ A;  1FGR A;  3FCS B;  3SED A;  4WWU C;  1N8Q A;  1QVF 2;  1OPY A;  4OK0 A;  2CWT A;  4EV5 A;  1SIH A;  1YVB I;  3D3L A;  3UJM A;  1A2K A;  3WA3 A;  1WMO A;  2ML6 A;  2CK3 H;  3FH1 A;  3OWS A;  4L8O A;  3AMO A;  3NBB A;  2PNC A;  1DVC A;  1K41 A;  1JKG A;  4RBN A;  2P0M A;  2ZDJ A;  1IT8 A;  3J7Y d;  2Z76 A;  4IIA A;  3ECF A;  1OF5 A;  1LVN A;  3HII A;  1Z1S A;  2RGQ A;  4KFF A;  1OGX A;  1W6Y A;  4IT7 A;  3KKG A;  1K9M 4;  2F99 A;  2Z6B A;  3OXA A;  4WYK B;  3LTD A;  2M7O A;  3U1W A;  4R1K A;  3ALA A;  3RGR A;  3B4P A;  5AEW B;  5KP3 A;  2YFL B;  3K5T A;  5IG3 A;  3K7C A;  3NX0 A;  3LML A;  1JB2 A;  3CNX A;  2O9U X;  3LTC A;  1WTH A;  3MG3 A;  3MPH A;  1AR0 A;  4HZB B;  4EYC A;  3KII A;  3B7C A;  4O3V A;  3NHX A;  5IEO A;  2WOF A;  4BTX A;  1K8A 4;  5AYS C;  1VQ8 3;  3BNC A;  4HJL B;  3OWU A;  4AEQ A;  5EQL A;  1VQP 3;  4JRF A;  1JN5 A;  1LNH A;  3AMO B;  3PZW A;  5BVB A;  3OW2 2;  2OTJ 3;  1NJI 4;  2R4I A;  1JKG B;  3IPT A;  1QAF A;  2C11 A;  3K0Z A;  4KVH A;  3EQQ B;  3FG1 A;  1GY5 A;  3MWZ A;  5IG4 A;  1OF5 B;  2Y74 A;  3EBT A;  1KQS 2;  5D81 A;  1NWW A;  2D1W A;  2RFR A;  5CXO A;  5AYR B;  3EC9 A;  4GL6 A;  3VF1 A;  3LXU X;  1GS3 A;  1DMM A;  1KC8 4;  3FF2 A;  1TP6 A;  1UUW B;  2SBL A;  3MG2 A;  2GEY A;  3X42 A;  1HKX A;  1YJW 3;  3UNL A;  3SOY A;  3KSE D;  3NQY A;  3G6E 3;  3CCQ 3;  3T8N A;  1OHP A;  5KP1 A;  1CYV A;  1SJW A;  3MG1 A;  1M9G A;  1E3R A;  3F40 A;  3KZT A;  4EXR A;  1W6C A;  2L4V A;  3G71 3;  3CME 3;  3S27 A;  3EN1 B;  4RNY A;  2CIU A;  3RDE A;  5BXQ A;  3V92 A;  4HM4 B;  2BMO B;  2W0Q A;  3NM2 A;  5IEN A;  2CW9 A;  3DY5 A;  1JN5 B;  1NB3 I;  2QGU A;  3KN4 A;  1EQK A;  1N5P A;  1V74 A;  1FGM A;  2MF7 A;  3JUN A;  1E97 A;  1O7H B;  3FG3 A;  4R9K A;  2CFG A;  2D42 A;  1OGZ A;  4ORL A;  5ELU A;  2OOV A;  5LC7 A;  4HM0 B;  1A2V A;  1NDO B;  3VGN A;  2P0X A;  2CKF B;  3STD A;  3UL6 A;  1UI8 A;  2BMQ B;  1IK3 A;  1JV2 B;  4NRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...