3SVAA

Crystal structure of v57d mutant of human cystatin c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
b'VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIDAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
molecule tags Hydrolase inhibitor
source organism Homo sapiens
publication title Structural characterization of V57D and V57P mutants of human cystatin C, an amyloidogenic protein.
pubmed doi rcsb
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3svaA00
4N6UA 3UL5A 2O9UX 5A0OB 3PS8A 4LZIA 5LC7A 1A67A 3S67A 1EQKA 4TX4A 3QRDA 1FUWA 2KXGA 3MWZA 2OCTA 4CCVA 1CYVA 4N6OB 1DVCA 3KFQC 4N6V0 5ELJA 3UL6A 1N5PA 1N5HA 1FA3A 1GD4A 3LH4A 1G96A 1NB3I 4IT7A 1NB5I 3Q2PA 3PXMA 3GAXA 4N6TA 1RN7A 1CEWI 1M9GA 1GD3A 1MNLA 1ROAA 1YVBI 3PYJA 5LC6A 1IV9A 4N6MA 1STFI 4EYCA 1CYUA 1WNHA 2W9PA 3KSED 5EQLA 4N6LA 2CH9A 2BO9B 2W9QA 4N6NB 1N9JA 1A90A 4ZM8A 1KWIA 3K9MC 3L0RA 1DVDA 3IMAB 1IV7A 5ELUA 1PFPA 3NX0A 1MOLA 1R4CA 3SVAA 1LXEA 1TIJA
chains in the Genus database with same CATH superfamily
4ILFA 2HOHA 4BTXA 2AAEA 2KF6A 5IEPA 1IVWA 3T0UA 2ZHXB 3ALAA 3CCV3 1B27A 1BSEA 3FF0A 1JBRA 4N3VA 1RJOA 2H0IA 1BU4A 4R9KA 3F7SA 1FGTA 5KP1A 3VSYA 1TRQA 4HAAA 1RN4A 1VQ73 2J8XB 1LNHA 3DMCA 1B21A 5JPPA 3OWUA 3B8LA 2CWTA 1I3IA 1CEWI 1I70A 1FGMA 4I5QA 3WA2X 1TUHA 2Q07A 1BSBA 4WYKB 5FGOA 1N9EA 2V1LA 3UNLA 3DH2A 4FMCA 1A2VA 5I97A 1JN5A 3LMLA 4H61A 1FW7A 3JVCA 3EQQB 1UUWB 3DUKA 2R4IA 1X1YA 4O3VA 5IENA 1ULIB 1OACA 4J5KA 5LC7A 1IVXA 1M1K4 1W4NA 3DXOA 3F9SA 4HVNA 5AIFA 5AI1A 4CCVA 1DVCA 1TJDA 1W01A 1VQ93 1G0TA 1RGHA 5HGRA 3UL6A 1N5HA 3K63A 3EBTA 1IK3A 1K9M4 3BNEA 1NB5I 1BRGA 1ROVA 2RBIA 4XM4A 2RNTA 4O2HA 1E97A 3FKAA 3O8YA 3STDA 1LNIA 3AMOB 5G1LA 1STFI 3JUMA 4AKYA 9RNTA 4L8PA 3AHSA 1RHLA 3EN8A 1BRJA 4EV5A 3VGNA 4L8OA 2F99A 1SPUA 4KFEA 3CCR3 3WODG 3RNTA 2GEXA 2XH9A 1Q40B 5IG4A 3G0KA 1OGXA 2F5MA 3QRDA 3U1WA 2W04A 1TTOA 1ZGXA 4NHFA 1BNEA 1RTUA 3KFQC 3Q3FA 1JV2B 2C4BA 5AYSC 3NXJA 2CFGA 1GOVA 1LOYA 3X40A 4O8SA 1B2UA 3FG3A 3SLUA 3WOFB 1Q864 1NWWA 1BRIA 1QAKA 5EEOA 3EF8A 1YNVX 4EYCA 4MMZB 4N6NB 2CX0A 2BIRA 4HM8B 3MSOA 1M1XB 3CD63 1NO3A 3M8CA 4IPBA 4K61A 2P0XA 2CC3A 2W56B 1J2BA 3BNCA 2O9UX 4TX4A 2YFIB 1FGQA 5KP3A 4WWUC 3NBBA 2KCDA 4KFFA 1CYVA 4WP5A 3G4S3 2SBLA 3BLZA 3G8ZA 3GWRA 3NM2A 1JZDA 1FUSA 3IPTA 3S28A 2HMLB 2D42A 2WO0A 1LQGC 1Q7HA 2BT3A 3A5EA 1IQXA 1I3FA 4NREA 3X3ZA 5IG3A 4R80A 2UGIA 4HM1B 3CC43 1I2EA 2W9PA 4BIRA 1AY7A 2STDA 4CPKA 1IVVA 2CG0A 3U97A 3DGYA 2RSXA 4OVMA 5AIHA 1N8QA 1VZZA 1W6CA 2LYXA 3GZYB 3LYGA 4HBRA 3FG1A 3SEDA 3MG3A 5AYRB 1K734 1LXEA 1MWUA 5A0OB 3NBRA 5BU4A 3AMOA 3PGBA 3H3HA 1IQ8A 2Z6BA 4WHAA 3DGOA 4BTYA 1AQZA 2BNGA 3K0ZA 2H0GA 1VQL3 2OQEA 4R4KA 4RNZA 1JB2A 1NJI4 1SIHA 5STDA 2IY2A 4RNTA 1JZOA 3EE1A 1QALA 1UW1A 3MKIA 1BNJA 1V58A 1G02A 1MNLA 1GD3A 2F98A 3N9HA 2I9WA 3DGLA 3JUPA 1DMMA 2ZA4A 1MGWA 2AADA 1QJGA 1ZX2A 1BSCA 2W9QA 3LTBA 1JKGA 4LSOA 1T2IA 5DRVA 5JBSA 1UCKA 3BNBA 4KFDA 3EX9A 5AIIA 3CMA3 2GBWB 1IT8A 1MOLA 2ZDJA 3X41A 3UJMA 2RGQA 2HMMB 4BTWA 1WMPA 3CNMA 3ZG5A 2KF5A 4KT3B 1FUWA 4BL3A 1U8CB 1LOVA 1ISKA 1UI7A 1Q824 5AEWB 1O7GB 2K3DA 3LXUX 1C7HA 2OQEC 1N5PA 1VQO3 1WMNA 1OHPA 4HM4B 4RZMA 3G713 2HMKB 3X3YA 3GAXA 4HKVB 2CFDA 1BSDA 4HM5B 5IW9A 1Y4KA 1VQ53 2GEYA 4EV2A 1W2B2 2WOHA 1JBSA 3FF2A 1FYSA 3WMDA 4R1KA 3CC73 1LRAA 4RNYA 1KWIA 1VQM3 1ASKA 3F40A 4BU4A 7STDA 1RGKA 1UDII 3CCJ3 5BVBA 3KSPA 1IQYA 5AEUB 5BXQA 1A67A 2W2CA 1RKYA 3LZAA 3HIGA 5ELJA 1WQLB 4JRFA 1BNIA 1I0XA 1LQMB 1YGWA 4ORLA 2IUJA 2FXTA 1BANA 1GD4A 3F8XA 1NB3I 4IT7A 3RDEA 3HX8A 1HU9A 2O3OA 3PZWA 3G6E3 1SJWA 5IG0A 1BRKA 2CFLA 3D9RA 1PYLA 4RBNA 1AVKA 1V57A 2W56A 4N6LA 2BO9B 1UGHI 2INXA 3SX1A 1DE3A 3LTAA 1W5ZA 4J8TA 3B7CA 5CLKA 3MG2A 1IV7A 1EKMA 2C11A 3CC23 2OTL3 3IJEB 3JUOA 4EBGA 1PU4A 7RNTA 3LT8A 3JUQA 3OV4A 1QVF2 3DZLA 2IA7A 1IDPA 2MF7A 2RFRA 2XSOB 1JJ22 1JN5B 3FCSB 1RGGA 2HMJB 3EBYA 4HJLB 3BU4A 4HZ9B 3WR2A 1UCLA 2CG1A 4J9AA 7GSPA 2W03A 4Q53A 1JRQA 4HM0B 1A2PA 3D5GA 1FZUA 3TDGA 3HK4A 3EN1B 4LMIA 1GMPA 3MYTA 4FMAA 3KE7A 1Q7Y4 4MMXB 2L4VA 5G2GA 1HZ1A 4QWTA 3NUVA 2WGQA 4OUQA 1BNFA 2QIYA 1VQQA 2XF3A 3D3LA 3EB8A 2QEX3 8CHOA 2UX0A 2GU3A 2CKFB 4LZIA 1RGLA 3E99A 1O7MB 4HM3B 1GOYA 1Z1SA 2XGNA 4HM2B 4KZ1A 3CCL3 1KQS2 1JKGB 1W6GA 3JUNA 2ML5A 2W0QA 3RGRA 1G96A 2CFWA 2FGTA 3D5IA 3FSDA 3MPHA 3MHEA 4FMDA 1OCVA 2QA43 1YGEA 3PCSA 5HOHA 3CNXA 1W2ZA 3DGMA 1O7PB 2M7OA 4HM7B 3HI7A 3DGNA 1RGFA 1OF5B 1RRHA 2CW9A 1WMOA 1RGEA 1RN1A 2P05A 2YX9A 1NNVA 1YIT3 2KAAA 2YFLB 2Z7AA 3QK9A 1UCJA 3NX0A 1R4CA 2GU1A 4H3UA 4XBYA 3CCE3 1F8NA 2R41A 1BSAA 1IYYA 3BB9A 3WA3A 5TGNA 1GY7A 1O7HB 1STDA 3KIIA 4K1UA 4N6V0 3WDGB 3X42A 1BNRA 1MWRA 3EJVA 3UB1A 1E3VA 1YJN3 2P09A 1E3RA 4EC6A 4LGQA 1BUJA 1D6ZA 1I2GA 2ML6A 3HZPA 4X2OA 1AVLA 3NV0B 1SARA 1LVNA 4HZBB 4O02B 4U13A 5DREA 1S723 3FH1A 4XBTA 4HOHA 2E2VA 2ZL8A 1O7WB 1GMQA 2IMJA 5D83A 1N9JA 8RNTA 1EEJA 1RRLA 1BNGA 3X3XA 5ELUA 3S29A 1DVDA 5CXOA 5CF2A 3MG1A 1RGAA 1BVIA 4AKZA 1IVUA 1OPYA 2BMQB 2D1WA 3FLJA 3NHXA 2MC8A 3S67A 1B2SA 2KXGA 3MWZA 1JBTA 1OUNA 4N6OB 1RNBA 2JQ5A 2XFTA 4L7KA 1Q42A 1EUIC 3SXXA 5EVHA 1KSIA 4MJDA 4GL6A 4LYLB 3Q2PA 1VQ43 1AR0A 4N6TA 1L5GB 4OK0A 3GZRA 1MWSA 1I2FA 1YVSA 1YVBI 3KKGA 3NV0A 5AIGA 3CCQ3 1I0VA 1IV9A 1BRHA 1DMQA 2XSHB 3B4PA 2KF4A 2F4YA 6GSPA 1CH0A 2Y74A 2Z76A 1OGZA 3L0RA 1KC84 3ROBA 2JDIH 1OH0A 1W02A 3LOYA 1TP6A 3PS8A 4XDWA 2CWVA 1QAFA 2OCTA 3OWYA 4FR9A 1RCLA 2WGOA 1X1XA 2BU4A 3I0YA 3KN4A 1AV4A 3Q1CA 2XR8B 4FCJA 3EHCA 3FG4A 1QVG2 3CU3A 5CK6A 1NU3A 6RNTA 4J5GA 3LTCA 4X2HA 3ZG0A 2GXFA 1TFOA 2K0MA 1M904 1W6YA 2PZVA 1TRPA 3FGYA 2Z77A 1YHQ3 2E2UA 1GS3A 2HMOB 3URPA 1BUQA 1RGCA 1B2ZA 3NQYA 1HKXA 2FNQA 1A90A 1VQP3 1BAOA 1B2XA 6STDA 3J7Yd 4PEJA 5IF6A 3OWSA 3G16A 3CCM3 3GZBA 5G1KA 5M1AA 1VQN3 2RCDA 3UL5A 5RNTA 4IIAA 1I8VA 3BIRA 3KCHA 2KF3A 2W6JH 1YJW3 1R4YA 3GSPA 3V92A 1OHSA 3LTDA 2OTJ3 4EXRA 3V98A 1ZS7A 1RSNA 4HM6B 3LH4A 1IT7A 1EA2A 4K1VA 3AGNA 3Q90A 1RNTA 1K28A 1M9GA 1GYBA 1C54A 1ULJB 1DETA 1OHOA 3DM8A 2XGLA 3KSED 1DMNA 3FZWA 3S27A 4BL2A 2CH9A 3HOHA 3EC9A 1ZO2A 1O7NB 4ZM8A 5D82A 1B20A 1RDSA 2KRTA 2H0HA 3CXC2 1S5AA 4FCZA 2CK3H 1BOXA 1GY6A 1RMSA 3NM7A 4WYKA 1SQWA 5IERA 3DY5A 1JNQA 4N6UA 3F14A 3T8NA 1UUGB 3CPW2 3PCRA 1FUTA 1BNSA 1GMRA 4FMBA 4K90B 2OOVA 1HYFA 2BHMA 4HYZA 2LQVA 3OXAA 3SOAA 5BIRA 4NPBA 2A15A 1W7CA 2BMOB 2XEPA 1JB5A 3AGOA 2PNCA 3NQZA 2CIUA 2GSPA 1BRNL 2CX1A 3ECFA 4R9LA 1B2MA 4CDLA 1RN7A 1WTHA 2CFKA 4WFOA 5CF1A 4N6MA 5D81A 1PY3A 1MGRA 1CQSA 5EQLA 3CCU3 4STDA 3I563 1GY5A 1V74A 4G1MB 1N8R4 2P0MA 4KVHA 1GSPA 3OW22 5IG5A 3SOYA 3I553 3SVAA 1OF5A 4GSPA 3CCS3 4JF8A 1K41A 1QMAA 1X1UA 3N8BA 3ZFZA 2SARA 1SIIA 3F7XA 5M19A 4GHOA 1EQKA 1T2HA 1LOXA 2F86B 2GBXB 3CPOA 3RGAA 5GSPA 3S5CA 2Y73A 2XRXB 4CJNA 4XDVA 1UCIA 3H51A 3WHOA 4MMYB 3ER7A 1Q40A 2IUKA 3NBJA 2F56A 3HIIA 1D6YA 1BIRA 1FGOA 3GRDA 3VF1A 2K54A 4XBXA 1U5OA 1B3SA 1VQK3 2CWUA 1VQ63 2OOVC 1A2KA 1RCKA 5JPUA 4GB5A 1UGIA 2P38A 1LOWA 3K9MC 5M18A 3V99A 1YIJ3 1TFKA 2WOFA 1IU7A 2IYJA 2UUGC 1US1A 3D79A 2HMNB 3GZXB 2OWPA 3LT9A 1D6UA 3SYUA 1EG9B 2L1SA 4DKIA 4EW5A 3KZTA 4MEIA 2F5WA 3A76A 2BMRB 1Q814 2QGUA 2C10A 5KP4A 1KD14 1FA3A 1MWTA 1NDOB 2XFSA 4FCMA 1X1WA 5FW5A 3OX9A 3F8HA 3PXMA 4LEHA 3T8UA 2YFJB 2B24B 3D4AA 3PYJA 1ROAA 1FGRA 3AHWA 3BNDA 5LC6A 1T5YA 1BGSA 4XB5A 1TU5A 1UI8A 1Q9EA 1WNHA 3K5TA 1T3BA 1DYUA 5IEOA 3WOEB 1CYUA 1BRSA 3B4OA 1UUVB 1W00A 1YI23 1K8A4 1VQ83 4I4KA 1JB4A 1GOUA 3K7CA 3IMAB 2CHCA 1PFPA 3CME3 4AEQA 2E2TA 1RLSA 3N54B 1YJ93 1TIJA 2B1XB
chains in the Genus database with same CATH topology
4BTXA 5IEPA 1IVWA 3T0UA 3ALAA 3CCV3 3FF0A 4N3VA 1RJOA 5KP1A 4R9KA 3F7SA 1FGTA 3VSYA 1VQ73 1LNHA 3DMCA 5JPPA 3OWUA 3B8LA 2CWTA 1CEWI 1FGMA 3WA2X 1TUHA 2Q07A 4WYKB 5FGOA 1N9EA 2V1LA 3UNLA 4FMCA 1A2VA 5I97A 1JN5A 3LMLA 4H61A 3JVCA 3EQQB 1UUWB 3DUKA 2R4IA 4O3VA 5IENA 1ULIB 1OACA 5LC7A 1M1K4 1IVXA 1W4NA 3DXOA 3F9SA 4HVNA 5AIFA 5AI1A 4CCVA 1DVCA 1W01A 1VQ93 5HGRA 3UL6A 1N5HA 3K63A 3EBTA 1IK3A 1K9M4 3BNEA 1NB5I 1ROVA 4XM4A 4O2HA 1E97A 3FKAA 3O8YA 3STDA 3AMOB 1STFI 3JUMA 4AKYA 4L8PA 4EV5A 3EN8A 3VGNA 4L8OA 2F99A 1SPUA 4KFEA 3CCR3 3WODG 2GEXA 2XH9A 1Q40B 5IG4A 3G0KA 1OGXA 3QRDA 3U1WA 2W04A 4NHFA 3KFQC 1JV2B 5AYSC 3NXJA 2CFGA 3X40A 4O8SA 3FG3A 3SLUA 3WOFB 1Q864 1NWWA 1QAKA 5EEOA 3EF8A 4EYCA 4MMZB 4N6NB 4HM8B 3MSOA 1M1XB 3CD63 1NO3A 3M8CA 4IPBA 4K61A 2P0XA 2CC3A 2W56B 1J2BA 3BNCA 2O9UX 4TX4A 2YFIB 1FGQA 5KP3A 4WWUC 3NBBA 2KCDA 4KFFA 1CYVA 4WP5A 3G4S3 2SBLA 3BLZA 3G8ZA 3GWRA 3NM2A 3IPTA 3S28A 2HMLB 2D42A 2WO0A 2BT3A 1IQXA 4NREA 3X3ZA 5IG3A 4R80A 4HM1B 3CC43 2W9PA 2STDA 1IVVA 2CG0A 3U97A 2RSXA 4OVMA 5AIHA 1N8QA 1VZZA 1W6CA 2LYXA 3GZYB 3LYGA 4HBRA 3FG1A 3SEDA 3MG3A 5AYRB 1K734 1LXEA 5A0OB 3NBRA 3AMOA 3PGBA 3H3HA 1IQ8A 2Z6BA 4WHAA 3DGOA 4BTYA 2BNGA 3K0ZA 1VQL3 2OQEA 4R4KA 4RNZA 1JB2A 1NJI4 1SIHA 5STDA 3EE1A 1QALA 1UW1A 3MKIA 1MNLA 3N9HA 1GD3A 2F98A 2I9WA 3DGLA 3JUPA 1DMMA 1QJGA 1ZX2A 2W9QA 3LTBA 1JKGA 4LSOA 5DRVA 5JBSA 3BNBA 4KFDA 3EX9A 5AIIA 3CMA3 2GBWB 1IT8A 1MOLA 2ZDJA 3X41A 3UJMA 2RGQA 2HMMB 4BTWA 1WMPA 3CNMA 1FUWA 1U8CB 1ISKA 1UI7A 1Q824 5AEWB 1O7GB 3LXUX 1C7HA 2OQEC 1N5PA 1VQO3 1WMNA 1OHPA 4HM4B 4RZMA 3G713 2HMKB 3X3YA 3GAXA 4HKVB 2CFDA 4HM5B 5IW9A 1Y4KA 1VQ53 2GEYA 4EV2A 1W2B2 2WOHA 3FF2A 3WMDA 4R1KA 3CC73 4RNYA 1KWIA 1VQM3 1ASKA 3F40A 7STDA 3CCJ3 5BVBA 3KSPA 1IQYA 5AEUB 5BXQA 1A67A 2W2CA 1RKYA 3LZAA 3HIGA 5ELJA 1WQLB 4JRFA 4ORLA 2IUJA 2FXTA 1GD4A 3F8XA 1NB3I 4IT7A 3RDEA 3HX8A 1HU9A 2O3OA 3PZWA 3G6E3 1SJWA 5IG0A 3D9RA 2CFLA 4RBNA 1AVKA 2W56A 4N6LA 2BO9B 3SX1A 2INXA 3LTAA 1W5ZA 4J8TA 3B7CA 5CLKA 3MG2A 1IV7A 1EKMA 2C11A 3CC23 2OTL3 3IJEB 3JUOA 4EBGA 1PU4A 3LT8A 3JUQA 3OV4A 1QVF2 3DZLA 2IA7A 1IDPA 2MF7A 2RFRA 2XSOB 1JJ22 1JN5B 3FCSB 2HMJB 3EBYA 4HJLB 4HZ9B 2CG1A 4J9AA 2W03A 4Q53A 1JRQA 4HM0B 3TDGA 3HK4A 3EN1B 4LMIA 3MYTA 4FMAA 3KE7A 1Q7Y4 4MMXB 2L4VA 5G2GA 4QWTA 3NUVA 2WGQA 4OUQA 2QIYA 2XF3A 3D3LA 3EB8A 2QEX3 8CHOA 2UX0A 2GU3A 2CKFB 4LZIA 3E99A 1O7MB 4HM3B 1Z1SA 2XGNA 4HM2B 4KZ1A 3CCL3 1KQS2 1JKGB 1W6GA 3JUNA 2ML5A 2W0QA 3RGRA 1G96A 2CFWA 2FGTA 3MPHA 3FSDA 4FMDA 3MHEA 1OCVA 2QA43 1YGEA 3PCSA 3CNXA 1W2ZA 3DGMA 1O7PB 2M7OA 4HM7B 3HI7A 3DGNA 1OF5B 1RRHA 2CW9A 1WMOA 2P05A 1YIT3 1K8A4 2YX9A 2YFLB 2Z7AA 3QK9A 3NX0A 1R4CA 2GU1A 4H3UA 4XBYA 3CCE3 1F8NA 3BB9A 3WA3A 5TGNA 1GY7A 1O7HB 1STDA 3KIIA 4K1UA 4N6V0 3WDGB 3X42A 3EJVA 3UB1A 1E3VA 1YJN3 2P09A 1E3RA 4EC6A 4LGQA 1D6ZA 2ML6A 3HZPA 4X2OA 1AVLA 3NV0B 4U13A 1LVNA 4HZBB 4O02B 5DREA 1S723 3FH1A 4XBTA 2E2VA 2ZL8A 1O7WB 2IMJA 5D83A 1N9JA 1RRLA 1DVDA 3X3XA 5ELUA 3S29A 5CXOA 5CF2A 3MG1A 4AKZA 1IVUA 1OPYA 2BMQB 2D1WA 3FLJA 3NHXA 2MC8A 3S67A 2KXGA 3MWZA 1OUNA 4N6OB 2JQ5A 2XFTA 4L7KA 1Q42A 3SXXA 5EVHA 1KSIA 4MJDA 4GL6A 1VQ43 3Q2PA 1AR0A 4N6TA 1L5GB 4OK0A 3GZRA 3NV0A 1YVBI 3KKGA 3CCQ3 5AIGA 1IV9A 1DMQA 2XSHB 3B4PA 2Y74A 2Z76A 1OGZA 3L0RA 1KC84 3ROBA 2JDIH 1OH0A 1W02A 3LOYA 1TP6A 3PS8A 4XDWA 2CWVA 1QAFA 2OCTA 3OWYA 4FR9A 3I0YA 2WGOA 3KN4A 3Q1CA 4FCJA 1AV4A 2XR8B 3EHCA 3FG4A 1QVG2 3CU3A 5CK6A 1NU3A 3LTCA 4X2HA 2GXFA 1TFOA 2K0MA 1M904 1W6YA 2PZVA 3FGYA 1YHQ3 2Z77A 1GS3A 2E2UA 2HMOB 1BUQA 3NQYA 1HKXA 2FNQA 1A90A 1VQP3 3J7Yd 6STDA 4PEJA 5IF6A 3OWSA 3G16A 3CCM3 3GZBA 1VQN3 2RCDA 3UL5A 4IIAA 2W6JH 1YJW3 3V92A 1OHSA 3LTDA 2OTJ3 4EXRA 3V98A 4HM6B 3LH4A 1IT7A 1EA2A 4K1VA 3Q90A 1K28A 1M9GA 1GYBA 1ULJB 1OHOA 3DM8A 2XGLA 3KSED 1DMNA 3FZWA 3S27A 2CH9A 3EC9A 1ZO2A 1O7NB 4ZM8A 5D82A 2KRTA 3CXC2 1S5AA 4FCZA 2CK3H 1GY6A 3NM7A 4WYKA 5IERA 1SQWA 3DY5A 1JNQA 4N6UA 3F14A 3T8NA 3CPW2 3PCRA 4FMBA 4K90B 2OOVA 2BHMA 4HYZA 2LQVA 3OXAA 3SOAA 2A15A 1W7CA 2BMOB 2XEPA 1JB5A 3NQZA 2PNCA 2CIUA 3ECFA 4R9LA 4CDLA 1RN7A 1WTHA 2CFKA 4WFOA 5CF1A 4N6MA 5D81A 1CQSA 5EQLA 3CCU3 4STDA 3I563 1GY5A 1V74A 4G1MB 1N8R4 2P0MA 4KVHA 3OW22 5IG5A 3SOYA 3I553 3SVAA 1OF5A 3CCS3 4JF8A 1K41A 1QMAA 3N8BA 3F7XA 1SIIA 1EQKA 1LOXA 2F86B 2GBXB 3CPOA 3RGAA 3S5CA 2Y73A 2XRXB 4XDVA 3H51A 4MMYB 3ER7A 1Q40A 2IUKA 3NBJA 3HIIA 1D6YA 1FGOA 3GRDA 3VF1A 2K54A 4XBXA 1U5OA 1VQK3 2CWUA 1VQ63 2OOVC 1A2KA 5JPUA 4GB5A 2P38A 3K9MC 3V99A 1YIJ3 1TFKA 2WOFA 1IU7A 1US1A 3GZXB 2HMNB 2OWPA 3LT9A 1D6UA 1EG9B 3KZTA 4MEIA 1Q814 3A76A 2BMRB 1KD14 2QGUA 2C10A 5KP4A 1FA3A 1NDOB 2XFSA 4FCMA 5FW5A 3OX9A 3F8HA 3PXMA 4LEHA 3T8UA 2YFJB 2B24B 3PYJA 1ROAA 1FGRA 5LC6A 3BNDA 1T5YA 4XB5A 1TU5A 1UI8A 3K5TA 1WNHA 5IEOA 3WOEB 1DYUA 1CYUA 3B4OA 1UUVB 1W00A 1YI23 1VQ83 4I4KA 1JB4A 3K7CA 3IMAB 2CHCA 1PFPA 3CME3 4AEQA 2E2TA 3N54B 1YJ93 1TIJA 2B1XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6U A;  3UL5 A;  2O9U X;  5A0O B;  3PS8 A;  4LZI A;  5LC7 A;  1A67 A;  3S67 A;  1EQK A;  4TX4 A;  3QRD A;  1FUW A;  2KXG A;  3MWZ A;  2OCT A;  4CCV A;  1CYV A;  4N6O B;  1DVC A;  3KFQ C;  4N6V 0;  5ELJ A;  3UL6 A;  1N5P A;  1N5H A;  1FA3 A;  1GD4 A;  3LH4 A;  1G96 A;  1NB3 I;  4IT7 A;  1NB5 I;  3Q2P A;  3PXM A;  3GAX A;  4N6T A;  1RN7 A;  1CEW I;  1M9G A;  1GD3 A;  1MNL A;  1ROA A;  1YVB I;  3PYJ A;  5LC6 A;  1IV9 A;  4N6M A;  1STF I;  4EYC A;  1CYU A;  1WNH A;  2W9P A;  3KSE D;  5EQL A;  4N6L A;  2CH9 A;  2BO9 B;  2W9Q A;  4N6N B;  1N9J A;  1A90 A;  4ZM8 A;  1KWI A;  3K9M C;  3L0R A;  1DVD A;  3IMA B;  1IV7 A;  5ELU A;  1PFP A;  3NX0 A;  1MOL A;  1R4C A;  3SVA A;  1LXE A;  1TIJ A; 
#chains in the Genus database with same CATH topology
 4ILF A;  2HOH A;  4BTX A;  2AAE A;  2KF6 A;  5IEP A;  1IVW A;  3T0U A;  2ZHX B;  3ALA A;  3CCV 3;  1B27 A;  1BSE A;  3FF0 A;  1JBR A;  4N3V A;  1RJO A;  2H0I A;  1BU4 A;  4R9K A;  3F7S A;  1FGT A;  5KP1 A;  3VSY A;  1TRQ A;  4HAA A;  1RN4 A;  1VQ7 3;  2J8X B;  1LNH A;  3DMC A;  1B21 A;  5JPP A;  3OWU A;  3B8L A;  2CWT A;  1I3I A;  1CEW I;  1I70 A;  1FGM A;  4I5Q A;  3WA2 X;  1TUH A;  2Q07 A;  1BSB A;  4WYK B;  5FGO A;  1N9E A;  2V1L A;  3UNL A;  3DH2 A;  4FMC A;  1A2V A;  5I97 A;  1JN5 A;  3LML A;  4H61 A;  1FW7 A;  3JVC A;  3EQQ B;  1UUW B;  3DUK A;  2R4I A;  1X1Y A;  4O3V A;  5IEN A;  1ULI B;  1OAC A;  4J5K A;  5LC7 A;  1IVX A;  1M1K 4;  1W4N A;  3DXO A;  3F9S A;  4HVN A;  5AIF A;  5AI1 A;  4CCV A;  1DVC A;  1TJD A;  1W01 A;  1VQ9 3;  1G0T A;  1RGH A;  5HGR A;  3UL6 A;  1N5H A;  3K63 A;  3EBT A;  1IK3 A;  1K9M 4;  3BNE A;  1NB5 I;  1BRG A;  1ROV A;  2RBI A;  4XM4 A;  2RNT A;  4O2H A;  1E97 A;  3FKA A;  3O8Y A;  3STD A;  1LNI A;  3AMO B;  5G1L A;  1STF I;  3JUM A;  4AKY A;  9RNT A;  4L8P A;  3AHS A;  1RHL A;  3EN8 A;  1BRJ A;  4EV5 A;  3VGN A;  4L8O A;  2F99 A;  1SPU A;  4KFE A;  3CCR 3;  3WOD G;  3RNT A;  2GEX A;  2XH9 A;  1Q40 B;  5IG4 A;  3G0K A;  1OGX A;  2F5M A;  3QRD A;  3U1W A;  2W04 A;  1TTO A;  1ZGX A;  4NHF A;  1BNE A;  1RTU A;  3KFQ C;  3Q3F A;  1JV2 B;  2C4B A;  5AYS C;  3NXJ A;  2CFG A;  1GOV A;  1LOY A;  3X40 A;  4O8S A;  1B2U A;  3FG3 A;  3SLU A;  3WOF B;  1Q86 4;  1NWW A;  1BRI A;  1QAK A;  5EEO A;  3EF8 A;  1YNV X;  4EYC A;  4MMZ B;  4N6N B;  2CX0 A;  2BIR A;  4HM8 B;  3MSO A;  1M1X B;  3CD6 3;  1NO3 A;  3M8C A;  4IPB A;  4K61 A;  2P0X A;  2CC3 A;  2W56 B;  1J2B A;  3BNC A;  2O9U X;  4TX4 A;  2YFI B;  1FGQ A;  5KP3 A;  4WWU C;  3NBB A;  2KCD A;  4KFF A;  1CYV A;  4WP5 A;  3G4S 3;  2SBL A;  3BLZ A;  3G8Z A;  3GWR A;  3NM2 A;  1JZD A;  1FUS A;  3IPT A;  3S28 A;  2HML B;  2D42 A;  2WO0 A;  1LQG C;  1Q7H A;  2BT3 A;  3A5E A;  1IQX A;  1I3F A;  4NRE A;  3X3Z A;  5IG3 A;  4R80 A;  2UGI A;  4HM1 B;  3CC4 3;  1I2E A;  2W9P A;  4BIR A;  1AY7 A;  2STD A;  4CPK A;  1IVV A;  2CG0 A;  3U97 A;  3DGY A;  2RSX A;  4OVM A;  5AIH A;  1N8Q A;  1VZZ A;  1W6C A;  2LYX A;  3GZY B;  3LYG A;  4HBR A;  3FG1 A;  3SED A;  3MG3 A;  5AYR B;  1K73 4;  1LXE A;  1MWU A;  5A0O B;  3NBR A;  5BU4 A;  3AMO A;  3PGB A;  3H3H A;  1IQ8 A;  2Z6B A;  4WHA A;  3DGO A;  4BTY A;  1AQZ A;  2BNG A;  3K0Z A;  2H0G A;  1VQL 3;  2OQE A;  4R4K A;  4RNZ A;  1JB2 A;  1NJI 4;  1SIH A;  5STD A;  2IY2 A;  4RNT A;  1JZO A;  3EE1 A;  1QAL A;  1UW1 A;  3MKI A;  1BNJ A;  1V58 A;  1G02 A;  1MNL A;  1GD3 A;  2F98 A;  3N9H A;  2I9W A;  3DGL A;  3JUP A;  1DMM A;  2ZA4 A;  1MGW A;  2AAD A;  1QJG A;  1ZX2 A;  1BSC A;  2W9Q A;  3LTB A;  1JKG A;  4LSO A;  1T2I A;  5DRV A;  5JBS A;  1UCK A;  3BNB A;  4KFD A;  3EX9 A;  5AII A;  3CMA 3;  2GBW B;  1IT8 A;  1MOL A;  2ZDJ A;  3X41 A;  3UJM A;  2RGQ A;  2HMM B;  4BTW A;  1WMP A;  3CNM A;  3ZG5 A;  2KF5 A;  4KT3 B;  1FUW A;  4BL3 A;  1U8C B;  1LOV A;  1ISK A;  1UI7 A;  1Q82 4;  5AEW B;  1O7G B;  2K3D A;  3LXU X;  1C7H A;  2OQE C;  1N5P A;  1VQO 3;  1WMN A;  1OHP A;  4HM4 B;  4RZM A;  3G71 3;  2HMK B;  3X3Y A;  3GAX A;  4HKV B;  2CFD A;  1BSD A;  4HM5 B;  5IW9 A;  1Y4K A;  1VQ5 3;  2GEY A;  4EV2 A;  1W2B 2;  2WOH A;  1JBS A;  3FF2 A;  1FYS A;  3WMD A;  4R1K A;  3CC7 3;  1LRA A;  4RNY A;  1KWI A;  1VQM 3;  1ASK A;  3F40 A;  4BU4 A;  7STD A;  1RGK A;  1UDI I;  3CCJ 3;  5BVB A;  3KSP A;  1IQY A;  5AEU B;  5BXQ A;  1A67 A;  2W2C A;  1RKY A;  3LZA A;  3HIG A;  5ELJ A;  1WQL B;  4JRF A;  1BNI A;  1I0X A;  1LQM B;  1YGW A;  4ORL A;  2IUJ A;  2FXT A;  1BAN A;  1GD4 A;  3F8X A;  1NB3 I;  4IT7 A;  3RDE A;  3HX8 A;  1HU9 A;  2O3O A;  3PZW A;  3G6E 3;  1SJW A;  5IG0 A;  1BRK A;  2CFL A;  3D9R A;  1PYL A;  4RBN A;  1AVK A;  1V57 A;  2W56 A;  4N6L A;  2BO9 B;  1UGH I;  2INX A;  3SX1 A;  1DE3 A;  3LTA A;  1W5Z A;  4J8T A;  3B7C A;  5CLK A;  3MG2 A;  1IV7 A;  1EKM A;  2C11 A;  3CC2 3;  2OTL 3;  3IJE B;  3JUO A;  4EBG A;  1PU4 A;  7RNT A;  3LT8 A;  3JUQ A;  3OV4 A;  1QVF 2;  3DZL A;  2IA7 A;  1IDP A;  2MF7 A;  2RFR A;  2XSO B;  1JJ2 2;  1JN5 B;  3FCS B;  1RGG A;  2HMJ B;  3EBY A;  4HJL B;  3BU4 A;  4HZ9 B;  3WR2 A;  1UCL A;  2CG1 A;  4J9A A;  7GSP A;  2W03 A;  4Q53 A;  1JRQ A;  4HM0 B;  1A2P A;  3D5G A;  1FZU A;  3TDG A;  3HK4 A;  3EN1 B;  4LMI A;  1GMP A;  3MYT A;  4FMA A;  3KE7 A;  1Q7Y 4;  4MMX B;  2L4V A;  5G2G A;  1HZ1 A;  4QWT A;  3NUV A;  2WGQ A;  4OUQ A;  1BNF A;  2QIY A;  1VQQ A;  2XF3 A;  3D3L A;  3EB8 A;  2QEX 3;  8CHO A;  2UX0 A;  2GU3 A;  2CKF B;  4LZI A;  1RGL A;  3E99 A;  1O7M B;  4HM3 B;  1GOY A;  1Z1S A;  2XGN A;  4HM2 B;  4KZ1 A;  3CCL 3;  1KQS 2;  1JKG B;  1W6G A;  3JUN A;  2ML5 A;  2W0Q A;  3RGR A;  1G96 A;  2CFW A;  2FGT A;  3D5I A;  3FSD A;  3MPH A;  3MHE A;  4FMD A;  1OCV A;  2QA4 3;  1YGE A;  3PCS A;  5HOH A;  3CNX A;  1W2Z A;  3DGM A;  1O7P B;  2M7O A;  4HM7 B;  3HI7 A;  3DGN A;  1RGF A;  1OF5 B;  1RRH A;  2CW9 A;  1WMO A;  1RGE A;  1RN1 A;  2P05 A;  2YX9 A;  1NNV A;  1YIT 3;  2KAA A;  2YFL B;  2Z7A A;  3QK9 A;  1UCJ A;  3NX0 A;  1R4C A;  2GU1 A;  4H3U A;  4XBY A;  3CCE 3;  1F8N A;  2R41 A;  1BSA A;  1IYY A;  3BB9 A;  3WA3 A;  5TGN A;  1GY7 A;  1O7H B;  1STD A;  3KII A;  4K1U A;  4N6V 0;  3WDG B;  3X42 A;  1BNR A;  1MWR A;  3EJV A;  3UB1 A;  1E3V A;  1YJN 3;  2P09 A;  1E3R A;  4EC6 A;  4LGQ A;  1BUJ A;  1D6Z A;  1I2G A;  2ML6 A;  3HZP A;  4X2O A;  1AVL A;  3NV0 B;  1SAR A;  1LVN A;  4HZB B;  4O02 B;  4U13 A;  5DRE A;  1S72 3;  3FH1 A;  4XBT A;  4HOH A;  2E2V A;  2ZL8 A;  1O7W B;  1GMQ A;  2IMJ A;  5D83 A;  1N9J A;  8RNT A;  1EEJ A;  1RRL A;  1BNG A;  3X3X A;  5ELU A;  3S29 A;  1DVD A;  5CXO A;  5CF2 A;  3MG1 A;  1RGA A;  1BVI A;  4AKZ A;  1IVU A;  1OPY A;  2BMQ B;  2D1W A;  3FLJ A;  3NHX A;  2MC8 A;  3S67 A;  1B2S A;  2KXG A;  3MWZ A;  1JBT A;  1OUN A;  4N6O B;  1RNB A;  2JQ5 A;  2XFT A;  4L7K A;  1Q42 A;  1EUI C;  3SXX A;  5EVH A;  1KSI A;  4MJD A;  4GL6 A;  4LYL B;  3Q2P A;  1VQ4 3;  1AR0 A;  4N6T A;  1L5G B;  4OK0 A;  3GZR A;  1MWS A;  1I2F A;  1YVS A;  1YVB I;  3KKG A;  3NV0 A;  5AIG A;  3CCQ 3;  1I0V A;  1IV9 A;  1BRH A;  1DMQ A;  2XSH B;  3B4P A;  2KF4 A;  2F4Y A;  6GSP A;  1CH0 A;  2Y74 A;  2Z76 A;  1OGZ A;  3L0R A;  1KC8 4;  3ROB A;  2JDI H;  1OH0 A;  1W02 A;  3LOY A;  1TP6 A;  3PS8 A;  4XDW A;  2CWV A;  1QAF A;  2OCT A;  3OWY A;  4FR9 A;  1RCL A;  2WGO A;  1X1X A;  2BU4 A;  3I0Y A;  3KN4 A;  1AV4 A;  3Q1C A;  2XR8 B;  4FCJ A;  3EHC A;  3FG4 A;  1QVG 2;  3CU3 A;  5CK6 A;  1NU3 A;  6RNT A;  4J5G A;  3LTC A;  4X2H A;  3ZG0 A;  2GXF A;  1TFO A;  2K0M A;  1M90 4;  1W6Y A;  2PZV A;  1TRP A;  3FGY A;  2Z77 A;  1YHQ 3;  2E2U A;  1GS3 A;  2HMO B;  3URP A;  1BUQ A;  1RGC A;  1B2Z A;  3NQY A;  1HKX A;  2FNQ A;  1A90 A;  1VQP 3;  1BAO A;  1B2X A;  6STD A;  3J7Y d;  4PEJ A;  5IF6 A;  3OWS A;  3G16 A;  3CCM 3;  3GZB A;  5G1K A;  5M1A A;  1VQN 3;  2RCD A;  3UL5 A;  5RNT A;  4IIA A;  1I8V A;  3BIR A;  3KCH A;  2KF3 A;  2W6J H;  1YJW 3;  1R4Y A;  3GSP A;  3V92 A;  1OHS A;  3LTD A;  2OTJ 3;  4EXR A;  3V98 A;  1ZS7 A;  1RSN A;  4HM6 B;  3LH4 A;  1IT7 A;  1EA2 A;  4K1V A;  3AGN A;  3Q90 A;  1RNT A;  1K28 A;  1M9G A;  1GYB A;  1C54 A;  1ULJ B;  1DET A;  1OHO A;  3DM8 A;  2XGL A;  3KSE D;  1DMN A;  3FZW A;  3S27 A;  4BL2 A;  2CH9 A;  3HOH A;  3EC9 A;  1ZO2 A;  1O7N B;  4ZM8 A;  5D82 A;  1B20 A;  1RDS A;  2KRT A;  2H0H A;  3CXC 2;  1S5A A;  4FCZ A;  2CK3 H;  1BOX A;  1GY6 A;  1RMS A;  3NM7 A;  4WYK A;  1SQW A;  5IER A;  3DY5 A;  1JNQ A;  4N6U A;  3F14 A;  3T8N A;  1UUG B;  3CPW 2;  3PCR A;  1FUT A;  1BNS A;  1GMR A;  4FMB A;  4K90 B;  2OOV A;  1HYF A;  2BHM A;  4HYZ A;  2LQV A;  3OXA A;  3SOA A;  5BIR A;  4NPB A;  2A15 A;  1W7C A;  2BMO B;  2XEP A;  1JB5 A;  3AGO A;  2PNC A;  3NQZ A;  2CIU A;  2GSP A;  1BRN L;  2CX1 A;  3ECF A;  4R9L A;  1B2M A;  4CDL A;  1RN7 A;  1WTH A;  2CFK A;  4WFO A;  5CF1 A;  4N6M A;  5D81 A;  1PY3 A;  1MGR A;  1CQS A;  5EQL A;  3CCU 3;  4STD A;  3I56 3;  1GY5 A;  1V74 A;  4G1M B;  1N8R 4;  2P0M A;  4KVH A;  1GSP A;  3OW2 2;  5IG5 A;  3SOY A;  3I55 3;  3SVA A;  1OF5 A;  4GSP A;  3CCS 3;  4JF8 A;  1K41 A;  1QMA A;  1X1U A;  3N8B A;  3ZFZ A;  2SAR A;  1SII A;  3F7X A;  5M19 A;  4GHO A;  1EQK A;  1T2H A;  1LOX A;  2F86 B;  2GBX B;  3CPO A;  3RGA A;  5GSP A;  3S5C A;  2Y73 A;  2XRX B;  4CJN A;  4XDV A;  1UCI A;  3H51 A;  3WHO A;  4MMY B;  3ER7 A;  1Q40 A;  2IUK A;  3NBJ A;  2F56 A;  3HII A;  1D6Y A;  1BIR A;  1FGO A;  3GRD A;  3VF1 A;  2K54 A;  4XBX A;  1U5O A;  1B3S A;  1VQK 3;  2CWU A;  1VQ6 3;  2OOV C;  1A2K A;  1RCK A;  5JPU A;  4GB5 A;  1UGI A;  2P38 A;  1LOW A;  3K9M C;  5M18 A;  3V99 A;  1YIJ 3;  1TFK A;  2WOF A;  1IU7 A;  2IYJ A;  2UUG C;  1US1 A;  3D79 A;  2HMN B;  3GZX B;  2OWP A;  3LT9 A;  1D6U A;  3SYU A;  1EG9 B;  2L1S A;  4DKI A;  4EW5 A;  3KZT A;  4MEI A;  2F5W A;  3A76 A;  2BMR B;  1Q81 4;  2QGU A;  2C10 A;  5KP4 A;  1KD1 4;  1FA3 A;  1MWT A;  1NDO B;  2XFS A;  4FCM A;  1X1W A;  5FW5 A;  3OX9 A;  3F8H A;  3PXM A;  4LEH A;  3T8U A;  2YFJ B;  2B24 B;  3D4A A;  3PYJ A;  1ROA A;  1FGR A;  3AHW A;  3BND A;  5LC6 A;  1T5Y A;  1BGS A;  4XB5 A;  1TU5 A;  1UI8 A;  1Q9E A;  1WNH A;  3K5T A;  1T3B A;  1DYU A;  5IEO A;  3WOE B;  1CYU A;  1BRS A;  3B4O A;  1UUV B;  1W00 A;  1YI2 3;  1K8A 4;  1VQ8 3;  4I4K A;  1JB4 A;  1GOU A;  3K7C A;  3IMA B;  2CHC A;  1PFP A;  3CME 3;  4AEQ A;  2E2T A;  1RLS A;  3N54 B;  1YJ9 3;  1TIJ A;  2B1X B; 
#chains in the Genus database with same CATH homology
 4BTX A;  5IEP A;  1IVW A;  3T0U A;  3ALA A;  3CCV 3;  3FF0 A;  4N3V A;  1RJO A;  5KP1 A;  4R9K A;  3F7S A;  1FGT A;  3VSY A;  1VQ7 3;  1LNH A;  3DMC A;  5JPP A;  3OWU A;  3B8L A;  2CWT A;  1CEW I;  1FGM A;  3WA2 X;  1TUH A;  2Q07 A;  4WYK B;  5FGO A;  1N9E A;  2V1L A;  3UNL A;  4FMC A;  1A2V A;  5I97 A;  1JN5 A;  3LML A;  4H61 A;  3JVC A;  3EQQ B;  1UUW B;  3DUK A;  2R4I A;  4O3V A;  5IEN A;  1ULI B;  1OAC A;  5LC7 A;  1M1K 4;  1IVX A;  1W4N A;  3DXO A;  3F9S A;  4HVN A;  5AIF A;  5AI1 A;  4CCV A;  1DVC A;  1W01 A;  1VQ9 3;  5HGR A;  3UL6 A;  1N5H A;  3K63 A;  3EBT A;  1IK3 A;  1K9M 4;  3BNE A;  1NB5 I;  1ROV A;  4XM4 A;  4O2H A;  1E97 A;  3FKA A;  3O8Y A;  3STD A;  3AMO B;  1STF I;  3JUM A;  4AKY A;  4L8P A;  4EV5 A;  3EN8 A;  3VGN A;  4L8O A;  2F99 A;  1SPU A;  4KFE A;  3CCR 3;  3WOD G;  2GEX A;  2XH9 A;  1Q40 B;  5IG4 A;  3G0K A;  1OGX A;  3QRD A;  3U1W A;  2W04 A;  4NHF A;  3KFQ C;  1JV2 B;  5AYS C;  3NXJ A;  2CFG A;  3X40 A;  4O8S A;  3FG3 A;  3SLU A;  3WOF B;  1Q86 4;  1NWW A;  1QAK A;  5EEO A;  3EF8 A;  4EYC A;  4MMZ B;  4N6N B;  4HM8 B;  3MSO A;  1M1X B;  3CD6 3;  1NO3 A;  3M8C A;  4IPB A;  4K61 A;  2P0X A;  2CC3 A;  2W56 B;  1J2B A;  3BNC A;  2O9U X;  4TX4 A;  2YFI B;  1FGQ A;  5KP3 A;  4WWU C;  3NBB A;  2KCD A;  4KFF A;  1CYV A;  4WP5 A;  3G4S 3;  2SBL A;  3BLZ A;  3G8Z A;  3GWR A;  3NM2 A;  3IPT A;  3S28 A;  2HML B;  2D42 A;  2WO0 A;  2BT3 A;  1IQX A;  4NRE A;  3X3Z A;  5IG3 A;  4R80 A;  4HM1 B;  3CC4 3;  2W9P A;  2STD A;  1IVV A;  2CG0 A;  3U97 A;  2RSX A;  4OVM A;  5AIH A;  1N8Q A;  1VZZ A;  1W6C A;  2LYX A;  3GZY B;  3LYG A;  4HBR A;  3FG1 A;  3SED A;  3MG3 A;  5AYR B;  1K73 4;  1LXE A;  5A0O B;  3NBR A;  3AMO A;  3PGB A;  3H3H A;  1IQ8 A;  2Z6B A;  4WHA A;  3DGO A;  4BTY A;  2BNG A;  3K0Z A;  1VQL 3;  2OQE A;  4R4K A;  4RNZ A;  1JB2 A;  1NJI 4;  1SIH A;  5STD A;  3EE1 A;  1QAL A;  1UW1 A;  3MKI A;  1MNL A;  3N9H A;  1GD3 A;  2F98 A;  2I9W A;  3DGL A;  3JUP A;  1DMM A;  1QJG A;  1ZX2 A;  2W9Q A;  3LTB A;  1JKG A;  4LSO A;  5DRV A;  5JBS A;  3BNB A;  4KFD A;  3EX9 A;  5AII A;  3CMA 3;  2GBW B;  1IT8 A;  1MOL A;  2ZDJ A;  3X41 A;  3UJM A;  2RGQ A;  2HMM B;  4BTW A;  1WMP A;  3CNM A;  1FUW A;  1U8C B;  1ISK A;  1UI7 A;  1Q82 4;  5AEW B;  1O7G B;  3LXU X;  1C7H A;  2OQE C;  1N5P A;  1VQO 3;  1WMN A;  1OHP A;  4HM4 B;  4RZM A;  3G71 3;  2HMK B;  3X3Y A;  3GAX A;  4HKV B;  2CFD A;  4HM5 B;  5IW9 A;  1Y4K A;  1VQ5 3;  2GEY A;  4EV2 A;  1W2B 2;  2WOH A;  3FF2 A;  3WMD A;  4R1K A;  3CC7 3;  4RNY A;  1KWI A;  1VQM 3;  1ASK A;  3F40 A;  7STD A;  3CCJ 3;  5BVB A;  3KSP A;  1IQY A;  5AEU B;  5BXQ A;  1A67 A;  2W2C A;  1RKY A;  3LZA A;  3HIG A;  5ELJ A;  1WQL B;  4JRF A;  4ORL A;  2IUJ A;  2FXT A;  1GD4 A;  3F8X A;  1NB3 I;  4IT7 A;  3RDE A;  3HX8 A;  1HU9 A;  2O3O A;  3PZW A;  3G6E 3;  1SJW A;  5IG0 A;  3D9R A;  2CFL A;  4RBN A;  1AVK A;  2W56 A;  4N6L A;  2BO9 B;  3SX1 A;  2INX A;  3LTA A;  1W5Z A;  4J8T A;  3B7C A;  5CLK A;  3MG2 A;  1IV7 A;  1EKM A;  2C11 A;  3CC2 3;  2OTL 3;  3IJE B;  3JUO A;  4EBG A;  1PU4 A;  3LT8 A;  3JUQ A;  3OV4 A;  1QVF 2;  3DZL A;  2IA7 A;  1IDP A;  2MF7 A;  2RFR A;  2XSO B;  1JJ2 2;  1JN5 B;  3FCS B;  2HMJ B;  3EBY A;  4HJL B;  4HZ9 B;  2CG1 A;  4J9A A;  2W03 A;  4Q53 A;  1JRQ A;  4HM0 B;  3TDG A;  3HK4 A;  3EN1 B;  4LMI A;  3MYT A;  4FMA A;  3KE7 A;  1Q7Y 4;  4MMX B;  2L4V A;  5G2G A;  4QWT A;  3NUV A;  2WGQ A;  4OUQ A;  2QIY A;  2XF3 A;  3D3L A;  3EB8 A;  2QEX 3;  8CHO A;  2UX0 A;  2GU3 A;  2CKF B;  4LZI A;  3E99 A;  1O7M B;  4HM3 B;  1Z1S A;  2XGN A;  4HM2 B;  4KZ1 A;  3CCL 3;  1KQS 2;  1JKG B;  1W6G A;  3JUN A;  2ML5 A;  2W0Q A;  3RGR A;  1G96 A;  2CFW A;  2FGT A;  3MPH A;  3FSD A;  4FMD A;  3MHE A;  1OCV A;  2QA4 3;  1YGE A;  3PCS A;  3CNX A;  1W2Z A;  3DGM A;  1O7P B;  2M7O A;  4HM7 B;  3HI7 A;  3DGN A;  1OF5 B;  1RRH A;  2CW9 A;  1WMO A;  2P05 A;  1YIT 3;  1K8A 4;  2YX9 A;  2YFL B;  2Z7A A;  3QK9 A;  3NX0 A;  1R4C A;  2GU1 A;  4H3U A;  4XBY A;  3CCE 3;  1F8N A;  3BB9 A;  3WA3 A;  5TGN A;  1GY7 A;  1O7H B;  1STD A;  3KII A;  4K1U A;  4N6V 0;  3WDG B;  3X42 A;  3EJV A;  3UB1 A;  1E3V A;  1YJN 3;  2P09 A;  1E3R A;  4EC6 A;  4LGQ A;  1D6Z A;  2ML6 A;  3HZP A;  4X2O A;  1AVL A;  3NV0 B;  4U13 A;  1LVN A;  4HZB B;  4O02 B;  5DRE A;  1S72 3;  3FH1 A;  4XBT A;  2E2V A;  2ZL8 A;  1O7W B;  2IMJ A;  5D83 A;  1N9J A;  1RRL A;  1DVD A;  3X3X A;  5ELU A;  3S29 A;  5CXO A;  5CF2 A;  3MG1 A;  4AKZ A;  1IVU A;  1OPY A;  2BMQ B;  2D1W A;  3FLJ A;  3NHX A;  2MC8 A;  3S67 A;  2KXG A;  3MWZ A;  1OUN A;  4N6O B;  2JQ5 A;  2XFT A;  4L7K A;  1Q42 A;  3SXX A;  5EVH A;  1KSI A;  4MJD A;  4GL6 A;  1VQ4 3;  3Q2P A;  1AR0 A;  4N6T A;  1L5G B;  4OK0 A;  3GZR A;  3NV0 A;  1YVB I;  3KKG A;  3CCQ 3;  5AIG A;  1IV9 A;  1DMQ A;  2XSH B;  3B4P A;  2Y74 A;  2Z76 A;  1OGZ A;  3L0R A;  1KC8 4;  3ROB A;  2JDI H;  1OH0 A;  1W02 A;  3LOY A;  1TP6 A;  3PS8 A;  4XDW A;  2CWV A;  1QAF A;  2OCT A;  3OWY A;  4FR9 A;  3I0Y A;  2WGO A;  3KN4 A;  3Q1C A;  4FCJ A;  1AV4 A;  2XR8 B;  3EHC A;  3FG4 A;  1QVG 2;  3CU3 A;  5CK6 A;  1NU3 A;  3LTC A;  4X2H A;  2GXF A;  1TFO A;  2K0M A;  1M90 4;  1W6Y A;  2PZV A;  3FGY A;  1YHQ 3;  2Z77 A;  1GS3 A;  2E2U A;  2HMO B;  1BUQ A;  3NQY A;  1HKX A;  2FNQ A;  1A90 A;  1VQP 3;  3J7Y d;  6STD A;  4PEJ A;  5IF6 A;  3OWS A;  3G16 A;  3CCM 3;  3GZB A;  1VQN 3;  2RCD A;  3UL5 A;  4IIA A;  2W6J H;  1YJW 3;  3V92 A;  1OHS A;  3LTD A;  2OTJ 3;  4EXR A;  3V98 A;  4HM6 B;  3LH4 A;  1IT7 A;  1EA2 A;  4K1V A;  3Q90 A;  1K28 A;  1M9G A;  1GYB A;  1ULJ B;  1OHO A;  3DM8 A;  2XGL A;  3KSE D;  1DMN A;  3FZW A;  3S27 A;  2CH9 A;  3EC9 A;  1ZO2 A;  1O7N B;  4ZM8 A;  5D82 A;  2KRT A;  3CXC 2;  1S5A A;  4FCZ A;  2CK3 H;  1GY6 A;  3NM7 A;  4WYK A;  5IER A;  1SQW A;  3DY5 A;  1JNQ A;  4N6U A;  3F14 A;  3T8N A;  3CPW 2;  3PCR A;  4FMB A;  4K90 B;  2OOV A;  2BHM A;  4HYZ A;  2LQV A;  3OXA A;  3SOA A;  2A15 A;  1W7C A;  2BMO B;  2XEP A;  1JB5 A;  3NQZ A;  2PNC A;  2CIU A;  3ECF A;  4R9L A;  4CDL A;  1RN7 A;  1WTH A;  2CFK A;  4WFO A;  5CF1 A;  4N6M A;  5D81 A;  1CQS A;  5EQL A;  3CCU 3;  4STD A;  3I56 3;  1GY5 A;  1V74 A;  4G1M B;  1N8R 4;  2P0M A;  4KVH A;  3OW2 2;  5IG5 A;  3SOY A;  3I55 3;  3SVA A;  1OF5 A;  3CCS 3;  4JF8 A;  1K41 A;  1QMA A;  3N8B A;  3F7X A;  1SII A;  1EQK A;  1LOX A;  2F86 B;  2GBX B;  3CPO A;  3RGA A;  3S5C A;  2Y73 A;  2XRX B;  4XDV A;  3H51 A;  4MMY B;  3ER7 A;  1Q40 A;  2IUK A;  3NBJ A;  3HII A;  1D6Y A;  1FGO A;  3GRD A;  3VF1 A;  2K54 A;  4XBX A;  1U5O A;  1VQK 3;  2CWU A;  1VQ6 3;  2OOV C;  1A2K A;  5JPU A;  4GB5 A;  2P38 A;  3K9M C;  3V99 A;  1YIJ 3;  1TFK A;  2WOF A;  1IU7 A;  1US1 A;  3GZX B;  2HMN B;  2OWP A;  3LT9 A;  1D6U A;  1EG9 B;  3KZT A;  4MEI A;  1Q81 4;  3A76 A;  2BMR B;  1KD1 4;  2QGU A;  2C10 A;  5KP4 A;  1FA3 A;  1NDO B;  2XFS A;  4FCM A;  5FW5 A;  3OX9 A;  3F8H A;  3PXM A;  4LEH A;  3T8U A;  2YFJ B;  2B24 B;  3PYJ A;  1ROA A;  1FGR A;  5LC6 A;  3BND A;  1T5Y A;  4XB5 A;  1TU5 A;  1UI8 A;  3K5T A;  1WNH A;  5IEO A;  3WOE B;  1DYU A;  1CYU A;  3B4O A;  1UUV B;  1W00 A;  1YI2 3;  1VQ8 3;  4I4K A;  1JB4 A;  3K7C A;  3IMA B;  2CHC A;  1PFP A;  3CME 3;  4AEQ A;  2E2T A;  3N54 B;  1YJ9 3;  1TIJ A;  2B1X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...