3SVAA

Crystal structure of v57d mutant of human cystatin c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIDAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Structural characterization of V57D and V57P mutants of human cystatin C, an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3svaA00
1IV7A 1MNLA 5LC6A 1GD4A 1ROAA 4N6TA 1MOLA 1IV9A 1M9GA 2OCTA 3IMAB 1WNHA 1N5PA 3PS8A 3L0RA 2W9PA 4TX4A 3PYJA 2KXGA 4N6MA 4ZM8A 3GAXA 3K9MC 3KSED 2BO9B 1A90A 1RN7A 5ELJA 2CH9A 3QRDA 4N6LA 3S67A 5LC7A 1R4CA 3Q2PA 1TIJA 3NX0A 1GD3A 3UL6A 4N6V0 1DVDA 5A0OB 5ELUA 4IT7A 1NB3I 1CYUA 3UL5A 1KWIA 4LZIA 4EYCA 1CYVA 1FA3A 1FUWA 1G96A 1NB5I 1A67A 3LH4A 5EQLA 4N6NB 2O9UX 1CEWI 4N6UA 3SVAA 1STFI 3PXMA 1PFPA 4N6OB 1EQKA 1N5HA 4CCVA 1DVCA 3MWZA 1LXEA 3KFQC 1N9JA 2W9QA 1YVBI
chains in the Genus database with same CATH superfamily
5BIRA 3CCU3 2D42A 3HOHA 3V98A 2HMMB 5IG3A 1ROAA 1AY7A 3F9SA 3F40A 1EA2A 2GBWB 2OCTA 4HBRA 4PEJA 1EG9B 4XDWA 3IPTA 1OACA 2Z6BA 4MMXB 5AIGA 8RNTA 1HYFA 1I8VA 3FCSB 3FG3A 1RKYA 1AVLA 4RNTA 3SOYA 3O8YA 4EW5A 4AEQA 3NBJA 2CG1A 4ZM8A 3B4OA 2F98A 1G0TA 1FGTA 4AKZA 1RTUA 2Y73A 3KSED 1JZDA 4RZMA 3MYTA 4I5QA 2BNGA 1FZUA 2BO9B 1JN5B 6STDA 5ELJA 5IEPA 2CFKA 2INXA 1V58A 2CH9A 3F7SA 1IQ8A 4KFFA 3MKIA 3HK4A 2UUGC 1SPUA 4ORLA 1G02A 2K3DA 4K61A 2CWVA 4MMZB 5GSPA 3Q90A 1RSNA 2XEPA 4HM5B 5LC7A 5EEOA 1D6ZA 5IENA 1I0XA 4FCMA 3T8UA 1B2ZA 1TIJA 1Z1SA 1T5YA 2BT3A 1JKGB 1O7HB 1OF5A 1BNRA 1Q7HA 4HM7B 1RGCA 3CPOA 3UL6A 1ASKA 2W56A 4R4KA 1I2FA 1FUTA 5CF1A 5IF6A 1PY3A 3J7Yd 4N6V0 3CPW2 4FCJA 1MWSA 1C54A 7GSPA 1OHSA 3NHXA 1Q814 1FGOA 1UCJA 1US1A 3F7XA 4GL6A 5ELUA 5JPPA 1YIT3 3OWSA 1MGRA 2HMOB 4WYKB 3X3YA 4HM3B 1I3FA 2Z77A 5G1KA 4HKVB 1UI8A 2K54A 3KE7A 2V1LA 4BTXA 3CCV3 3G0KA 1ISKA 2CX0A 1O7GB 1C7HA 2BMOB 4WHAA 3X3ZA 2RFRA 1WQLB 3CXC2 4R80A 4X2HA 1FUWA 3WMDA 1YI23 1ROVA 1JBSA 3A5EA 3DGNA 1DMMA 1F8NA 1BRKA 3NV0A 1SIIA 4IPBA 3X42A 1Q824 3AHWA 4GSPA 4QWTA 2FNQA 3LH4A 2C10A 1B2MA 1O7WB 2W2CA 4XB5A 3F14A 4HM6B 1JRQA 4LMIA 4N6NB 1UUGB 1DMNA 3OV4A 3FLJA 4K90B 1DMQA 2A15A 1CEWI 1VQ73 1SARA 1OGXA 1NJI4 5AI1A 3DM8A 1JBTA 2L4VA 1LRAA 1RRLA 3NM2A 1KD14 3LT9A 1B27A 3AGNA 1N8QA 3GZYB 1GS3A 1N9EA 2C11A 1E97A 1IDPA 3B7CA 2SBLA 3HZPA 1BNFA 4CJNA 2IA7A 3B4PA 3D79A 1ULJB 4L8PA 3WR2A 3EN1B 4J5GA 1IYYA 1Q9EA 1LXEA 2W6JH 3OWUA 3KFQC 1N9JA 2KAAA 1ZS7A 1YVBI 1IU7A 2W9QA 4FMDA 3X41A 5D82A 1YGEA 5M18A 1A2KA 3CC73 3KZTA 1BUQA 2RCDA 1MNLA 1JB2A 3EQQB 5JBSA 1RN4A 1GD4A 4N6TA 1BNIA 5IW9A 1S5AA 1N8R4 3G16A 3PZWA 1QMAA 3LYGA 3V92A 2F4YA 2GXFA 3VF1A 1TU5A 3OWYA 1LVNA 2C4BA 2XF3A 1BANA 2CWTA 3NUVA 1N5PA 3AGOA 1RHLA 2IYJA 1X1UA 4H3UA 5DREA 1HU9A 2GU1A 4K1VA 3BNCA 1R4YA 5STDA 3SEDA 1Q40A 1VQP3 1RCKA 1IQYA 1BSEA 1W02A 3PYJA 1B21A 2KXGA 2XGNA 4GB5A 3JUMA 1TUHA 3BNBA 5CXOA 2KCDA 1SJWA 5CF2A 1T2IA 1RN7A 2P09A 5AIIA 1SIHA 1OGZA 3DGLA 1NDOB 3LTCA 3UJMA 3U1WA 5BVBA 1WMNA 2KF4A 4HZBB 3FG1A 3HIIA 4FCZA 1MWRA 1FGRA 5TGNA 3FZWA 3S27A 8CHOA 3D9RA 4HOHA 1VQ93 3Q2PA 5G1LA 4MJDA 1TP6A 2E2UA 1UW1A 4GHOA 1BRSA 4R9LA 3ROBA 1BNEA 7RNTA 4BL3A 1S723 1T2HA 3LTBA 1MWUA 2XH9A 4STDA 1B2UA 1IVWA 2W0QA 3DGYA 1GMPA 1D6UA 3CCQ3 2ZHXB 4BL2A 2WGQA 5HOHA 3EBYA 2XR8B 3NQZA 1VQQA 4LSOA 1GY7A 1UCLA 4LYLB 1RLSA 1B2XA 2XRXB 1RNTA 1UI7A 3D5GA 1RCLA 3HI7A 4IT7A 2YX9A 3WODG 3X40A 6GSPA 3MG1A 1NB3I 3WHOA 1CYUA 2GSPA 3ECFA 2HMNB 3K5TA 3PCSA 4XBXA 1KWIA 4O2HA 3PCRA 4EYCA 1Q7Y4 3DH2A 4HM8B 1EUIC 2BIRA 1TRQA 3CU3A 3URPA 1UGIA 2YFIB 5FW5A 1G96A 2QA43 5M19A 4MMYB 4BTWA 1JB4A 4ILFA 3F8HA 2SARA 1M1K4 4J5KA 1AV4A 4BIRA 3WA3A 2HMKB 1TJDA 2MF7A 4HM1B 4MEIA 5IG5A 2O9UX 2CFGA 4FMCA 4N6UA 2P0XA 1CQSA 3BNEA 2CFLA 4IIAA 1LOWA 1BRGA 3LMLA 1VQK3 1PYLA 3STDA 2QGUA 3N9HA 4HVNA 4EV5A 4N6OB 1RRHA 3HIGA 1U8CB 1I70A 3KIIA 3PGBA 1JB5A 3B8LA 4EBGA 1K734 4JRFA 1N5HA 1BGSA 4KT3B 3MSOA 1W7CA 3KKGA 3DMCA 1VQM3 3GRDA 2OQEC 4CCVA 4X2OA 3UB1A 3OXAA 4KVHA 3CCL3 3BLZA 1O7PB 1W5ZA 2K0MA 2Y74A 3AMOA 2IY2A 3MWZA 3NBRA 7STDA 3OW22 1DE3A 1IT8A 3DGOA 2OWPA 2ML6A 1BNSA 2XSHB 4N3VA 5D81A 4BU4A 1K9M4 3T8NA 2E2TA 1BRHA 3GZXB 3FF2A 1BNGA 1MGWA 1W6CA 1BRJA 3SX1A 4L7KA 2JDIH 1QVG2 5LC6A 5BU4A 1OUNA 1JZOA 1OHPA 3JUQA 3RDEA 1W2B2 5M1AA 2P05A 1GOVA 2I9WA 1VZZA 3IMAB 2OOVC 1W6YA 1YNVX 4EXRA 1WNHA 1BSBA 3EC9A 4KZ1A 2L1SA 2BU4A 2OQEA 1BSAA 3PS8A 4O3VA 2CW9A 3Q1CA 1TFOA 5EVHA 1OCVA 3ER7A 3L0RA 3WA2X 2RGQA 2W9PA 1IVXA 2P0MA 1RGFA 3EE1A 2CG0A 4KFEA 1RJOA 2H0IA 5IERA 1YJN3 1Q864 2OTJ3 1STDA 2E2VA 3K9MC 4Q53A 3X3XA 3WOEB 1RGHA 3LT8A 1GSPA 1A90A 1QJGA 2PZVA 1I2EA 1TFKA 1QAKA 5AEWB 3CCJ3 2GEXA 1UCKA 3KCHA 2F56A 4FMAA 2CHCA 1BSCA 1RGGA 2B1XB 2OOVA 2F5WA 3S67A 2P38A 3G713 4U13A 1RGEA 2AADA 1R4CA 2ZL8A 2KF6A 3BU4A 4K1UA 5D83A 3GWRA 5FGOA 4H61A 1AR0A 4WFOA 1T3BA 1OH0A 6RNTA 2R41A 1RGAA 1GD3A 2ML5A 3NQYA 1HZ1A 1LNHA 3EHCA 5AYSC 1VQ43 5DRVA 1JN5A 2CFDA 4HYZA 1HKXA 3EF8A 1OPYA 3EBTA 3F8XA 3RNTA 1JNQA 5AEUB 2MC8A 5A0OB 1VQL3 4FR9A 3S5CA 3SXXA 2GU3A 4RBNA 2KRTA 1RGLA 3JUPA 5KP4A 2BMQB 2PNCA 1JKGA 1X1YA 2BHMA 2RSXA 1IVVA 3LTAA 1CYVA 3CME3 1JJ22 3JVCA 2YFLB 1FA3A 3KN4A 2OTL3 1LOXA 4R9KA 3GZBA 1YJ93 3GZRA 9RNTA 2CKFB 1NB5I 3SYUA 3ZFZA 4WYKA 1DETA 1GOYA 5AYRB 1NNVA 4CPKA 4KFDA 2H0HA 1V57A 2CIUA 3K0ZA 1YJW3 1FW7A 2FXTA 2AAEA 2UX0A 1MWTA 1WTHA 3G8ZA 3JUOA 3SVAA 4HAAA 1SQWA 2STDA 1ULIB 5CK6A 4HZ9B 1UUWB 2D1WA 1W6GA 1PFPA 4XBTA 4DKIA 3CMA3 3BNDA 1NWWA 4BTYA 1RGKA 2UGIA 4RNZA 2M7OA 1VQN3 3EN8A 4FMBA 3LOYA 1BAOA 1CH0A 3DGMA 4HM0B 2XFTA 4NPBA 1LQMB 3I563 3MHEA 1GOUA 1W01A 5AIHA 1VQ53 2KF5A 1KSIA 1D6YA 3MG2A 1AQZA 3BIRA 1A2PA 3EB8A 1VQ63 1JBRA 1M904 2IMJA 2W03A 1BNJA 1KQS2 1EKMA 3CCE3 1Q40B 2XGLA 3CCS3 3MPHA 2ZA4A 3CNMA 1IV7A 1J2BA 1KC84 4WWUC 3DZLA 4LEHA 2Q07A 3EJVA 3LTDA 1MOLA 1IV9A 3BB9A 1M9GA 2H0GA 2J8XB 4J8TA 5I97A 1B2SA 1BOXA 2WOFA 2F86B 1ZGXA 4XM4A 3OX9A 1Q42A 2ZDJA 1A2VA 1UCIA 2XSOB 5JPUA 2O3OA 2LYXA 4JF8A 3A76A 2CWUA 3IJEB 2RBIA 4WP5A 3QK9A 4OUQA 2GEYA 3N54B 4TX4A 1QVF2 2Z76A 4N6MA 2F99A 3GAXA 3M8CA 3FG4A 5G2GA 4CDLA 3CCR3 1B3SA 5KP1A 2QEX3 2WGOA 1Y4KA 3K63A 1DYUA 1W4NA 1GYBA 3G4S3 3ZG0A 5IG4A 2XFSA 2CFWA 3FGYA 3QRDA 4N6LA 3RGRA 3WDGB 5IG0A 3CC23 3RGAA 1BUJA 1UUVB 3CNXA 3TDGA 1WMOA 4XDVA 1K41A 1RDSA 1YIJ3 1RNBA 1TTOA 3Q3FA 3ZG5A 3GSPA 3D3LA 1X1XA 2IUKA 3DY5A 3EX9A 4HM4B 3NX0A 3DUKA 2Z7AA 4EV2A 3FH1A 3H51A 5AIFA 1RMSA 1GMRA 1BVIA 1BIRA 2QIYA 3VGNA 3DXOA 2JQ5A 3SOAA 1IQXA 1ZX2A 1YVSA 1IT7A 3VSYA 2HMJB 1OF5B 3I553 1VQ83 1DVDA 3CC43 1X1WA 1E3RA 2HOHA 3E99A 1VQO3 1YHQ3 3NXJA 1IVUA 1BU4A 2W56B 1K28A 1OHOA 3D5IA 3NBBA 1I3IA 2BMRB 1IK3A 2YFJB 3HX8A 3UL5A 1PU4A 1LQGC 4LZIA 4RNYA 1NU3A 3U97A 3KSPA 4O02B 4NHFA 3WOFB 2RNTA 1UDII 4HJLB 1BSDA 1NO3A 2CX1A 3G6E3 4I4KA 2CK3H 3I0YA 3LZAA 2R4IA 1W2ZA 4L8OA 4NREA 5RNTA 1FYSA 2GBXB 2KF3A 3K7CA 4O8SA 4R1KA 5KP3A 3FSDA 1A67A 2W04A 1ZO2A 5EQLA 1GY5A 3T0UA 3CD63 3N8BA 1UGHI 3D4AA 1AVKA 3NV0B 2B24B 4XBYA 4G1MB 2FGTA 1LOVA 4J9AA 3AMOB 3MG3A 4AKYA 4LGQA 1BRNL 1TRPA 1STFI 4HM2B 1QALA 2HMLB 5IEOA 3PXMA 3H3HA 3SLUA 1JV2B 1E3VA 2LQVA 4OVMA 1BRIA 2WOHA 2IUJA 1V74A 4OK0A 1K8A4 1EQKA 1U5OA 3CCM3 1B20A 1RN1A 3V99A 1O7MB 1GY6A 3FF0A 1FUSA 1FGMA 1YGWA 5CLKA 1W00A 3S29A 1LNIA 3JUNA 3UNLA 1FGQA 1I0VA 1QAFA 3NM7A 5HGRA 1EEJA 1I2GA 1DVCA 3ALAA 3AHSA 5BXQA 1L5GB 3LXUX 4EC6A 2F5MA 2WO0A 2CC3A 1M1XB 3S28A 1WMPA 1O7NB 1GMQA 3FKAA 1LOYA
chains in the Genus database with same CATH topology
3CCU3 2D42A 3V98A 2HMMB 5IG3A 1ROAA 3F9SA 3F40A 1EA2A 2GBWB 2OCTA 4HBRA 4PEJA 1EG9B 4XDWA 3IPTA 1OACA 2Z6BA 4MMXB 5AIGA 3FCSB 3FG3A 1RKYA 1AVLA 3SOYA 3O8YA 4AEQA 3NBJA 2CG1A 4ZM8A 3B4OA 2F98A 1FGTA 4AKZA 2Y73A 3KSED 4RZMA 5IEPA 3MYTA 2BNGA 2BO9B 1JN5B 6STDA 5ELJA 2CFKA 2INXA 3F7SA 2CH9A 1IQ8A 4KFFA 3MKIA 3HK4A 1SPUA 4ORLA 4K61A 2CWVA 4MMZB 3Q90A 4HM5B 2XEPA 5LC7A 5EEOA 1D6ZA 5IENA 4FCMA 3T8UA 1TIJA 1Z1SA 1T5YA 2BT3A 1JKGB 1O7HB 1OF5A 4HM7B 3CPOA 3UL6A 1ASKA 2W56A 4R4KA 5CF1A 5IF6A 3J7Yd 4N6V0 3CPW2 4FCJA 1OHSA 3NHXA 1Q814 1FGOA 1US1A 3F7XA 5ELUA 4GL6A 5JPPA 1YIT3 3OWSA 2HMOB 4WYKB 3X3YA 4HM3B 2Z77A 4HKVB 1UI8A 2K54A 3KE7A 2V1LA 4BTXA 3CCV3 3G0KA 1ISKA 1O7GB 1C7HA 2BMOB 4WHAA 3X3ZA 2RFRA 1WQLB 3CXC2 4R80A 4X2HA 1FUWA 3WMDA 1YI23 1ROVA 3DGNA 1DMMA 1F8NA 3NV0A 1SIIA 4IPBA 3X42A 1Q824 4QWTA 2FNQA 3LH4A 2C10A 1O7WB 2W2CA 4XB5A 3F14A 4HM6B 1JRQA 4LMIA 4N6NB 1DMNA 3OV4A 3FLJA 4K90B 1DMQA 2A15A 1CEWI 1VQ73 1OGXA 1NJI4 5AI1A 3DM8A 2L4VA 1RRLA 3NM2A 1KD14 3LT9A 1N8QA 3GZYB 1GS3A 1N9EA 2C11A 1E97A 1IDPA 3B7CA 2SBLA 3HZPA 2IA7A 3B4PA 1ULJB 4L8PA 3EN1B 2W6JH 1LXEA 3OWUA 3KFQC 1N9JA 2W9QA 3X41A 1YVBI 1IU7A 4FMDA 5D82A 1YGEA 1A2KA 3CC73 3KZTA 1BUQA 2RCDA 1MNLA 1JB2A 3EQQB 5JBSA 1GD4A 4N6TA 5IW9A 1N8R4 1S5AA 3G16A 3PZWA 1QMAA 3LYGA 3V92A 1TU5A 2GXFA 3VF1A 3OWYA 1LVNA 2XF3A 2CWTA 3NUVA 1N5PA 5DREA 4H3UA 1HU9A 2GU1A 4K1VA 3BNCA 5STDA 3SEDA 1Q40A 1VQP3 1IQYA 1W02A 3PYJA 2KXGA 2XGNA 4GB5A 3JUMA 1TUHA 3BNBA 5CXOA 2KCDA 1SJWA 5CF2A 1RN7A 2P09A 5AIIA 1SIHA 1OGZA 3DGLA 1NDOB 3LTCA 3UJMA 3U1WA 5BVBA 1WMNA 4HZBB 3FG1A 3HIIA 4FCZA 1FGRA 5TGNA 3FZWA 3S27A 8CHOA 3D9RA 1VQ93 3Q2PA 4MJDA 1TP6A 2E2UA 1UW1A 4R9LA 3ROBA 1S723 3LTBA 2XH9A 4STDA 1IVWA 2W0QA 1D6UA 3CCQ3 2WGQA 3EBYA 2XR8B 3NQZA 4LSOA 1GY7A 2XRXB 1UI7A 3HI7A 3WODG 4IT7A 2YX9A 3X40A 3MG1A 1NB3I 1CYUA 3ECFA 2HMNB 3K5TA 3PCSA 4XBXA 1KWIA 4O2HA 3PCRA 4EYCA 1Q7Y4 4HM8B 3CU3A 2YFIB 5FW5A 1G96A 2QA43 4MMYB 4BTWA 1JB4A 3F8HA 1M1K4 1AV4A 3WA3A 2HMKB 2MF7A 4HM1B 4MEIA 5IG5A 2O9UX 2CFGA 4FMCA 4N6UA 2P0XA 1CQSA 3BNEA 2CFLA 4IIAA 3LMLA 1VQK3 3STDA 2QGUA 3N9HA 4HVNA 4EV5A 4N6OB 1RRHA 3HIGA 1U8CB 3KIIA 3PGBA 1JB5A 3B8LA 4EBGA 1K734 4JRFA 1N5HA 3MSOA 1W7CA 3KKGA 3DMCA 1VQM3 3GRDA 2OQEC 4CCVA 4X2OA 3UB1A 3OXAA 4KVHA 3CCL3 3BLZA 1O7PB 1W5ZA 2K0MA 2Y74A 3AMOA 3MWZA 3NBRA 3OW22 7STDA 1IT8A 3DGOA 2OWPA 2ML6A 4N3VA 2XSHB 5D81A 1K9M4 3T8NA 2E2TA 3GZXB 3FF2A 1W6CA 3SX1A 4L7KA 2JDIH 1QVG2 5LC6A 1OUNA 1OHPA 3JUQA 3RDEA 1W2B2 2P05A 2I9WA 1VZZA 3IMAB 2OOVC 1W6YA 4EXRA 1WNHA 3EC9A 4KZ1A 2OQEA 3PS8A 4O3VA 2CW9A 3Q1CA 1TFOA 5EVHA 1OCVA 3ER7A 3L0RA 3WA2X 2RGQA 2W9PA 1IVXA 2P0MA 3EE1A 2CG0A 4KFEA 1RJOA 5IERA 1YJN3 1Q864 2OTJ3 1STDA 2E2VA 3K9MC 4Q53A 3X3XA 3WOEB 3LT8A 1A90A 1QJGA 2PZVA 1TFKA 1QAKA 5AEWB 3CCJ3 2GEXA 4FMAA 2CHCA 2B1XB 2OOVA 3S67A 2P38A 3G713 4U13A 2ZL8A 1R4CA 4K1UA 5FGOA 5D83A 3GWRA 4H61A 1AR0A 4WFOA 1OH0A 1GD3A 2ML5A 3NQYA 1LNHA 3EHCA 5AYSC 1VQ43 5DRVA 1JN5A 2CFDA 4HYZA 1HKXA 3EF8A 1OPYA 3EBTA 3F8XA 5AEUB 1JNQA 1VQL3 2MC8A 5A0OB 4FR9A 3S5CA 3SXXA 2GU3A 4RBNA 2KRTA 3JUPA 5KP4A 2BMQB 2PNCA 1JKGA 2BHMA 2RSXA 1IVVA 3LTAA 1CYVA 3CME3 1JJ22 3JVCA 2YFLB 1FA3A 3KN4A 2OTL3 1LOXA 4R9KA 3GZBA 1YJ93 3GZRA 2CKFB 1NB5I 4WYKA 5AYRB 4KFDA 2CIUA 3K0ZA 1YJW3 2FXTA 2UX0A 1WTHA 3G8ZA 3JUOA 3SVAA 1SQWA 2STDA 1ULIB 5CK6A 4HZ9B 1UUWB 2D1WA 1W6GA 1PFPA 4XBTA 3CMA3 3BNDA 1NWWA 4BTYA 4RNZA 2M7OA 1VQN3 3EN8A 4FMBA 3LOYA 3DGMA 4HM0B 2XFTA 3I563 3MHEA 1W01A 1VQ53 5AIHA 1KSIA 1D6YA 3MG2A 3EB8A 1VQ63 1M904 2IMJA 2W03A 1KQS2 1EKMA 3CCE3 1Q40B 2XGLA 3CCS3 3MPHA 3CNMA 1J2BA 1IV7A 1KC84 4WWUC 3DZLA 4LEHA 2Q07A 3EJVA 3LTDA 1MOLA 1IV9A 3BB9A 1M9GA 4J8TA 5I97A 2WOFA 2F86B 4XM4A 3OX9A 1Q42A 2ZDJA 1A2VA 2XSOB 5JPUA 2O3OA 2LYXA 4JF8A 3A76A 2CWUA 3IJEB 4WP5A 3QK9A 4OUQA 2GEYA 3N54B 4TX4A 1QVF2 2Z76A 4N6MA 2F99A 3GAXA 3M8CA 3FG4A 5G2GA 4CDLA 3CCR3 2QEX3 5KP1A 2WGOA 1Y4KA 3K63A 1DYUA 1W4NA 1GYBA 3G4S3 5IG4A 2XFSA 2CFWA 3FGYA 3QRDA 4N6LA 3RGRA 3WDGB 5IG0A 3CC23 3RGAA 1UUVB 3CNXA 3TDGA 1WMOA 4XDVA 1K41A 1YIJ3 3D3LA 2IUKA 3DY5A 3EX9A 4HM4B 3NX0A 3DUKA 2Z7AA 4EV2A 3FH1A 3H51A 5AIFA 2QIYA 3VGNA 3DXOA 2JQ5A 3SOAA 1IQXA 1ZX2A 1IT7A 3VSYA 2HMJB 1OF5B 3I553 1VQ83 1DVDA 3CC43 3E99A 1E3RA 1YHQ3 1VQO3 3NXJA 1IVUA 2W56B 1K28A 1OHOA 3NBBA 2BMRB 1IK3A 2YFJB 3HX8A 3UL5A 1PU4A 4LZIA 4RNYA 1NU3A 3U97A 3KSPA 4O02B 4NHFA 3WOFB 4HJLB 1NO3A 3G6E3 4I4KA 2CK3H 3I0YA 3LZAA 2R4IA 1W2ZA 4L8OA 4NREA 2GBXB 5KP3A 3K7CA 4O8SA 4R1KA 3FSDA 1A67A 2W04A 1ZO2A 5EQLA 1GY5A 3T0UA 3CD63 3N8BA 3NV0B 1AVKA 4XBYA 2B24B 4G1MB 2FGTA 4J9AA 3AMOB 3MG3A 4AKYA 4LGQA 1STFI 4HM2B 1QALA 2HMLB 5IEOA 3PXMA 3H3HA 3SLUA 1JV2B 1E3VA 2LQVA 4OVMA 2WOHA 2IUJA 1V74A 4OK0A 1K8A4 1EQKA 1U5OA 3CCM3 3V99A 1O7MB 1GY6A 3FF0A 1FGMA 5CLKA 3S29A 1W00A 3UNLA 3JUNA 1FGQA 1QAFA 3NM7A 5HGRA 1DVCA 3ALAA 5BXQA 1L5GB 3LXUX 4EC6A 2WO0A 2CC3A 1M1XB 3S28A 1WMPA 1O7NB 3FKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV7 A;  1MNL A;  5LC6 A;  1GD4 A;  1ROA A;  4N6T A;  1MOL A;  1IV9 A;  1M9G A;  2OCT A;  3IMA B;  1WNH A;  1N5P A;  3PS8 A;  3L0R A;  2W9P A;  4TX4 A;  3PYJ A;  2KXG A;  4N6M A;  4ZM8 A;  3GAX A;  3K9M C;  3KSE D;  2BO9 B;  1A90 A;  1RN7 A;  5ELJ A;  2CH9 A;  3QRD A;  4N6L A;  3S67 A;  5LC7 A;  1R4C A;  3Q2P A;  1TIJ A;  3NX0 A;  1GD3 A;  3UL6 A;  4N6V 0;  1DVD A;  5A0O B;  5ELU A;  4IT7 A;  1NB3 I;  1CYU A;  3UL5 A;  1KWI A;  4LZI A;  4EYC A;  1CYV A;  1FA3 A;  1FUW A;  1G96 A;  1NB5 I;  1A67 A;  3LH4 A;  5EQL A;  4N6N B;  2O9U X;  1CEW I;  4N6U A;  3SVA A;  1STF I;  3PXM A;  1PFP A;  4N6O B;  1EQK A;  1N5H A;  4CCV A;  1DVC A;  3MWZ A;  1LXE A;  3KFQ C;  1N9J A;  2W9Q A;  1YVB I; 
#chains in the Genus database with same CATH topology
 5BIR A;  3CCU 3;  2D42 A;  3HOH A;  3V98 A;  2HMM B;  5IG3 A;  1ROA A;  1AY7 A;  3F9S A;  3F40 A;  1EA2 A;  2GBW B;  2OCT A;  4HBR A;  4PEJ A;  1EG9 B;  4XDW A;  3IPT A;  1OAC A;  2Z6B A;  4MMX B;  5AIG A;  8RNT A;  1HYF A;  1I8V A;  3FCS B;  3FG3 A;  1RKY A;  1AVL A;  4RNT A;  3SOY A;  3O8Y A;  4EW5 A;  4AEQ A;  3NBJ A;  2CG1 A;  4ZM8 A;  3B4O A;  2F98 A;  1G0T A;  1FGT A;  4AKZ A;  1RTU A;  2Y73 A;  3KSE D;  1JZD A;  4RZM A;  3MYT A;  4I5Q A;  2BNG A;  1FZU A;  2BO9 B;  1JN5 B;  6STD A;  5ELJ A;  5IEP A;  2CFK A;  2INX A;  1V58 A;  2CH9 A;  3F7S A;  1IQ8 A;  4KFF A;  3MKI A;  3HK4 A;  2UUG C;  1SPU A;  4ORL A;  1G02 A;  2K3D A;  4K61 A;  2CWV A;  4MMZ B;  5GSP A;  3Q90 A;  1RSN A;  2XEP A;  4HM5 B;  5LC7 A;  5EEO A;  1D6Z A;  5IEN A;  1I0X A;  4FCM A;  3T8U A;  1B2Z A;  1TIJ A;  1Z1S A;  1T5Y A;  2BT3 A;  1JKG B;  1O7H B;  1OF5 A;  1BNR A;  1Q7H A;  4HM7 B;  1RGC A;  3CPO A;  3UL6 A;  1ASK A;  2W56 A;  4R4K A;  1I2F A;  1FUT A;  5CF1 A;  5IF6 A;  1PY3 A;  3J7Y d;  4N6V 0;  3CPW 2;  4FCJ A;  1MWS A;  1C54 A;  7GSP A;  1OHS A;  3NHX A;  1Q81 4;  1FGO A;  1UCJ A;  1US1 A;  3F7X A;  4GL6 A;  5ELU A;  5JPP A;  1YIT 3;  3OWS A;  1MGR A;  2HMO B;  4WYK B;  3X3Y A;  4HM3 B;  1I3F A;  2Z77 A;  5G1K A;  4HKV B;  1UI8 A;  2K54 A;  3KE7 A;  2V1L A;  4BTX A;  3CCV 3;  3G0K A;  1ISK A;  2CX0 A;  1O7G B;  1C7H A;  2BMO B;  4WHA A;  3X3Z A;  2RFR A;  1WQL B;  3CXC 2;  4R80 A;  4X2H A;  1FUW A;  3WMD A;  1YI2 3;  1ROV A;  1JBS A;  3A5E A;  3DGN A;  1DMM A;  1F8N A;  1BRK A;  3NV0 A;  1SII A;  4IPB A;  3X42 A;  1Q82 4;  3AHW A;  4GSP A;  4QWT A;  2FNQ A;  3LH4 A;  2C10 A;  1B2M A;  1O7W B;  2W2C A;  4XB5 A;  3F14 A;  4HM6 B;  1JRQ A;  4LMI A;  4N6N B;  1UUG B;  1DMN A;  3OV4 A;  3FLJ A;  4K90 B;  1DMQ A;  2A15 A;  1CEW I;  1VQ7 3;  1SAR A;  1OGX A;  1NJI 4;  5AI1 A;  3DM8 A;  1JBT A;  2L4V A;  1LRA A;  1RRL A;  3NM2 A;  1KD1 4;  3LT9 A;  1B27 A;  3AGN A;  1N8Q A;  3GZY B;  1GS3 A;  1N9E A;  2C11 A;  1E97 A;  1IDP A;  3B7C A;  2SBL A;  3HZP A;  1BNF A;  4CJN A;  2IA7 A;  3B4P A;  3D79 A;  1ULJ B;  4L8P A;  3WR2 A;  3EN1 B;  4J5G A;  1IYY A;  1Q9E A;  1LXE A;  2W6J H;  3OWU A;  3KFQ C;  1N9J A;  2KAA A;  1ZS7 A;  1YVB I;  1IU7 A;  2W9Q A;  4FMD A;  3X41 A;  5D82 A;  1YGE A;  5M18 A;  1A2K A;  3CC7 3;  3KZT A;  1BUQ A;  2RCD A;  1MNL A;  1JB2 A;  3EQQ B;  5JBS A;  1RN4 A;  1GD4 A;  4N6T A;  1BNI A;  5IW9 A;  1S5A A;  1N8R 4;  3G16 A;  3PZW A;  1QMA A;  3LYG A;  3V92 A;  2F4Y A;  2GXF A;  3VF1 A;  1TU5 A;  3OWY A;  1LVN A;  2C4B A;  2XF3 A;  1BAN A;  2CWT A;  3NUV A;  1N5P A;  3AGO A;  1RHL A;  2IYJ A;  1X1U A;  4H3U A;  5DRE A;  1HU9 A;  2GU1 A;  4K1V A;  3BNC A;  1R4Y A;  5STD A;  3SED A;  1Q40 A;  1VQP 3;  1RCK A;  1IQY A;  1BSE A;  1W02 A;  3PYJ A;  1B21 A;  2KXG A;  2XGN A;  4GB5 A;  3JUM A;  1TUH A;  3BNB A;  5CXO A;  2KCD A;  1SJW A;  5CF2 A;  1T2I A;  1RN7 A;  2P09 A;  5AII A;  1SIH A;  1OGZ A;  3DGL A;  1NDO B;  3LTC A;  3UJM A;  3U1W A;  5BVB A;  1WMN A;  2KF4 A;  4HZB B;  3FG1 A;  3HII A;  4FCZ A;  1MWR A;  1FGR A;  5TGN A;  3FZW A;  3S27 A;  8CHO A;  3D9R A;  4HOH A;  1VQ9 3;  3Q2P A;  5G1L A;  4MJD A;  1TP6 A;  2E2U A;  1UW1 A;  4GHO A;  1BRS A;  4R9L A;  3ROB A;  1BNE A;  7RNT A;  4BL3 A;  1S72 3;  1T2H A;  3LTB A;  1MWU A;  2XH9 A;  4STD A;  1B2U A;  1IVW A;  2W0Q A;  3DGY A;  1GMP A;  1D6U A;  3CCQ 3;  2ZHX B;  4BL2 A;  2WGQ A;  5HOH A;  3EBY A;  2XR8 B;  3NQZ A;  1VQQ A;  4LSO A;  1GY7 A;  1UCL A;  4LYL B;  1RLS A;  1B2X A;  2XRX B;  1RNT A;  1UI7 A;  3D5G A;  1RCL A;  3HI7 A;  4IT7 A;  2YX9 A;  3WOD G;  3X40 A;  6GSP A;  3MG1 A;  1NB3 I;  3WHO A;  1CYU A;  2GSP A;  3ECF A;  2HMN B;  3K5T A;  3PCS A;  4XBX A;  1KWI A;  4O2H A;  3PCR A;  4EYC A;  1Q7Y 4;  3DH2 A;  4HM8 B;  1EUI C;  2BIR A;  1TRQ A;  3CU3 A;  3URP A;  1UGI A;  2YFI B;  5FW5 A;  1G96 A;  2QA4 3;  5M19 A;  4MMY B;  4BTW A;  1JB4 A;  4ILF A;  3F8H A;  2SAR A;  1M1K 4;  4J5K A;  1AV4 A;  4BIR A;  3WA3 A;  2HMK B;  1TJD A;  2MF7 A;  4HM1 B;  4MEI A;  5IG5 A;  2O9U X;  2CFG A;  4FMC A;  4N6U A;  2P0X A;  1CQS A;  3BNE A;  2CFL A;  4IIA A;  1LOW A;  1BRG A;  3LML A;  1VQK 3;  1PYL A;  3STD A;  2QGU A;  3N9H A;  4HVN A;  4EV5 A;  4N6O B;  1RRH A;  3HIG A;  1U8C B;  1I70 A;  3KII A;  3PGB A;  1JB5 A;  3B8L A;  4EBG A;  1K73 4;  4JRF A;  1N5H A;  1BGS A;  4KT3 B;  3MSO A;  1W7C A;  3KKG A;  3DMC A;  1VQM 3;  3GRD A;  2OQE C;  4CCV A;  4X2O A;  3UB1 A;  3OXA A;  4KVH A;  3CCL 3;  3BLZ A;  1O7P B;  1W5Z A;  2K0M A;  2Y74 A;  3AMO A;  2IY2 A;  3MWZ A;  3NBR A;  7STD A;  3OW2 2;  1DE3 A;  1IT8 A;  3DGO A;  2OWP A;  2ML6 A;  1BNS A;  2XSH B;  4N3V A;  5D81 A;  4BU4 A;  1K9M 4;  3T8N A;  2E2T A;  1BRH A;  3GZX B;  3FF2 A;  1BNG A;  1MGW A;  1W6C A;  1BRJ A;  3SX1 A;  4L7K A;  2JDI H;  1QVG 2;  5LC6 A;  5BU4 A;  1OUN A;  1JZO A;  1OHP A;  3JUQ A;  3RDE A;  1W2B 2;  5M1A A;  2P05 A;  1GOV A;  2I9W A;  1VZZ A;  3IMA B;  2OOV C;  1W6Y A;  1YNV X;  4EXR A;  1WNH A;  1BSB A;  3EC9 A;  4KZ1 A;  2L1S A;  2BU4 A;  2OQE A;  1BSA A;  3PS8 A;  4O3V A;  2CW9 A;  3Q1C A;  1TFO A;  5EVH A;  1OCV A;  3ER7 A;  3L0R A;  3WA2 X;  2RGQ A;  2W9P A;  1IVX A;  2P0M A;  1RGF A;  3EE1 A;  2CG0 A;  4KFE A;  1RJO A;  2H0I A;  5IER A;  1YJN 3;  1Q86 4;  2OTJ 3;  1STD A;  2E2V A;  3K9M C;  4Q53 A;  3X3X A;  3WOE B;  1RGH A;  3LT8 A;  1GSP A;  1A90 A;  1QJG A;  2PZV A;  1I2E A;  1TFK A;  1QAK A;  5AEW B;  3CCJ 3;  2GEX A;  1UCK A;  3KCH A;  2F56 A;  4FMA A;  2CHC A;  1BSC A;  1RGG A;  2B1X B;  2OOV A;  2F5W A;  3S67 A;  2P38 A;  3G71 3;  4U13 A;  1RGE A;  2AAD A;  1R4C A;  2ZL8 A;  2KF6 A;  3BU4 A;  4K1U A;  5D83 A;  3GWR A;  5FGO A;  4H61 A;  1AR0 A;  4WFO A;  1T3B A;  1OH0 A;  6RNT A;  2R41 A;  1RGA A;  1GD3 A;  2ML5 A;  3NQY A;  1HZ1 A;  1LNH A;  3EHC A;  5AYS C;  1VQ4 3;  5DRV A;  1JN5 A;  2CFD A;  4HYZ A;  1HKX A;  3EF8 A;  1OPY A;  3EBT A;  3F8X A;  3RNT A;  1JNQ A;  5AEU B;  2MC8 A;  5A0O B;  1VQL 3;  4FR9 A;  3S5C A;  3SXX A;  2GU3 A;  4RBN A;  2KRT A;  1RGL A;  3JUP A;  5KP4 A;  2BMQ B;  2PNC A;  1JKG A;  1X1Y A;  2BHM A;  2RSX A;  1IVV A;  3LTA A;  1CYV A;  3CME 3;  1JJ2 2;  3JVC A;  2YFL B;  1FA3 A;  3KN4 A;  2OTL 3;  1LOX A;  4R9K A;  3GZB A;  1YJ9 3;  3GZR A;  9RNT A;  2CKF B;  1NB5 I;  3SYU A;  3ZFZ A;  4WYK A;  1DET A;  1GOY A;  5AYR B;  1NNV A;  4CPK A;  4KFD A;  2H0H A;  1V57 A;  2CIU A;  3K0Z A;  1YJW 3;  1FW7 A;  2FXT A;  2AAE A;  2UX0 A;  1MWT A;  1WTH A;  3G8Z A;  3JUO A;  3SVA A;  4HAA A;  1SQW A;  2STD A;  1ULI B;  5CK6 A;  4HZ9 B;  1UUW B;  2D1W A;  1W6G A;  1PFP A;  4XBT A;  4DKI A;  3CMA 3;  3BND A;  1NWW A;  4BTY A;  1RGK A;  2UGI A;  4RNZ A;  2M7O A;  1VQN 3;  3EN8 A;  4FMB A;  3LOY A;  1BAO A;  1CH0 A;  3DGM A;  4HM0 B;  2XFT A;  4NPB A;  1LQM B;  3I56 3;  3MHE A;  1GOU A;  1W01 A;  5AIH A;  1VQ5 3;  2KF5 A;  1KSI A;  1D6Y A;  3MG2 A;  1AQZ A;  3BIR A;  1A2P A;  3EB8 A;  1VQ6 3;  1JBR A;  1M90 4;  2IMJ A;  2W03 A;  1BNJ A;  1KQS 2;  1EKM A;  3CCE 3;  1Q40 B;  2XGL A;  3CCS 3;  3MPH A;  2ZA4 A;  3CNM A;  1IV7 A;  1J2B A;  1KC8 4;  4WWU C;  3DZL A;  4LEH A;  2Q07 A;  3EJV A;  3LTD A;  1MOL A;  1IV9 A;  3BB9 A;  1M9G A;  2H0G A;  2J8X B;  4J8T A;  5I97 A;  1B2S A;  1BOX A;  2WOF A;  2F86 B;  1ZGX A;  4XM4 A;  3OX9 A;  1Q42 A;  2ZDJ A;  1A2V A;  1UCI A;  2XSO B;  5JPU A;  2O3O A;  2LYX A;  4JF8 A;  3A76 A;  2CWU A;  3IJE B;  2RBI A;  4WP5 A;  3QK9 A;  4OUQ A;  2GEY A;  3N54 B;  4TX4 A;  1QVF 2;  2Z76 A;  4N6M A;  2F99 A;  3GAX A;  3M8C A;  3FG4 A;  5G2G A;  4CDL A;  3CCR 3;  1B3S A;  5KP1 A;  2QEX 3;  2WGO A;  1Y4K A;  3K63 A;  1DYU A;  1W4N A;  1GYB A;  3G4S 3;  3ZG0 A;  5IG4 A;  2XFS A;  2CFW A;  3FGY A;  3QRD A;  4N6L A;  3RGR A;  3WDG B;  5IG0 A;  3CC2 3;  3RGA A;  1BUJ A;  1UUV B;  3CNX A;  3TDG A;  1WMO A;  4XDV A;  1K41 A;  1RDS A;  1YIJ 3;  1RNB A;  1TTO A;  3Q3F A;  3ZG5 A;  3GSP A;  3D3L A;  1X1X A;  2IUK A;  3DY5 A;  3EX9 A;  4HM4 B;  3NX0 A;  3DUK A;  2Z7A A;  4EV2 A;  3FH1 A;  3H51 A;  5AIF A;  1RMS A;  1GMR A;  1BVI A;  1BIR A;  2QIY A;  3VGN A;  3DXO A;  2JQ5 A;  3SOA A;  1IQX A;  1ZX2 A;  1YVS A;  1IT7 A;  3VSY A;  2HMJ B;  1OF5 B;  3I55 3;  1VQ8 3;  1DVD A;  3CC4 3;  1X1W A;  1E3R A;  2HOH A;  3E99 A;  1VQO 3;  1YHQ 3;  3NXJ A;  1IVU A;  1BU4 A;  2W56 B;  1K28 A;  1OHO A;  3D5I A;  3NBB A;  1I3I A;  2BMR B;  1IK3 A;  2YFJ B;  3HX8 A;  3UL5 A;  1PU4 A;  1LQG C;  4LZI A;  4RNY A;  1NU3 A;  3U97 A;  3KSP A;  4O02 B;  4NHF A;  3WOF B;  2RNT A;  1UDI I;  4HJL B;  1BSD A;  1NO3 A;  2CX1 A;  3G6E 3;  4I4K A;  2CK3 H;  3I0Y A;  3LZA A;  2R4I A;  1W2Z A;  4L8O A;  4NRE A;  5RNT A;  1FYS A;  2GBX B;  2KF3 A;  3K7C A;  4O8S A;  4R1K A;  5KP3 A;  3FSD A;  1A67 A;  2W04 A;  1ZO2 A;  5EQL A;  1GY5 A;  3T0U A;  3CD6 3;  3N8B A;  1UGH I;  3D4A A;  1AVK A;  3NV0 B;  2B24 B;  4XBY A;  4G1M B;  2FGT A;  1LOV A;  4J9A A;  3AMO B;  3MG3 A;  4AKY A;  4LGQ A;  1BRN L;  1TRP A;  1STF I;  4HM2 B;  1QAL A;  2HML B;  5IEO A;  3PXM A;  3H3H A;  3SLU A;  1JV2 B;  1E3V A;  2LQV A;  4OVM A;  1BRI A;  2WOH A;  2IUJ A;  1V74 A;  4OK0 A;  1K8A 4;  1EQK A;  1U5O A;  3CCM 3;  1B20 A;  1RN1 A;  3V99 A;  1O7M B;  1GY6 A;  3FF0 A;  1FUS A;  1FGM A;  1YGW A;  5CLK A;  1W00 A;  3S29 A;  1LNI A;  3JUN A;  3UNL A;  1FGQ A;  1I0V A;  1QAF A;  3NM7 A;  5HGR A;  1EEJ A;  1I2G A;  1DVC A;  3ALA A;  3AHS A;  5BXQ A;  1L5G B;  3LXU X;  4EC6 A;  2F5M A;  2WO0 A;  2CC3 A;  1M1X B;  3S28 A;  1WMP A;  1O7N B;  1GMQ A;  3FKA A;  1LOY A; 
#chains in the Genus database with same CATH homology
 3CCU 3;  2D42 A;  3V98 A;  2HMM B;  5IG3 A;  1ROA A;  3F9S A;  3F40 A;  1EA2 A;  2GBW B;  2OCT A;  4HBR A;  4PEJ A;  1EG9 B;  4XDW A;  3IPT A;  1OAC A;  2Z6B A;  4MMX B;  5AIG A;  3FCS B;  3FG3 A;  1RKY A;  1AVL A;  3SOY A;  3O8Y A;  4AEQ A;  3NBJ A;  2CG1 A;  4ZM8 A;  3B4O A;  2F98 A;  1FGT A;  4AKZ A;  2Y73 A;  3KSE D;  4RZM A;  5IEP A;  3MYT A;  2BNG A;  2BO9 B;  1JN5 B;  6STD A;  5ELJ A;  2CFK A;  2INX A;  3F7S A;  2CH9 A;  1IQ8 A;  4KFF A;  3MKI A;  3HK4 A;  1SPU A;  4ORL A;  4K61 A;  2CWV A;  4MMZ B;  3Q90 A;  4HM5 B;  2XEP A;  5LC7 A;  5EEO A;  1D6Z A;  5IEN A;  4FCM A;  3T8U A;  1TIJ A;  1Z1S A;  1T5Y A;  2BT3 A;  1JKG B;  1O7H B;  1OF5 A;  4HM7 B;  3CPO A;  3UL6 A;  1ASK A;  2W56 A;  4R4K A;  5CF1 A;  5IF6 A;  3J7Y d;  4N6V 0;  3CPW 2;  4FCJ A;  1OHS A;  3NHX A;  1Q81 4;  1FGO A;  1US1 A;  3F7X A;  5ELU A;  4GL6 A;  5JPP A;  1YIT 3;  3OWS A;  2HMO B;  4WYK B;  3X3Y A;  4HM3 B;  2Z77 A;  4HKV B;  1UI8 A;  2K54 A;  3KE7 A;  2V1L A;  4BTX A;  3CCV 3;  3G0K A;  1ISK A;  1O7G B;  1C7H A;  2BMO B;  4WHA A;  3X3Z A;  2RFR A;  1WQL B;  3CXC 2;  4R80 A;  4X2H A;  1FUW A;  3WMD A;  1YI2 3;  1ROV A;  3DGN A;  1DMM A;  1F8N A;  3NV0 A;  1SII A;  4IPB A;  3X42 A;  1Q82 4;  4QWT A;  2FNQ A;  3LH4 A;  2C10 A;  1O7W B;  2W2C A;  4XB5 A;  3F14 A;  4HM6 B;  1JRQ A;  4LMI A;  4N6N B;  1DMN A;  3OV4 A;  3FLJ A;  4K90 B;  1DMQ A;  2A15 A;  1CEW I;  1VQ7 3;  1OGX A;  1NJI 4;  5AI1 A;  3DM8 A;  2L4V A;  1RRL A;  3NM2 A;  1KD1 4;  3LT9 A;  1N8Q A;  3GZY B;  1GS3 A;  1N9E A;  2C11 A;  1E97 A;  1IDP A;  3B7C A;  2SBL A;  3HZP A;  2IA7 A;  3B4P A;  1ULJ B;  4L8P A;  3EN1 B;  2W6J H;  1LXE A;  3OWU A;  3KFQ C;  1N9J A;  2W9Q A;  3X41 A;  1YVB I;  1IU7 A;  4FMD A;  5D82 A;  1YGE A;  1A2K A;  3CC7 3;  3KZT A;  1BUQ A;  2RCD A;  1MNL A;  1JB2 A;  3EQQ B;  5JBS A;  1GD4 A;  4N6T A;  5IW9 A;  1N8R 4;  1S5A A;  3G16 A;  3PZW A;  1QMA A;  3LYG A;  3V92 A;  1TU5 A;  2GXF A;  3VF1 A;  3OWY A;  1LVN A;  2XF3 A;  2CWT A;  3NUV A;  1N5P A;  5DRE A;  4H3U A;  1HU9 A;  2GU1 A;  4K1V A;  3BNC A;  5STD A;  3SED A;  1Q40 A;  1VQP 3;  1IQY A;  1W02 A;  3PYJ A;  2KXG A;  2XGN A;  4GB5 A;  3JUM A;  1TUH A;  3BNB A;  5CXO A;  2KCD A;  1SJW A;  5CF2 A;  1RN7 A;  2P09 A;  5AII A;  1SIH A;  1OGZ A;  3DGL A;  1NDO B;  3LTC A;  3UJM A;  3U1W A;  5BVB A;  1WMN A;  4HZB B;  3FG1 A;  3HII A;  4FCZ A;  1FGR A;  5TGN A;  3FZW A;  3S27 A;  8CHO A;  3D9R A;  1VQ9 3;  3Q2P A;  4MJD A;  1TP6 A;  2E2U A;  1UW1 A;  4R9L A;  3ROB A;  1S72 3;  3LTB A;  2XH9 A;  4STD A;  1IVW A;  2W0Q A;  1D6U A;  3CCQ 3;  2WGQ A;  3EBY A;  2XR8 B;  3NQZ A;  4LSO A;  1GY7 A;  2XRX B;  1UI7 A;  3HI7 A;  3WOD G;  4IT7 A;  2YX9 A;  3X40 A;  3MG1 A;  1NB3 I;  1CYU A;  3ECF A;  2HMN B;  3K5T A;  3PCS A;  4XBX A;  1KWI A;  4O2H A;  3PCR A;  4EYC A;  1Q7Y 4;  4HM8 B;  3CU3 A;  2YFI B;  5FW5 A;  1G96 A;  2QA4 3;  4MMY B;  4BTW A;  1JB4 A;  3F8H A;  1M1K 4;  1AV4 A;  3WA3 A;  2HMK B;  2MF7 A;  4HM1 B;  4MEI A;  5IG5 A;  2O9U X;  2CFG A;  4FMC A;  4N6U A;  2P0X A;  1CQS A;  3BNE A;  2CFL A;  4IIA A;  3LML A;  1VQK 3;  3STD A;  2QGU A;  3N9H A;  4HVN A;  4EV5 A;  4N6O B;  1RRH A;  3HIG A;  1U8C B;  3KII A;  3PGB A;  1JB5 A;  3B8L A;  4EBG A;  1K73 4;  4JRF A;  1N5H A;  3MSO A;  1W7C A;  3KKG A;  3DMC A;  1VQM 3;  3GRD A;  2OQE C;  4CCV A;  4X2O A;  3UB1 A;  3OXA A;  4KVH A;  3CCL 3;  3BLZ A;  1O7P B;  1W5Z A;  2K0M A;  2Y74 A;  3AMO A;  3MWZ A;  3NBR A;  3OW2 2;  7STD A;  1IT8 A;  3DGO A;  2OWP A;  2ML6 A;  4N3V A;  2XSH B;  5D81 A;  1K9M 4;  3T8N A;  2E2T A;  3GZX B;  3FF2 A;  1W6C A;  3SX1 A;  4L7K A;  2JDI H;  1QVG 2;  5LC6 A;  1OUN A;  1OHP A;  3JUQ A;  3RDE A;  1W2B 2;  2P05 A;  2I9W A;  1VZZ A;  3IMA B;  2OOV C;  1W6Y A;  4EXR A;  1WNH A;  3EC9 A;  4KZ1 A;  2OQE A;  3PS8 A;  4O3V A;  2CW9 A;  3Q1C A;  1TFO A;  5EVH A;  1OCV A;  3ER7 A;  3L0R A;  3WA2 X;  2RGQ A;  2W9P A;  1IVX A;  2P0M A;  3EE1 A;  2CG0 A;  4KFE A;  1RJO A;  5IER A;  1YJN 3;  1Q86 4;  2OTJ 3;  1STD A;  2E2V A;  3K9M C;  4Q53 A;  3X3X A;  3WOE B;  3LT8 A;  1A90 A;  1QJG A;  2PZV A;  1TFK A;  1QAK A;  5AEW B;  3CCJ 3;  2GEX A;  4FMA A;  2CHC A;  2B1X B;  2OOV A;  3S67 A;  2P38 A;  3G71 3;  4U13 A;  2ZL8 A;  1R4C A;  4K1U A;  5FGO A;  5D83 A;  3GWR A;  4H61 A;  1AR0 A;  4WFO A;  1OH0 A;  1GD3 A;  2ML5 A;  3NQY A;  1LNH A;  3EHC A;  5AYS C;  1VQ4 3;  5DRV A;  1JN5 A;  2CFD A;  4HYZ A;  1HKX A;  3EF8 A;  1OPY A;  3EBT A;  3F8X A;  5AEU B;  1JNQ A;  1VQL 3;  2MC8 A;  5A0O B;  4FR9 A;  3S5C A;  3SXX A;  2GU3 A;  4RBN A;  2KRT A;  3JUP A;  5KP4 A;  2BMQ B;  2PNC A;  1JKG A;  2BHM A;  2RSX A;  1IVV A;  3LTA A;  1CYV A;  3CME 3;  1JJ2 2;  3JVC A;  2YFL B;  1FA3 A;  3KN4 A;  2OTL 3;  1LOX A;  4R9K A;  3GZB A;  1YJ9 3;  3GZR A;  2CKF B;  1NB5 I;  4WYK A;  5AYR B;  4KFD A;  2CIU A;  3K0Z A;  1YJW 3;  2FXT A;  2UX0 A;  1WTH A;  3G8Z A;  3JUO A;  3SVA A;  1SQW A;  2STD A;  1ULI B;  5CK6 A;  4HZ9 B;  1UUW B;  2D1W A;  1W6G A;  1PFP A;  4XBT A;  3CMA 3;  3BND A;  1NWW A;  4BTY A;  4RNZ A;  2M7O A;  1VQN 3;  3EN8 A;  4FMB A;  3LOY A;  3DGM A;  4HM0 B;  2XFT A;  3I56 3;  3MHE A;  1W01 A;  1VQ5 3;  5AIH A;  1KSI A;  1D6Y A;  3MG2 A;  3EB8 A;  1VQ6 3;  1M90 4;  2IMJ A;  2W03 A;  1KQS 2;  1EKM A;  3CCE 3;  1Q40 B;  2XGL A;  3CCS 3;  3MPH A;  3CNM A;  1J2B A;  1IV7 A;  1KC8 4;  4WWU C;  3DZL A;  4LEH A;  2Q07 A;  3EJV A;  3LTD A;  1MOL A;  1IV9 A;  3BB9 A;  1M9G A;  4J8T A;  5I97 A;  2WOF A;  2F86 B;  4XM4 A;  3OX9 A;  1Q42 A;  2ZDJ A;  1A2V A;  2XSO B;  5JPU A;  2O3O A;  2LYX A;  4JF8 A;  3A76 A;  2CWU A;  3IJE B;  4WP5 A;  3QK9 A;  4OUQ A;  2GEY A;  3N54 B;  4TX4 A;  1QVF 2;  2Z76 A;  4N6M A;  2F99 A;  3GAX A;  3M8C A;  3FG4 A;  5G2G A;  4CDL A;  3CCR 3;  2QEX 3;  5KP1 A;  2WGO A;  1Y4K A;  3K63 A;  1DYU A;  1W4N A;  1GYB A;  3G4S 3;  5IG4 A;  2XFS A;  2CFW A;  3FGY A;  3QRD A;  4N6L A;  3RGR A;  3WDG B;  5IG0 A;  3CC2 3;  3RGA A;  1UUV B;  3CNX A;  3TDG A;  1WMO A;  4XDV A;  1K41 A;  1YIJ 3;  3D3L A;  2IUK A;  3DY5 A;  3EX9 A;  4HM4 B;  3NX0 A;  3DUK A;  2Z7A A;  4EV2 A;  3FH1 A;  3H51 A;  5AIF A;  2QIY A;  3VGN A;  3DXO A;  2JQ5 A;  3SOA A;  1IQX A;  1ZX2 A;  1IT7 A;  3VSY A;  2HMJ B;  1OF5 B;  3I55 3;  1VQ8 3;  1DVD A;  3CC4 3;  3E99 A;  1E3R A;  1YHQ 3;  1VQO 3;  3NXJ A;  1IVU A;  2W56 B;  1K28 A;  1OHO A;  3NBB A;  2BMR B;  1IK3 A;  2YFJ B;  3HX8 A;  3UL5 A;  1PU4 A;  4LZI A;  4RNY A;  1NU3 A;  3U97 A;  3KSP A;  4O02 B;  4NHF A;  3WOF B;  4HJL B;  1NO3 A;  3G6E 3;  4I4K A;  2CK3 H;  3I0Y A;  3LZA A;  2R4I A;  1W2Z A;  4L8O A;  4NRE A;  2GBX B;  5KP3 A;  3K7C A;  4O8S A;  4R1K A;  3FSD A;  1A67 A;  2W04 A;  1ZO2 A;  5EQL A;  1GY5 A;  3T0U A;  3CD6 3;  3N8B A;  3NV0 B;  1AVK A;  4XBY A;  2B24 B;  4G1M B;  2FGT A;  4J9A A;  3AMO B;  3MG3 A;  4AKY A;  4LGQ A;  1STF I;  4HM2 B;  1QAL A;  2HML B;  5IEO A;  3PXM A;  3H3H A;  3SLU A;  1JV2 B;  1E3V A;  2LQV A;  4OVM A;  2WOH A;  2IUJ A;  1V74 A;  4OK0 A;  1K8A 4;  1EQK A;  1U5O A;  3CCM 3;  3V99 A;  1O7M B;  1GY6 A;  3FF0 A;  1FGM A;  5CLK A;  3S29 A;  1W00 A;  3UNL A;  3JUN A;  1FGQ A;  1QAF A;  3NM7 A;  5HGR A;  1DVC A;  3ALA A;  5BXQ A;  1L5G B;  3LXU X;  4EC6 A;  2WO0 A;  2CC3 A;  1M1X B;  3S28 A;  1WMP A;  1O7N B;  3FKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...