3SVAA

Crystal structure of v57d mutant of human cystatin c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIDAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Structural characterization of V57D and V57P mutants of human cystatin C, an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3svaA00
1IV7A 1LXEA 1GD4A 1N5HA 1N5PA 4CCVA 1CEWI 3KFQC 3KSED 1PFPA 5LC6A 3QRDA 3UL6A 1R4CA 4LZIA 1STFI 5A0OB 3PXMA 2O9UX 4N6V0 1KWIA 5ELUA 3LH4A 1TIJA 2OCTA 3UL5A 1M9GA 3IMAB 2W9QA 3SVAA 1MOLA 4IT7A 1CYUA 2BO9B 4N6LA 1YVBI 1ROAA 1N9JA 2W9PA 1DVCA 1FA3A 3S67A 5LC7A 4N6NB 5ELJA 1FUWA 1IV9A 3K9MC 3GAXA 4EYCA 1DVDA 4N6OB 1NB5I 3MWZA 3PYJA 1RN7A 3NX0A 3L0RA 4N6UA 5EQLA 4N6MA 1G96A 1MNLA 1A67A 1CYVA 4ZM8A 1EQKA 2KXGA 4TX4A 1WNHA 3Q2PA 4N6TA 1NB3I 1A90A 2CH9A 1GD3A 3PS8A
chains in the Genus database with same CATH superfamily
2E2VA 1IV7A 2K54A 4RZMA 3D4AA 4WYKB 1N5HA 3S28A 5IF6A 1N5PA 3JUQA 1NO3A 1Q40A 2YFLB 5KP3A 2E2UA 2OOVC 4CJNA 5M1AA 2V1LA 1W6YA 3STDA 1TJDA 3KSED 1MWSA 4GSPA 3WR2A 1YJN3 9RNTA 4GHOA 5D81A 1RGGA 3DMCA 1JB4A 1OGZA 1B2SA 4H61A 5TGNA 3UL6A 3X3YA 1FUSA 3CCE3 3SLUA 1GY6A 3EB8A 3J7Yd 1Q814 3EHCA 1RMSA 2K3DA 3MG1A 1RGFA 1Q7Y4 1RGEA 1GYBA 3CMA3 3UNLA 5IG4A 1B2UA 1KWIA 3LH4A 4O02B 1RRLA 2BIRA 5CK6A 3JUOA 3U1WA 1LQGC 1GOVA 3A5EA 1RHLA 2H0GA 3DXOA 3NM2A 2CFKA 1BAOA 5IW9A 1JB5A 2F98A 3URPA 2ML5A 2BMOB 2W9QA 4XBXA 1VQP3 1ZGXA 1I3IA 4QWTA 3SVAA 1OF5A 3WA3A 5M18A 5IEOA 3DZLA 3G16A 4IIAA 1AV4A 1ISKA 1IDPA 4IT7A 2K0MA 5G1LA 1VQ93 1IYYA 5KP4A 1TRPA 1I0VA 1MGRA 1UCJA 1Q42A 3EJVA 2HMOB 4N6LA 4NREA 5KP1A 1QAFA 1WTHA 1VQ73 3D3LA 1LOWA 4XB5A 1LVNA 1N9JA 4LMIA 2RBIA 1BRHA 2PZVA 1GMQA 3EN1B 3CNXA 1LRAA 4MEIA 1DMNA 3F8HA 3N9HA 2WGOA 3N8BA 5CXOA 3NQZA 5G1KA 3CCM3 2W9PA 5AIHA 2HMLB 4MMZB 1JKGA 3DGYA 3F14A 1Y4KA 3S67A 4BTXA 2JDIH 7GSPA 2F5MA 4DKIA 5ELJA 1IQXA 1FUWA 1BRNL 2W6JH 3GAXA 4MMXB 3JVCA 1CH0A 1BGSA 1BRKA 1DVDA 3K0ZA 3MG2A 3MKIA 4ORLA 3OV4A 2GXFA 4KFEA 1RGCA 1N8R4 1RN7A 1O7WB 1DYUA 3NX0A 5RNTA 2KAAA 2IUJA 1TTOA 1YVSA 3MPHA 1B21A 3ROBA 5CF1A 3I553 1MGWA 2CIUA 1RGAA 3I563 3U97A 3WOEB 4HM3B 1FZUA 3F8XA 2Z76A 2KRTA 2CWVA 1L5GB 1IVVA 1RKYA 1GSPA 3NXJA 4KFDA 4WHAA 1JN5A 1MNLA 1AVKA 5IEPA 1E3RA 2BHMA 3GZBA 1N9EA 4X2HA 1CYVA 4ZM8A 3JUNA 5CLKA 3LTBA 4XBYA 4HM7B 1GY7A 3NUVA 1LOYA 3CCL3 1B3SA 4N6TA 3E99A 1DE3A 1W4NA 1NB3I 3F40A 1O7MB 1KD14 1JRQA 2IMJA 2Y74A 3MHEA 4Q53A 1MWRA 4O2HA 4LYLB 2W03A 3A76A 4PEJA 2W0QA 2KF6A 1A90A 1GD3A 3PS8A 1B27A 3X41A 3FZWA 1EG9B 3SXXA 3AGOA 2UUGC 3MYTA 3UJMA 1ULJB 4WYKA 4HM0B 1LXEA 2RSXA 1GD4A 2XF3A 1UCLA 1RN4A 2CWUA 1AR0A 2QGUA 2W56A 2C11A 4FR9A 3SX1A 4WWUC 3AMOA 1Q7HA 1W5ZA 3T8UA 1YHQ3 1SARA 4ILFA 1BRJA 2WO0A 1NJI4 1YIT3 1FYSA 1DMMA 1QALA 3KZTA 2CFDA 2CG1A 5HGRA 3F7XA 4LEHA 1R4CA 1I2EA 3FCSB 3ZFZA 3MSOA 4STDA 5A0OB 5FW5A 1VZZA 1I3FA 1BNGA 3HIIA 1U8CB 1YI23 2B24B 3PCRA 4N6V0 3HI7A 2H0HA 2GEYA 3EX9A 2BU4A 5ELUA 1RSNA 2CFWA 4EV5A 1TU5A 2L1SA 1TIJA 1BNJA 2OCTA 2XR8B 2INXA 1UI7A 1TUHA 1A2VA 2IA7A 2KF3A 2R41A 3NHXA 1BNEA 2QIYA 3HX8A 3PZWA 2OTL3 4K1VA 3NV0A 4LGQA 1M1K4 1Z1SA 4FCZA 2HMNB 1E3VA 1FGOA 7STDA 1BRGA 1CYUA 1SIIA 2C4BA 8RNTA 1RGLA 1UCKA 1RGKA 2XFTA 1S723 1UI8A 2GEXA 2OOVA 1SIHA 2HMJB 3RNTA 1BRIA 1NNVA 4AKZA 1JZOA 1W00A 1VQM3 2F4YA 3LMLA 1NDOB 1FGMA 2HMMB 1VQL3 1BNSA 3BNCA 1DVCA 5STDA 3FH1A 1WQLB 2KF4A 3IPTA 3OX9A 1BNFA 2BMRB 1HU9A 3AHSA 2CW9A 2WOHA 3GZXB 4L8OA 1KC84 4HM5B 3X42A 4J5GA 1UGIA 2HMKB 4K1UA 1FW7A 2Q07A 4J9AA 1LOVA 2CX0A 1BANA 2BT3A 2OWPA 2MF7A 4NPBA 2M7OA 3LXUX 1YGWA 3PCSA 3DGOA 4N6OB 3HZPA 1RCKA 1O7GB 5EEOA 1FGQA 2CC3A 3CCU3 5AYSC 5BXQA 2IYJA 3B7CA 3WODG 3VF1A 3L0RA 4O3VA 1RLSA 3BNEA 1RJOA 3CME3 3FSDA 4CDLA 3V92A 1V74A 1LNIA 3Q1CA 1N8QA 4I5QA 1QVG2 1Q824 5EQLA 4N6MA 1B2ZA 1G96A 2F86B 1X1WA 5DRVA 1ZO2A 3X40A 1JBTA 5D83A 2AADA 3H3HA 3G713 4JRFA 1TFOA 4R1KA 1V57A 1JV2B 2P0MA 3CXC2 1I8VA 1EQKA 3NBBA 3X3XA 3N54B 4EC6A 1RTUA 3SEDA 4HVNA 3LYGA 3B8LA 1E97A 1GMPA 2I9WA 2WOFA 3Q2PA 3KN4A 3VGNA 1JBSA 3GRDA 3GZRA 3ER7A 3ZG5A 1BUJA 1SPUA 1UDII 3OXAA 2ZA4A 1VQ83 1VQ53 4MJDA 1OUNA 4RNTA 2Z7AA 3LOYA 3CD63 3HOHA 2RCDA 1VQQA 1U5OA 1BIRA 1IT7A 1W2ZA 3BNBA 2FXTA 5BU4A 5CF2A 2A15A 1W01A 1EA2A 4HKVB 2XRXB 5D82A 8CHOA 4K90B 3FG4A 7RNTA 3Q3FA 2OTJ3 1O7NB 1OF5B 3ECFA 5AEUB 5HOHA 3VSYA 1V58A 4AEQA 2OQEC 5IG5A 4IPBA 1OHOA 1ROVA 2FGTA 4HZ9B 4HZBB 3EC9A 2XEPA 3QRDA 2LQVA 1M904 3FGYA 4BIRA 2UGIA 4LZIA 1KSIA 2CFGA 4OVMA 1IK3A 3NBRA 1CQSA 2CG0A 3PXMA 3S27A 4BTWA 4I4KA 4KFFA 2YX9A 2GU1A 3I0YA 3K7CA 1IVWA 3OW22 3CCR3 1OPYA 1OHSA 2C10A 1W6GA 3FG3A 2Z77A 1VQ43 3BIRA 1M9GA 2W04A 4EV2A 3FF0A 1JKGB 6RNTA 1F8NA 3IMAB 3OWUA 1K8A4 3CPOA 1IU7A 1OCVA 3H51A 1T3BA 4HAAA 5AIFA 4FMBA 4EBGA 5IG0A 3ZG0A 3RGAA 1LNHA 1B2XA 3B4OA 1FUTA 2YFIB 4HM4B 3T0UA 2BO9B 1W2B2 1S5AA 1TP6A 3KCHA 4FCMA 1GMRA 4HBRA 1M1XB 1ROAA 5M19A 1WMPA 1STDA 2YFJB 4KZ1A 5G2GA 4RBNA 3K5TA 3WA2X 5GSPA 3GZYB 1JBRA 2Z6BA 4LSOA 4WP5A 2XSOB 1AY7A 2GBWB 3RDEA 1FGRA 3LT9A 2LYXA 1DMQA 4KVHA 1FA3A 1JN5B 2XGLA 5LC7A 2UX0A 1W02A 4RNYA 1X1YA 2BMQB 2XH9A 1WMOA 3G0KA 4HM6B 1YNVX 1IV9A 3DGNA 3JUPA 5IERA 1AQZA 1BOXA 1OGXA 3DUKA 2CHCA 1EKMA 2XGNA 3V99A 1BSBA 3SOYA 3JUMA 3KIIA 1RRHA 3D5IA 4HM2B 3UB1A 1SQWA 1T2HA 1VQO3 3PYJA 2P05A 2ML6A 1YIJ3 6STDA 3DM8A 2ZL8A 3T8NA 3FF2A 5AIIA 1HYFA 1LOXA 1UUWB 2XFSA 2CFLA 3K63A 3CCQ3 5JPUA 1WMNA 2AAEA 1BNRA 1MWUA 4N6UA 1K28A 2WGQA 4R4KA 3G4S3 3CC23 4XDWA 2PNCA 1YJW3 1K41A 4G1MB 2L4VA 1PYLA 3NQYA 2W56B 1US1A 2Y73A 3AHWA 4FCJA 3WDGB 3SOAA 1C7HA 3AMOB 1A67A 5AYRB 3CC43 1IT8A 3OWYA 1NU3A 2D42A 3EN8A 3SYUA 1EUIC 1Q9EA 2KXGA 1JB2A 1D6YA 2IY2A 1RDSA 3S5CA 3Q90A 1VQK3 3GSPA 4L7KA 1D6ZA 3IJEB 2GSPA 2KF5A 3MG3A 3CC73 5AIGA 3FLJA 2QA43 2F99A 3G8ZA 4HJLB 4J5KA 4HM1B 4MMYB 4BL3A 1G0TA 2GU3A 1NWWA 2SBLA 3CPW2 3BNDA 4GL6A 4FMCA 4R9LA 3M8CA 2MC8A 2RNTA 5JPPA 1RGHA 1BSDA 1QJGA 3FG1A 4CCVA 3CNMA 1PU4A 2CX1A 1CEWI 3KFQC 1Q40B 4H3UA 3O8YA 1QVF2 2GBXB 1BNIA 1B2MA 3NV0B 5FGOA 5JBSA 1MWTA 1PFPA 4O8SA 5LC6A 1RNTA 3EQQB 5AEWB 3F9SA 1BSAA 1VQ63 1JNQA 1JZDA 1UW1A 3AGNA 2W2CA 3BLZA 1K734 3LZAA 1ZS7A 1STFI 2O3OA 1ASKA 1T2IA 2CWTA 1J2BA 3PGBA 3CCS3 4BTYA 2O9UX 3LTDA 4FMDA 1OHPA 2CKFB 2BNGA 2ZDJA 2E2TA 4R80A 1RN1A 2SARA 1BSEA 3EF8A 1I2GA 1BSCA 3DH2A 5EVHA 1BVIA 3QK9A 3UL5A 1SJWA 3CCV3 1LQMB 3D9RA 4XDVA 4AKYA 1BRSA 5BVBA 2P38A 4OK0A 1IQYA 1O7HB 3OWSA 1BU4A 5IENA 1PY3A 1MOLA 1TFKA 4HYZA 1GOUA 3B4PA 3WHOA 1GY5A 3BB9A 1VQN3 3HK4A 1BUQA 3LTCA 3KSPA 1EEJA 1ZX2A 1QMAA 1I0XA 2P09A 1IQ8A 1YVBI 1AVLA 2RGQA 1DETA 2P0XA 2JQ5A 2OQEA 4GB5A 4K61A 3WOFB 1KQS2 1B20A 3KE7A 1QAKA 4RNZA 3RGRA 3D79A 1X1UA 3NM7A 1K9M4 1UUVB 2J8XB 3D5GA 5BIRA 1HZ1A 2IUKA 1IVUA 1GOYA 2R4IA 4BU4A 4HM8B 3X3ZA 4CPKA 3EBTA 4N6NB 4L8PA 2QEX3 2F5WA 1ULIB 1OH0A 3K9MC 1YJ93 1RNBA 3EE1A 1UGHI 3NBJA 1I70A 4WFOA 1HKXA 4EYCA 1X1XA 3WMDA 2F56A 1D6UA 1NB5I 3MWZA 3V98A 1TRQA 4FMAA 1UUGB 3ALAA 2KCDA 4XBTA 4J8TA 4JF8A 2STDA 3DY5A 3HIGA 1YGEA 1R4YA 3CU3A 4X2OA 2RFRA 4NHFA 1W6CA 2ZHXB 1UCIA 4HOHA 3FKAA 3LT8A 1G02A 4KT3B 4BL2A 4U13A 3G6E3 3KKGA 4EW5A 1O7PB 2FNQA 5DREA 1FGTA 5IG3A 5I97A 4N3VA 4EXRA 3CCJ3 2H0IA 3BU4A 1T5YA 3F7SA 3GWRA 4R9KA 5AI1A 1RCLA 1I2FA 3TDGA 3S29A 2HOHA 1WNHA 4TX4A 1A2KA 2D1WA 1A2PA 1IVXA 4XM4A 4OUQA 6GSPA 1JJ22 2CK3H 3EBYA 2B1XB 2XSHB 1Q864 1OACA 1W7CA 2CH9A 1C54A 3DGLA 1GS3A 3LTAA 3DGMA
chains in the Genus database with same CATH topology
2E2VA 1IV7A 2K54A 4RZMA 4WYKB 1N5HA 3S28A 5IF6A 1N5PA 3JUQA 1NO3A 1Q40A 2YFLB 5KP3A 2E2UA 2OOVC 2V1LA 1W6YA 3STDA 3KSED 1YJN3 5D81A 3DMCA 1JB4A 1OGZA 3UL6A 4H61A 5TGNA 3X3YA 3CCE3 3SLUA 1GY6A 3EB8A 3J7Yd 1Q814 3EHCA 3MG1A 1Q7Y4 1GYBA 3CMA3 3UNLA 5IG4A 1KWIA 4O02B 3LH4A 5CK6A 1RRLA 3U1WA 3JUOA 3DXOA 3NM2A 2CFKA 5IW9A 1JB5A 2F98A 2ML5A 2BMOB 2W9QA 4XBXA 1VQP3 4QWTA 3SVAA 3WA3A 1OF5A 5IEOA 3DZLA 3G16A 4IIAA 1AV4A 1ISKA 1IDPA 4IT7A 2K0MA 1VQ93 5KP4A 3EJVA 4NREA 5KP1A 1Q42A 2HMOB 4N6LA 1VQ73 1QAFA 1WTHA 3D3LA 4XB5A 1LVNA 1N9JA 4LMIA 2PZVA 3EN1B 3CNXA 4MEIA 1DMNA 3F8HA 3N9HA 2WGOA 3N8BA 5CXOA 3NQZA 3CCM3 2W9PA 5AIHA 2HMLB 4MMZB 1JKGA 3F14A 1Y4KA 3S67A 4BTXA 2JDIH 5ELJA 1IQXA 1FUWA 2W6JH 3GAXA 4MMXB 3JVCA 1DVDA 3K0ZA 3MG2A 3MKIA 4ORLA 3OV4A 2GXFA 4KFEA 1N8R4 1RN7A 1O7WB 1DYUA 3NX0A 3I553 2IUJA 3MPHA 3I563 3ROBA 5CF1A 2CIUA 3U97A 3WOEB 4HM3B 3F8XA 2Z76A 2KRTA 2CWVA 1L5GB 1IVVA 1RKYA 3NXJA 4KFDA 4WHAA 1JN5A 1MNLA 1AVKA 5IEPA 1E3RA 2BHMA 3GZBA 1N9EA 4X2HA 1CYVA 4ZM8A 3JUNA 5CLKA 3LTBA 4XBYA 4HM7B 1GY7A 3NUVA 3CCL3 4N6TA 3E99A 1W4NA 1NB3I 3F40A 1O7MB 1KD14 1JRQA 2IMJA 2Y74A 3MHEA 4Q53A 4O2HA 4PEJA 2W03A 3A76A 1A90A 2W0QA 1GD3A 3PS8A 3X41A 3FZWA 1EG9B 3SXXA 3UJMA 3MYTA 1ULJB 4WYKA 4HM0B 1LXEA 2RSXA 1GD4A 2XF3A 4FR9A 2CWUA 1AR0A 2QGUA 2W56A 2C11A 3SX1A 4WWUC 3AMOA 1W5ZA 3T8UA 1YHQ3 2WO0A 1NJI4 1YIT3 1DMMA 1QALA 3KZTA 2CFDA 2CG1A 5HGRA 3F7XA 4LEHA 1R4CA 3FCSB 3MSOA 4STDA 5A0OB 5FW5A 1VZZA 3HIIA 1U8CB 1YI23 2B24B 3PCRA 4N6V0 3HI7A 2GEYA 3EX9A 5ELUA 2CFWA 4EV5A 1TU5A 1TIJA 2OCTA 2XR8B 2INXA 1UI7A 1TUHA 1A2VA 2IA7A 3NHXA 3HX8A 2QIYA 3PZWA 2OTL3 4K1VA 3NV0A 4LGQA 1M1K4 1Z1SA 4FCZA 2HMNB 1E3VA 1FGOA 7STDA 1CYUA 1SIIA 2XFTA 1S723 1UI8A 2GEXA 2OOVA 2HMJB 1SIHA 4AKZA 1W00A 1VQM3 3LMLA 1NDOB 1FGMA 2HMMB 1VQL3 3BNCA 1DVCA 5STDA 3FH1A 1WQLB 3IPTA 3OX9A 2BMRB 1HU9A 2CW9A 2WOHA 3GZXB 4L8OA 1KC84 4HM5B 3X42A 2HMKB 4K1UA 2Q07A 4J9AA 2BT3A 2OWPA 2MF7A 2M7OA 3LXUX 3PCSA 3DGOA 4N6OB 3HZPA 1O7GB 5EEOA 1FGQA 2CC3A 3CCU3 5AYSC 5BXQA 3B7CA 3WODG 3VF1A 3L0RA 4O3VA 3BNEA 1RJOA 3CME3 3FSDA 4CDLA 3V92A 1V74A 3Q1CA 1N8QA 1QVG2 1Q824 5EQLA 4N6MA 1G96A 2F86B 5DRVA 3X40A 1ZO2A 1VQ83 5D83A 3H3HA 3G713 4JRFA 1TFOA 4R1KA 1EQKA 1JV2B 2P0MA 3CXC2 3NBBA 3X3XA 3N54B 4EC6A 3SEDA 4HVNA 3LYGA 3B8LA 1E97A 2I9WA 3Q2PA 2WOFA 3VGNA 3KN4A 3GRDA 3GZRA 3ER7A 1SPUA 3OXAA 1VQ53 4MJDA 1OUNA 2Z7AA 3LOYA 3CD63 2RCDA 1U5OA 1IT7A 3BNBA 1W2ZA 2FXTA 5CF2A 2A15A 1W01A 1EA2A 4HKVB 2XRXB 5D82A 8CHOA 4K90B 3FG4A 2OTJ3 1O7NB 1OF5B 3ECFA 5AEUB 3VSYA 4AEQA 2OQEC 5IG5A 4IPBA 1OHOA 1ROVA 2FGTA 4HZ9B 4HZBB 3EC9A 2XEPA 3QRDA 2LQVA 1M904 3FGYA 4LZIA 1KSIA 2CFGA 4OVMA 1IK3A 3NBRA 1CQSA 2CG0A 3PXMA 3S27A 4BTWA 4I4KA 4KFFA 2YX9A 2GU1A 3I0YA 3K7CA 1IVWA 3OW22 3CCR3 1OPYA 1OHSA 2C10A 1W6GA 3FG3A 2Z77A 1VQ43 1M9GA 2W04A 4EV2A 3FF0A 1JKGB 1F8NA 3IMAB 3OWUA 1K8A4 3CPOA 1IU7A 1OCVA 3H51A 5AIFA 4FMBA 4EBGA 5IG0A 3RGAA 1LNHA 3B4OA 3T0UA 2YFIB 4HM4B 2BO9B 1W2B2 1S5AA 1TP6A 4FCMA 4HBRA 1M1XB 1ROAA 1WMPA 1STDA 2YFJB 4KZ1A 5G2GA 4RBNA 3K5TA 3WA2X 3GZYB 2Z6BA 4LSOA 4WP5A 2XSOB 2GBWB 3RDEA 1FGRA 3LT9A 2LYXA 1DMQA 4KVHA 1FA3A 1JN5B 2XGLA 5LC7A 2UX0A 1W02A 4RNYA 2BMQB 2XH9A 1WMOA 3G0KA 4HM6B 1IV9A 3DGNA 3JUPA 5IERA 1OGXA 3DUKA 2CHCA 1EKMA 2XGNA 3V99A 3SOYA 3JUMA 3KIIA 1RRHA 4HM2B 3UB1A 1SQWA 1VQO3 3PYJA 2P05A 2ML6A 1YIJ3 6STDA 3DM8A 2ZL8A 3T8NA 3FF2A 5AIIA 1LOXA 1UUWB 2XFSA 2CFLA 3K63A 3CCQ3 5JPUA 1WMNA 4N6UA 1K28A 2WGQA 4R4KA 3G4S3 3CC23 4XDWA 2PNCA 1YJW3 1K41A 4G1MB 2L4VA 3NQYA 2W56B 1US1A 2Y73A 4FCJA 3WDGB 3SOAA 1C7HA 3AMOB 1A67A 5AYRB 3CC43 1IT8A 3OWYA 1NU3A 2D42A 3EN8A 2KXGA 1JB2A 1D6YA 3S5CA 3Q90A 1VQK3 4L7KA 1D6ZA 3IJEB 3CC73 3MG3A 5AIGA 3FLJA 2QA43 2F99A 3G8ZA 4HJLB 4HM1B 4MMYB 2GU3A 1NWWA 2SBLA 3CPW2 3BNDA 4GL6A 4FMCA 4R9LA 3M8CA 2MC8A 5JPPA 4CCVA 1QJGA 3FG1A 1PU4A 3CNMA 1CEWI 3KFQC 1Q40B 4H3UA 3O8YA 1QVF2 2GBXB 3NV0B 5FGOA 5JBSA 1PFPA 4O8SA 5LC6A 5AEWB 3EQQB 1VQ63 3F9SA 1JNQA 1UW1A 3BLZA 2W2CA 1K734 3LZAA 1STFI 2O3OA 1ASKA 2CWTA 1J2BA 3PGBA 3CCS3 4BTYA 2O9UX 3LTDA 4FMDA 1OHPA 2CKFB 2BNGA 2ZDJA 2E2TA 4R80A 3EF8A 5EVHA 3UL5A 3QK9A 1SJWA 3CCV3 3D9RA 4XDVA 4AKYA 5BVBA 2P38A 4OK0A 1IQYA 1O7HB 3OWSA 5IENA 1MOLA 1TFKA 4HYZA 3B4PA 1GY5A 3BB9A 1VQN3 3HK4A 1BUQA 3LTCA 3KSPA 1ZX2A 1QMAA 2P09A 1IQ8A 1YVBI 1AVLA 2RGQA 2P0XA 2JQ5A 2OQEA 4GB5A 4K61A 3WOFB 1KQS2 3KE7A 1QAKA 4RNZA 3RGRA 3NM7A 1K9M4 1UUVB 2IUKA 1IVUA 2R4IA 4HM8B 3X3ZA 3EBTA 4N6NB 4L8PA 2QEX3 1ULIB 1OH0A 3K9MC 1YJ93 3EE1A 3NBJA 4WFOA 1HKXA 4EYCA 3WMDA 1D6UA 1NB5I 3MWZA 3V98A 4FMAA 3ALAA 2KCDA 4XBTA 4J8TA 4JF8A 2STDA 3DY5A 3HIGA 1YGEA 4X2OA 3CU3A 2RFRA 4NHFA 1W6CA 3FKAA 3LT8A 4U13A 3G6E3 3KKGA 1O7PB 2FNQA 5DREA 1FGTA 5IG3A 5I97A 4N3VA 4EXRA 3CCJ3 1T5YA 3F7SA 3GWRA 4R9KA 5AI1A 3TDGA 3S29A 4TX4A 1WNHA 1A2KA 2D1WA 1IVXA 4XM4A 4OUQA 1JJ22 2CK3H 3EBYA 2B1XB 2XSHB 1Q864 1OACA 1W7CA 2CH9A 3DGLA 1GS3A 3LTAA 3DGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV7 A;  1LXE A;  1GD4 A;  1N5H A;  1N5P A;  4CCV A;  1CEW I;  3KFQ C;  3KSE D;  1PFP A;  5LC6 A;  3QRD A;  3UL6 A;  1R4C A;  4LZI A;  1STF I;  5A0O B;  3PXM A;  2O9U X;  4N6V 0;  1KWI A;  5ELU A;  3LH4 A;  1TIJ A;  2OCT A;  3UL5 A;  1M9G A;  3IMA B;  2W9Q A;  3SVA A;  1MOL A;  4IT7 A;  1CYU A;  2BO9 B;  4N6L A;  1YVB I;  1ROA A;  1N9J A;  2W9P A;  1DVC A;  1FA3 A;  3S67 A;  5LC7 A;  4N6N B;  5ELJ A;  1FUW A;  1IV9 A;  3K9M C;  3GAX A;  4EYC A;  1DVD A;  4N6O B;  1NB5 I;  3MWZ A;  3PYJ A;  1RN7 A;  3NX0 A;  3L0R A;  4N6U A;  5EQL A;  4N6M A;  1G96 A;  1MNL A;  1A67 A;  1CYV A;  4ZM8 A;  1EQK A;  2KXG A;  4TX4 A;  1WNH A;  3Q2P A;  4N6T A;  1NB3 I;  1A90 A;  2CH9 A;  1GD3 A;  3PS8 A; 
#chains in the Genus database with same CATH topology
 2E2V A;  1IV7 A;  2K54 A;  4RZM A;  3D4A A;  4WYK B;  1N5H A;  3S28 A;  5IF6 A;  1N5P A;  3JUQ A;  1NO3 A;  1Q40 A;  2YFL B;  5KP3 A;  2E2U A;  2OOV C;  4CJN A;  5M1A A;  2V1L A;  1W6Y A;  3STD A;  1TJD A;  3KSE D;  1MWS A;  4GSP A;  3WR2 A;  1YJN 3;  9RNT A;  4GHO A;  5D81 A;  1RGG A;  3DMC A;  1JB4 A;  1OGZ A;  1B2S A;  4H61 A;  5TGN A;  3UL6 A;  3X3Y A;  1FUS A;  3CCE 3;  3SLU A;  1GY6 A;  3EB8 A;  3J7Y d;  1Q81 4;  3EHC A;  1RMS A;  2K3D A;  3MG1 A;  1RGF A;  1Q7Y 4;  1RGE A;  1GYB A;  3CMA 3;  3UNL A;  5IG4 A;  1B2U A;  1KWI A;  3LH4 A;  4O02 B;  1RRL A;  2BIR A;  5CK6 A;  3JUO A;  3U1W A;  1LQG C;  1GOV A;  3A5E A;  1RHL A;  2H0G A;  3DXO A;  3NM2 A;  2CFK A;  1BAO A;  5IW9 A;  1JB5 A;  2F98 A;  3URP A;  2ML5 A;  2BMO B;  2W9Q A;  4XBX A;  1VQP 3;  1ZGX A;  1I3I A;  4QWT A;  3SVA A;  1OF5 A;  3WA3 A;  5M18 A;  5IEO A;  3DZL A;  3G16 A;  4IIA A;  1AV4 A;  1ISK A;  1IDP A;  4IT7 A;  2K0M A;  5G1L A;  1VQ9 3;  1IYY A;  5KP4 A;  1TRP A;  1I0V A;  1MGR A;  1UCJ A;  1Q42 A;  3EJV A;  2HMO B;  4N6L A;  4NRE A;  5KP1 A;  1QAF A;  1WTH A;  1VQ7 3;  3D3L A;  1LOW A;  4XB5 A;  1LVN A;  1N9J A;  4LMI A;  2RBI A;  1BRH A;  2PZV A;  1GMQ A;  3EN1 B;  3CNX A;  1LRA A;  4MEI A;  1DMN A;  3F8H A;  3N9H A;  2WGO A;  3N8B A;  5CXO A;  3NQZ A;  5G1K A;  3CCM 3;  2W9P A;  5AIH A;  2HML B;  4MMZ B;  1JKG A;  3DGY A;  3F14 A;  1Y4K A;  3S67 A;  4BTX A;  2JDI H;  7GSP A;  2F5M A;  4DKI A;  5ELJ A;  1IQX A;  1FUW A;  1BRN L;  2W6J H;  3GAX A;  4MMX B;  3JVC A;  1CH0 A;  1BGS A;  1BRK A;  1DVD A;  3K0Z A;  3MG2 A;  3MKI A;  4ORL A;  3OV4 A;  2GXF A;  4KFE A;  1RGC A;  1N8R 4;  1RN7 A;  1O7W B;  1DYU A;  3NX0 A;  5RNT A;  2KAA A;  2IUJ A;  1TTO A;  1YVS A;  3MPH A;  1B21 A;  3ROB A;  5CF1 A;  3I55 3;  1MGW A;  2CIU A;  1RGA A;  3I56 3;  3U97 A;  3WOE B;  4HM3 B;  1FZU A;  3F8X A;  2Z76 A;  2KRT A;  2CWV A;  1L5G B;  1IVV A;  1RKY A;  1GSP A;  3NXJ A;  4KFD A;  4WHA A;  1JN5 A;  1MNL A;  1AVK A;  5IEP A;  1E3R A;  2BHM A;  3GZB A;  1N9E A;  4X2H A;  1CYV A;  4ZM8 A;  3JUN A;  5CLK A;  3LTB A;  4XBY A;  4HM7 B;  1GY7 A;  3NUV A;  1LOY A;  3CCL 3;  1B3S A;  4N6T A;  3E99 A;  1DE3 A;  1W4N A;  1NB3 I;  3F40 A;  1O7M B;  1KD1 4;  1JRQ A;  2IMJ A;  2Y74 A;  3MHE A;  4Q53 A;  1MWR A;  4O2H A;  4LYL B;  2W03 A;  3A76 A;  4PEJ A;  2W0Q A;  2KF6 A;  1A90 A;  1GD3 A;  3PS8 A;  1B27 A;  3X41 A;  3FZW A;  1EG9 B;  3SXX A;  3AGO A;  2UUG C;  3MYT A;  3UJM A;  1ULJ B;  4WYK A;  4HM0 B;  1LXE A;  2RSX A;  1GD4 A;  2XF3 A;  1UCL A;  1RN4 A;  2CWU A;  1AR0 A;  2QGU A;  2W56 A;  2C11 A;  4FR9 A;  3SX1 A;  4WWU C;  3AMO A;  1Q7H A;  1W5Z A;  3T8U A;  1YHQ 3;  1SAR A;  4ILF A;  1BRJ A;  2WO0 A;  1NJI 4;  1YIT 3;  1FYS A;  1DMM A;  1QAL A;  3KZT A;  2CFD A;  2CG1 A;  5HGR A;  3F7X A;  4LEH A;  1R4C A;  1I2E A;  3FCS B;  3ZFZ A;  3MSO A;  4STD A;  5A0O B;  5FW5 A;  1VZZ A;  1I3F A;  1BNG A;  3HII A;  1U8C B;  1YI2 3;  2B24 B;  3PCR A;  4N6V 0;  3HI7 A;  2H0H A;  2GEY A;  3EX9 A;  2BU4 A;  5ELU A;  1RSN A;  2CFW A;  4EV5 A;  1TU5 A;  2L1S A;  1TIJ A;  1BNJ A;  2OCT A;  2XR8 B;  2INX A;  1UI7 A;  1TUH A;  1A2V A;  2IA7 A;  2KF3 A;  2R41 A;  3NHX A;  1BNE A;  2QIY A;  3HX8 A;  3PZW A;  2OTL 3;  4K1V A;  3NV0 A;  4LGQ A;  1M1K 4;  1Z1S A;  4FCZ A;  2HMN B;  1E3V A;  1FGO A;  7STD A;  1BRG A;  1CYU A;  1SII A;  2C4B A;  8RNT A;  1RGL A;  1UCK A;  1RGK A;  2XFT A;  1S72 3;  1UI8 A;  2GEX A;  2OOV A;  1SIH A;  2HMJ B;  3RNT A;  1BRI A;  1NNV A;  4AKZ A;  1JZO A;  1W00 A;  1VQM 3;  2F4Y A;  3LML A;  1NDO B;  1FGM A;  2HMM B;  1VQL 3;  1BNS A;  3BNC A;  1DVC A;  5STD A;  3FH1 A;  1WQL B;  2KF4 A;  3IPT A;  3OX9 A;  1BNF A;  2BMR B;  1HU9 A;  3AHS A;  2CW9 A;  2WOH A;  3GZX B;  4L8O A;  1KC8 4;  4HM5 B;  3X42 A;  4J5G A;  1UGI A;  2HMK B;  4K1U A;  1FW7 A;  2Q07 A;  4J9A A;  1LOV A;  2CX0 A;  1BAN A;  2BT3 A;  2OWP A;  2MF7 A;  4NPB A;  2M7O A;  3LXU X;  1YGW A;  3PCS A;  3DGO A;  4N6O B;  3HZP A;  1RCK A;  1O7G B;  5EEO A;  1FGQ A;  2CC3 A;  3CCU 3;  5AYS C;  5BXQ A;  2IYJ A;  3B7C A;  3WOD G;  3VF1 A;  3L0R A;  4O3V A;  1RLS A;  3BNE A;  1RJO A;  3CME 3;  3FSD A;  4CDL A;  3V92 A;  1V74 A;  1LNI A;  3Q1C A;  1N8Q A;  4I5Q A;  1QVG 2;  1Q82 4;  5EQL A;  4N6M A;  1B2Z A;  1G96 A;  2F86 B;  1X1W A;  5DRV A;  1ZO2 A;  3X40 A;  1JBT A;  5D83 A;  2AAD A;  3H3H A;  3G71 3;  4JRF A;  1TFO A;  4R1K A;  1V57 A;  1JV2 B;  2P0M A;  3CXC 2;  1I8V A;  1EQK A;  3NBB A;  3X3X A;  3N54 B;  4EC6 A;  1RTU A;  3SED A;  4HVN A;  3LYG A;  3B8L A;  1E97 A;  1GMP A;  2I9W A;  2WOF A;  3Q2P A;  3KN4 A;  3VGN A;  1JBS A;  3GRD A;  3GZR A;  3ER7 A;  3ZG5 A;  1BUJ A;  1SPU A;  1UDI I;  3OXA A;  2ZA4 A;  1VQ8 3;  1VQ5 3;  4MJD A;  1OUN A;  4RNT A;  2Z7A A;  3LOY A;  3CD6 3;  3HOH A;  2RCD A;  1VQQ A;  1U5O A;  1BIR A;  1IT7 A;  1W2Z A;  3BNB A;  2FXT A;  5BU4 A;  5CF2 A;  2A15 A;  1W01 A;  1EA2 A;  4HKV B;  2XRX B;  5D82 A;  8CHO A;  4K90 B;  3FG4 A;  7RNT A;  3Q3F A;  2OTJ 3;  1O7N B;  1OF5 B;  3ECF A;  5AEU B;  5HOH A;  3VSY A;  1V58 A;  4AEQ A;  2OQE C;  5IG5 A;  4IPB A;  1OHO A;  1ROV A;  2FGT A;  4HZ9 B;  4HZB B;  3EC9 A;  2XEP A;  3QRD A;  2LQV A;  1M90 4;  3FGY A;  4BIR A;  2UGI A;  4LZI A;  1KSI A;  2CFG A;  4OVM A;  1IK3 A;  3NBR A;  1CQS A;  2CG0 A;  3PXM A;  3S27 A;  4BTW A;  4I4K A;  4KFF A;  2YX9 A;  2GU1 A;  3I0Y A;  3K7C A;  1IVW A;  3OW2 2;  3CCR 3;  1OPY A;  1OHS A;  2C10 A;  1W6G A;  3FG3 A;  2Z77 A;  1VQ4 3;  3BIR A;  1M9G A;  2W04 A;  4EV2 A;  3FF0 A;  1JKG B;  6RNT A;  1F8N A;  3IMA B;  3OWU A;  1K8A 4;  3CPO A;  1IU7 A;  1OCV A;  3H51 A;  1T3B A;  4HAA A;  5AIF A;  4FMB A;  4EBG A;  5IG0 A;  3ZG0 A;  3RGA A;  1LNH A;  1B2X A;  3B4O A;  1FUT A;  2YFI B;  4HM4 B;  3T0U A;  2BO9 B;  1W2B 2;  1S5A A;  1TP6 A;  3KCH A;  4FCM A;  1GMR A;  4HBR A;  1M1X B;  1ROA A;  5M19 A;  1WMP A;  1STD A;  2YFJ B;  4KZ1 A;  5G2G A;  4RBN A;  3K5T A;  3WA2 X;  5GSP A;  3GZY B;  1JBR A;  2Z6B A;  4LSO A;  4WP5 A;  2XSO B;  1AY7 A;  2GBW B;  3RDE A;  1FGR A;  3LT9 A;  2LYX A;  1DMQ A;  4KVH A;  1FA3 A;  1JN5 B;  2XGL A;  5LC7 A;  2UX0 A;  1W02 A;  4RNY A;  1X1Y A;  2BMQ B;  2XH9 A;  1WMO A;  3G0K A;  4HM6 B;  1YNV X;  1IV9 A;  3DGN A;  3JUP A;  5IER A;  1AQZ A;  1BOX A;  1OGX A;  3DUK A;  2CHC A;  1EKM A;  2XGN A;  3V99 A;  1BSB A;  3SOY A;  3JUM A;  3KII A;  1RRH A;  3D5I A;  4HM2 B;  3UB1 A;  1SQW A;  1T2H A;  1VQO 3;  3PYJ A;  2P05 A;  2ML6 A;  1YIJ 3;  6STD A;  3DM8 A;  2ZL8 A;  3T8N A;  3FF2 A;  5AII A;  1HYF A;  1LOX A;  1UUW B;  2XFS A;  2CFL A;  3K63 A;  3CCQ 3;  5JPU A;  1WMN A;  2AAE A;  1BNR A;  1MWU A;  4N6U A;  1K28 A;  2WGQ A;  4R4K A;  3G4S 3;  3CC2 3;  4XDW A;  2PNC A;  1YJW 3;  1K41 A;  4G1M B;  2L4V A;  1PYL A;  3NQY A;  2W56 B;  1US1 A;  2Y73 A;  3AHW A;  4FCJ A;  3WDG B;  3SOA A;  1C7H A;  3AMO B;  1A67 A;  5AYR B;  3CC4 3;  1IT8 A;  3OWY A;  1NU3 A;  2D42 A;  3EN8 A;  3SYU A;  1EUI C;  1Q9E A;  2KXG A;  1JB2 A;  1D6Y A;  2IY2 A;  1RDS A;  3S5C A;  3Q90 A;  1VQK 3;  3GSP A;  4L7K A;  1D6Z A;  3IJE B;  2GSP A;  2KF5 A;  3MG3 A;  3CC7 3;  5AIG A;  3FLJ A;  2QA4 3;  2F99 A;  3G8Z A;  4HJL B;  4J5K A;  4HM1 B;  4MMY B;  4BL3 A;  1G0T A;  2GU3 A;  1NWW A;  2SBL A;  3CPW 2;  3BND A;  4GL6 A;  4FMC A;  4R9L A;  3M8C A;  2MC8 A;  2RNT A;  5JPP A;  1RGH A;  1BSD A;  1QJG A;  3FG1 A;  4CCV A;  3CNM A;  1PU4 A;  2CX1 A;  1CEW I;  3KFQ C;  1Q40 B;  4H3U A;  3O8Y A;  1QVF 2;  2GBX B;  1BNI A;  1B2M A;  3NV0 B;  5FGO A;  5JBS A;  1MWT A;  1PFP A;  4O8S A;  5LC6 A;  1RNT A;  3EQQ B;  5AEW B;  3F9S A;  1BSA A;  1VQ6 3;  1JNQ A;  1JZD A;  1UW1 A;  3AGN A;  2W2C A;  3BLZ A;  1K73 4;  3LZA A;  1ZS7 A;  1STF I;  2O3O A;  1ASK A;  1T2I A;  2CWT A;  1J2B A;  3PGB A;  3CCS 3;  4BTY A;  2O9U X;  3LTD A;  4FMD A;  1OHP A;  2CKF B;  2BNG A;  2ZDJ A;  2E2T A;  4R80 A;  1RN1 A;  2SAR A;  1BSE A;  3EF8 A;  1I2G A;  1BSC A;  3DH2 A;  5EVH A;  1BVI A;  3QK9 A;  3UL5 A;  1SJW A;  3CCV 3;  1LQM B;  3D9R A;  4XDV A;  4AKY A;  1BRS A;  5BVB A;  2P38 A;  4OK0 A;  1IQY A;  1O7H B;  3OWS A;  1BU4 A;  5IEN A;  1PY3 A;  1MOL A;  1TFK A;  4HYZ A;  1GOU A;  3B4P A;  3WHO A;  1GY5 A;  3BB9 A;  1VQN 3;  3HK4 A;  1BUQ A;  3LTC A;  3KSP A;  1EEJ A;  1ZX2 A;  1QMA A;  1I0X A;  2P09 A;  1IQ8 A;  1YVB I;  1AVL A;  2RGQ A;  1DET A;  2P0X A;  2JQ5 A;  2OQE A;  4GB5 A;  4K61 A;  3WOF B;  1KQS 2;  1B20 A;  3KE7 A;  1QAK A;  4RNZ A;  3RGR A;  3D79 A;  1X1U A;  3NM7 A;  1K9M 4;  1UUV B;  2J8X B;  3D5G A;  5BIR A;  1HZ1 A;  2IUK A;  1IVU A;  1GOY A;  2R4I A;  4BU4 A;  4HM8 B;  3X3Z A;  4CPK A;  3EBT A;  4N6N B;  4L8P A;  2QEX 3;  2F5W A;  1ULI B;  1OH0 A;  3K9M C;  1YJ9 3;  1RNB A;  3EE1 A;  1UGH I;  3NBJ A;  1I70 A;  4WFO A;  1HKX A;  4EYC A;  1X1X A;  3WMD A;  2F56 A;  1D6U A;  1NB5 I;  3MWZ A;  3V98 A;  1TRQ A;  4FMA A;  1UUG B;  3ALA A;  2KCD A;  4XBT A;  4J8T A;  4JF8 A;  2STD A;  3DY5 A;  3HIG A;  1YGE A;  1R4Y A;  3CU3 A;  4X2O A;  2RFR A;  4NHF A;  1W6C A;  2ZHX B;  1UCI A;  4HOH A;  3FKA A;  3LT8 A;  1G02 A;  4KT3 B;  4BL2 A;  4U13 A;  3G6E 3;  3KKG A;  4EW5 A;  1O7P B;  2FNQ A;  5DRE A;  1FGT A;  5IG3 A;  5I97 A;  4N3V A;  4EXR A;  3CCJ 3;  2H0I A;  3BU4 A;  1T5Y A;  3F7S A;  3GWR A;  4R9K A;  5AI1 A;  1RCL A;  1I2F A;  3TDG A;  3S29 A;  2HOH A;  1WNH A;  4TX4 A;  1A2K A;  2D1W A;  1A2P A;  1IVX A;  4XM4 A;  4OUQ A;  6GSP A;  1JJ2 2;  2CK3 H;  3EBY A;  2B1X B;  2XSH B;  1Q86 4;  1OAC A;  1W7C A;  2CH9 A;  1C54 A;  3DGL A;  1GS3 A;  3LTA A;  3DGM A; 
#chains in the Genus database with same CATH homology
 2E2V A;  1IV7 A;  2K54 A;  4RZM A;  4WYK B;  1N5H A;  3S28 A;  5IF6 A;  1N5P A;  3JUQ A;  1NO3 A;  1Q40 A;  2YFL B;  5KP3 A;  2E2U A;  2OOV C;  2V1L A;  1W6Y A;  3STD A;  3KSE D;  1YJN 3;  5D81 A;  3DMC A;  1JB4 A;  1OGZ A;  3UL6 A;  4H61 A;  5TGN A;  3X3Y A;  3CCE 3;  3SLU A;  1GY6 A;  3EB8 A;  3J7Y d;  1Q81 4;  3EHC A;  3MG1 A;  1Q7Y 4;  1GYB A;  3CMA 3;  3UNL A;  5IG4 A;  1KWI A;  4O02 B;  3LH4 A;  5CK6 A;  1RRL A;  3U1W A;  3JUO A;  3DXO A;  3NM2 A;  2CFK A;  5IW9 A;  1JB5 A;  2F98 A;  2ML5 A;  2BMO B;  2W9Q A;  4XBX A;  1VQP 3;  4QWT A;  3SVA A;  3WA3 A;  1OF5 A;  5IEO A;  3DZL A;  3G16 A;  4IIA A;  1AV4 A;  1ISK A;  1IDP A;  4IT7 A;  2K0M A;  1VQ9 3;  5KP4 A;  3EJV A;  4NRE A;  5KP1 A;  1Q42 A;  2HMO B;  4N6L A;  1VQ7 3;  1QAF A;  1WTH A;  3D3L A;  4XB5 A;  1LVN A;  1N9J A;  4LMI A;  2PZV A;  3EN1 B;  3CNX A;  4MEI A;  1DMN A;  3F8H A;  3N9H A;  2WGO A;  3N8B A;  5CXO A;  3NQZ A;  3CCM 3;  2W9P A;  5AIH A;  2HML B;  4MMZ B;  1JKG A;  3F14 A;  1Y4K A;  3S67 A;  4BTX A;  2JDI H;  5ELJ A;  1IQX A;  1FUW A;  2W6J H;  3GAX A;  4MMX B;  3JVC A;  1DVD A;  3K0Z A;  3MG2 A;  3MKI A;  4ORL A;  3OV4 A;  2GXF A;  4KFE A;  1N8R 4;  1RN7 A;  1O7W B;  1DYU A;  3NX0 A;  3I55 3;  2IUJ A;  3MPH A;  3I56 3;  3ROB A;  5CF1 A;  2CIU A;  3U97 A;  3WOE B;  4HM3 B;  3F8X A;  2Z76 A;  2KRT A;  2CWV A;  1L5G B;  1IVV A;  1RKY A;  3NXJ A;  4KFD A;  4WHA A;  1JN5 A;  1MNL A;  1AVK A;  5IEP A;  1E3R A;  2BHM A;  3GZB A;  1N9E A;  4X2H A;  1CYV A;  4ZM8 A;  3JUN A;  5CLK A;  3LTB A;  4XBY A;  4HM7 B;  1GY7 A;  3NUV A;  3CCL 3;  4N6T A;  3E99 A;  1W4N A;  1NB3 I;  3F40 A;  1O7M B;  1KD1 4;  1JRQ A;  2IMJ A;  2Y74 A;  3MHE A;  4Q53 A;  4O2H A;  4PEJ A;  2W03 A;  3A76 A;  1A90 A;  2W0Q A;  1GD3 A;  3PS8 A;  3X41 A;  3FZW A;  1EG9 B;  3SXX A;  3UJM A;  3MYT A;  1ULJ B;  4WYK A;  4HM0 B;  1LXE A;  2RSX A;  1GD4 A;  2XF3 A;  4FR9 A;  2CWU A;  1AR0 A;  2QGU A;  2W56 A;  2C11 A;  3SX1 A;  4WWU C;  3AMO A;  1W5Z A;  3T8U A;  1YHQ 3;  2WO0 A;  1NJI 4;  1YIT 3;  1DMM A;  1QAL A;  3KZT A;  2CFD A;  2CG1 A;  5HGR A;  3F7X A;  4LEH A;  1R4C A;  3FCS B;  3MSO A;  4STD A;  5A0O B;  5FW5 A;  1VZZ A;  3HII A;  1U8C B;  1YI2 3;  2B24 B;  3PCR A;  4N6V 0;  3HI7 A;  2GEY A;  3EX9 A;  5ELU A;  2CFW A;  4EV5 A;  1TU5 A;  1TIJ A;  2OCT A;  2XR8 B;  2INX A;  1UI7 A;  1TUH A;  1A2V A;  2IA7 A;  3NHX A;  3HX8 A;  2QIY A;  3PZW A;  2OTL 3;  4K1V A;  3NV0 A;  4LGQ A;  1M1K 4;  1Z1S A;  4FCZ A;  2HMN B;  1E3V A;  1FGO A;  7STD A;  1CYU A;  1SII A;  2XFT A;  1S72 3;  1UI8 A;  2GEX A;  2OOV A;  2HMJ B;  1SIH A;  4AKZ A;  1W00 A;  1VQM 3;  3LML A;  1NDO B;  1FGM A;  2HMM B;  1VQL 3;  3BNC A;  1DVC A;  5STD A;  3FH1 A;  1WQL B;  3IPT A;  3OX9 A;  2BMR B;  1HU9 A;  2CW9 A;  2WOH A;  3GZX B;  4L8O A;  1KC8 4;  4HM5 B;  3X42 A;  2HMK B;  4K1U A;  2Q07 A;  4J9A A;  2BT3 A;  2OWP A;  2MF7 A;  2M7O A;  3LXU X;  3PCS A;  3DGO A;  4N6O B;  3HZP A;  1O7G B;  5EEO A;  1FGQ A;  2CC3 A;  3CCU 3;  5AYS C;  5BXQ A;  3B7C A;  3WOD G;  3VF1 A;  3L0R A;  4O3V A;  3BNE A;  1RJO A;  3CME 3;  3FSD A;  4CDL A;  3V92 A;  1V74 A;  3Q1C A;  1N8Q A;  1QVG 2;  1Q82 4;  5EQL A;  4N6M A;  1G96 A;  2F86 B;  5DRV A;  3X40 A;  1ZO2 A;  1VQ8 3;  5D83 A;  3H3H A;  3G71 3;  4JRF A;  1TFO A;  4R1K A;  1EQK A;  1JV2 B;  2P0M A;  3CXC 2;  3NBB A;  3X3X A;  3N54 B;  4EC6 A;  3SED A;  4HVN A;  3LYG A;  3B8L A;  1E97 A;  2I9W A;  3Q2P A;  2WOF A;  3VGN A;  3KN4 A;  3GRD A;  3GZR A;  3ER7 A;  1SPU A;  3OXA A;  1VQ5 3;  4MJD A;  1OUN A;  2Z7A A;  3LOY A;  3CD6 3;  2RCD A;  1U5O A;  1IT7 A;  3BNB A;  1W2Z A;  2FXT A;  5CF2 A;  2A15 A;  1W01 A;  1EA2 A;  4HKV B;  2XRX B;  5D82 A;  8CHO A;  4K90 B;  3FG4 A;  2OTJ 3;  1O7N B;  1OF5 B;  3ECF A;  5AEU B;  3VSY A;  4AEQ A;  2OQE C;  5IG5 A;  4IPB A;  1OHO A;  1ROV A;  2FGT A;  4HZ9 B;  4HZB B;  3EC9 A;  2XEP A;  3QRD A;  2LQV A;  1M90 4;  3FGY A;  4LZI A;  1KSI A;  2CFG A;  4OVM A;  1IK3 A;  3NBR A;  1CQS A;  2CG0 A;  3PXM A;  3S27 A;  4BTW A;  4I4K A;  4KFF A;  2YX9 A;  2GU1 A;  3I0Y A;  3K7C A;  1IVW A;  3OW2 2;  3CCR 3;  1OPY A;  1OHS A;  2C10 A;  1W6G A;  3FG3 A;  2Z77 A;  1VQ4 3;  1M9G A;  2W04 A;  4EV2 A;  3FF0 A;  1JKG B;  1F8N A;  3IMA B;  3OWU A;  1K8A 4;  3CPO A;  1IU7 A;  1OCV A;  3H51 A;  5AIF A;  4FMB A;  4EBG A;  5IG0 A;  3RGA A;  1LNH A;  3B4O A;  3T0U A;  2YFI B;  4HM4 B;  2BO9 B;  1W2B 2;  1S5A A;  1TP6 A;  4FCM A;  4HBR A;  1M1X B;  1ROA A;  1WMP A;  1STD A;  2YFJ B;  4KZ1 A;  5G2G A;  4RBN A;  3K5T A;  3WA2 X;  3GZY B;  2Z6B A;  4LSO A;  4WP5 A;  2XSO B;  2GBW B;  3RDE A;  1FGR A;  3LT9 A;  2LYX A;  1DMQ A;  4KVH A;  1FA3 A;  1JN5 B;  2XGL A;  5LC7 A;  2UX0 A;  1W02 A;  4RNY A;  2BMQ B;  2XH9 A;  1WMO A;  3G0K A;  4HM6 B;  1IV9 A;  3DGN A;  3JUP A;  5IER A;  1OGX A;  3DUK A;  2CHC A;  1EKM A;  2XGN A;  3V99 A;  3SOY A;  3JUM A;  3KII A;  1RRH A;  4HM2 B;  3UB1 A;  1SQW A;  1VQO 3;  3PYJ A;  2P05 A;  2ML6 A;  1YIJ 3;  6STD A;  3DM8 A;  2ZL8 A;  3T8N A;  3FF2 A;  5AII A;  1LOX A;  1UUW B;  2XFS A;  2CFL A;  3K63 A;  3CCQ 3;  5JPU A;  1WMN A;  4N6U A;  1K28 A;  2WGQ A;  4R4K A;  3G4S 3;  3CC2 3;  4XDW A;  2PNC A;  1YJW 3;  1K41 A;  4G1M B;  2L4V A;  3NQY A;  2W56 B;  1US1 A;  2Y73 A;  4FCJ A;  3WDG B;  3SOA A;  1C7H A;  3AMO B;  1A67 A;  5AYR B;  3CC4 3;  1IT8 A;  3OWY A;  1NU3 A;  2D42 A;  3EN8 A;  2KXG A;  1JB2 A;  1D6Y A;  3S5C A;  3Q90 A;  1VQK 3;  4L7K A;  1D6Z A;  3IJE B;  3CC7 3;  3MG3 A;  5AIG A;  3FLJ A;  2QA4 3;  2F99 A;  3G8Z A;  4HJL B;  4HM1 B;  4MMY B;  2GU3 A;  1NWW A;  2SBL A;  3CPW 2;  3BND A;  4GL6 A;  4FMC A;  4R9L A;  3M8C A;  2MC8 A;  5JPP A;  4CCV A;  1QJG A;  3FG1 A;  1PU4 A;  3CNM A;  1CEW I;  3KFQ C;  1Q40 B;  4H3U A;  3O8Y A;  1QVF 2;  2GBX B;  3NV0 B;  5FGO A;  5JBS A;  1PFP A;  4O8S A;  5LC6 A;  5AEW B;  3EQQ B;  1VQ6 3;  3F9S A;  1JNQ A;  1UW1 A;  3BLZ A;  2W2C A;  1K73 4;  3LZA A;  1STF I;  2O3O A;  1ASK A;  2CWT A;  1J2B A;  3PGB A;  3CCS 3;  4BTY A;  2O9U X;  3LTD A;  4FMD A;  1OHP A;  2CKF B;  2BNG A;  2ZDJ A;  2E2T A;  4R80 A;  3EF8 A;  5EVH A;  3UL5 A;  3QK9 A;  1SJW A;  3CCV 3;  3D9R A;  4XDV A;  4AKY A;  5BVB A;  2P38 A;  4OK0 A;  1IQY A;  1O7H B;  3OWS A;  5IEN A;  1MOL A;  1TFK A;  4HYZ A;  3B4P A;  1GY5 A;  3BB9 A;  1VQN 3;  3HK4 A;  1BUQ A;  3LTC A;  3KSP A;  1ZX2 A;  1QMA A;  2P09 A;  1IQ8 A;  1YVB I;  1AVL A;  2RGQ A;  2P0X A;  2JQ5 A;  2OQE A;  4GB5 A;  4K61 A;  3WOF B;  1KQS 2;  3KE7 A;  1QAK A;  4RNZ A;  3RGR A;  3NM7 A;  1K9M 4;  1UUV B;  2IUK A;  1IVU A;  2R4I A;  4HM8 B;  3X3Z A;  3EBT A;  4N6N B;  4L8P A;  2QEX 3;  1ULI B;  1OH0 A;  3K9M C;  1YJ9 3;  3EE1 A;  3NBJ A;  4WFO A;  1HKX A;  4EYC A;  3WMD A;  1D6U A;  1NB5 I;  3MWZ A;  3V98 A;  4FMA A;  3ALA A;  2KCD A;  4XBT A;  4J8T A;  4JF8 A;  2STD A;  3DY5 A;  3HIG A;  1YGE A;  4X2O A;  3CU3 A;  2RFR A;  4NHF A;  1W6C A;  3FKA A;  3LT8 A;  4U13 A;  3G6E 3;  3KKG A;  1O7P B;  2FNQ A;  5DRE A;  1FGT A;  5IG3 A;  5I97 A;  4N3V A;  4EXR A;  3CCJ 3;  1T5Y A;  3F7S A;  3GWR A;  4R9K A;  5AI1 A;  3TDG A;  3S29 A;  4TX4 A;  1WNH A;  1A2K A;  2D1W A;  1IVX A;  4XM4 A;  4OUQ A;  1JJ2 2;  2CK3 H;  3EBY A;  2B1X B;  2XSH B;  1Q86 4;  1OAC A;  1W7C A;  2CH9 A;  3DGL A;  1GS3 A;  3LTA A;  3DGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...