1UUGB

Escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, hydrolase
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Escherichia coli k12
total genus 15
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1uugB00
4LYLB 1UDII 1LQMB 2UUGC 1EUIC 2UGIA 1UUGB 1LQGC 2J8XB 1UGHI 1UGIA 2ZHXB
chains in the Genus database with same CATH superfamily
4DKIA 2Z7AA 2CFKA 3CD63 1OPYA 1TRQA 5AIHA 3UB1A 1UCLA 2B1XB 5CF1A 4PEJA 4AEQA 5JPPA 4EW5A 2HOHA 1Z1SA 3K63A 4LGQA 1TTOA 1I2FA 3WDGB 3JUOA 2YFIB 1YI23 2ZDJA 2HMLB 3WA3A 1AQZA 1GD3A 3EF8A 1BSAA 1TFKA 4MMZB 4LMIA 1IDPA 5ELJA 3S28A 1VQN3 2XGLA 2F86B 1OHSA 2O9UX 1UUWB 3FG3A 4N6MA 1DETA 4FCJA 1NO3A 2P38A 1VQK3 3F40A 3LTDA 3SLUA 2GSPA 3CXC2 1JJ22 1VQQA 1V74A 3D79A 1I70A 1DVDA 3IMAB 4R1KA 1Q42A 3NBRA 4N6V0 5KP3A 3HOHA 1IQXA 1E97A 2F5WA 3EN1B 3SYUA 3FLJA 4RNTA 1T2HA 2CHCA 1RNBA 2Y74A 1PFPA 1Q9EA 1UDII 1O7PB 5HOHA 1V58A 1WMPA 2JDIH 1D6YA 3K7CA 4NPBA 1SJWA 4J5GA 1IVUA 3I553 1Q7Y4 1BNRA 5LC6A 1MOLA 1S5AA 1IV7A 1W7CA 1LOXA 1DMQA 3DGNA 3I0YA 1OH0A 3KSPA 2QA43 1S723 2HMMB 1UCJA 1DE3A 3G713 3F14A 4WYKB 3T8NA 2MF7A 4WHAA 4XBXA 3UL5A 5IEOA 2GU3A 3S27A 3CC23 3GSPA 1M9GA 4L7KA 1CH0A 3FSDA 4N3VA 1ULJB 5STDA 5AIGA 1NU3A 2KF3A 1JV2B 1DVCA 3MPHA 1A2VA 1B3SA 3KSED 3JUMA 1BRIA 1EUIC 4FMAA 3GZRA 1E3RA 7RNTA 4BIRA 1JB2A 4LYLB 2GEXA 1WTHA 2OQEC 1RGHA 1FZUA 4STDA 4X2OA 1M904 1D6UA 4HZ9B 5BXQA 1HYFA 1Q7HA 5DRVA 5A0OB 3TDGA 1SQWA 1B21A 2CFLA 1LRAA 2CX0A 1IVWA 2OOVC 4KZ1A 4R9KA 1FA3A 1VQL3 5JPUA 1STFI 2IMJA 1BANA 3CCQ3 1OACA 4QWTA 1M1XB 1NDOB 1VQ43 1BUQA 1IYYA 2C10A 2P0MA 1MGRA 3JUQA 1N5HA 3URPA 4CCVA 3RNTA 3FCSB 3SEDA 1WQLB 4N6NB 1Y4KA 2XSOB 1K28A 2P05A 4HM8B 2IUJA 3WMDA 1OF5B 5BIRA 1B2XA 2WOFA 1UW1A 1W6YA 4K1VA 1GOVA 5CF2A 3U1WA 3Q90A 1IV9A 1FGQA 3WOEB 1BUJA 2KCDA 2CFDA 1YNVX 5BVBA 3D5IA 3UJMA 3SXXA 3X3XA 5AEUB 7GSPA 1BIRA 1BRKA 2WGOA 2XF3A 3I563 1W6GA 1BNIA 4J9AA 1B2SA 3PS8A 2W9PA 2RNTA 2IA7A 1WMNA 1O7GB 2Z6BA 3Q3FA 1OF5A 3G8ZA 3VGNA 1OUNA 2KF4A 3KKGA 1I0VA 4FCMA 3T0UA 3WOFB 1GYBA 1BSDA 2CH9A 5I97A 4HKVB 1CEWI 1UGIA 5M1AA 4JF8A 3N9HA 3EC9A 3CNMA 1KQS2 1BNGA 4NREA 4N6LA 1QVF2 1JB4A 5IF6A 1PYLA 2BU4A 3CPOA 5EEOA 1UCKA 1AVKA 1B2ZA 1DMMA 3CC73 3F8XA 2F56A 1W00A 1OHOA 1ROVA 3B8LA 3CC43 2Q07A 3MYTA 1JRQA 2R41A 1IT8A 2HMKB 3NXJA 1RCLA 1YJN3 1TRPA 1AVLA 3A76A 2XFTA 3MG1A 1X1UA 2CWVA 3X40A 3HIIA 8RNTA 3AHSA 1G96A 1K41A 3DMCA 4H3UA 3G4S3 4RBNA 2KXGA 3MWZA 3LXUX 5AYSC 3Q1CA 5G1KA 1O7NB 3CCE3 2KAAA 1RN1A 2BO9B 2CC3A 1VQM3 1JN5A 1K734 3NM7A 1O7WB 1G02A 2C4BA 2CW9A 2KF6A 1T2IA 1A2PA 1RCKA 3SOYA 3ZFZA 3NHXA 1VQ83 3BNBA 2STDA 3FKAA 5HGRA 4AKYA 3NV0B 1RGGA 4N6TA 1YIT3 2WGQA 1MWRA 2SBLA 3D9RA 3LOYA 4HM1B 1EQKA 3DUKA 1RMSA 4HJLB 1LQGC 1IT7A 2L1SA 4XDVA 2BMOB 3QK9A 1I2GA 1SIIA 4IT7A 3QRDA 1NWWA 2GBXB 2CX1A 4I5QA 2K3DA 1DYUA 3D5GA 1SPUA 1C7HA 2KF5A 3EX9A 3NV0A 4XBYA 1ISKA 1WMOA 2CWUA 2JQ5A 4OUQA 4L8PA 1U5OA 1T5YA 1TFOA 1FUTA 2MC8A 6STDA 2OTL3 3F7XA 3BNCA 4BU4A 1N8QA 1YHQ3 4BTYA 3B7CA 1JB5A 2E2VA 3DZLA 4N6OB 1WNHA 1MWUA 3FF0A 4MMXB 3SX1A 3WR2A 3LTAA 5FGOA 3ER7A 3K0ZA 1SIHA 3X42A 2HMOB 3RDEA 3PGBA 4MJDA 4EC6A 5JBSA 2PNCA 4KVHA 3FF2A 2RGQA 9RNTA 1W4NA 1ZX2A 1QAKA 2I9WA 3NUVA 3HZPA 4J8TA 4BL2A 2CWTA 4EYCA 1X1XA 1TU5A 1HZ1A 3PZWA 1OCVA 1O7MB 1GY6A 3FG4A 3OX9A 1NJI4 3LTCA 4WYKA 3CNXA 1NB3I 3BU4A 4I4KA 1FW7A 7STDA 4ILFA 1IK3A 5KP1A 2M7OA 2W9QA 2OOVA 3CCU3 1W02A 4FCZA 5CXOA 1GY7A 3EBTA 1QJGA 1RN7A 2GBWB 2F99A 2UX0A 4XB5A 3CCR3 4Q53A 3S29A 1RGFA 3X3ZA 1A2KA 1IQ8A 3AMOB 1ZGXA 4HM0B 5IENA 1VQ63 2LQVA 3EN8A 3STDA 4FMDA 4X2HA 1W2B2 3X41A 5CLKA 1GMRA 4EV2A 2A15A 2GEYA 5D81A 3VSYA 3WODG 2O3OA 3MKIA 4HM3B 2QEX3 1CYUA 2D1WA 3CCJ3 3KN4A 1T3BA 3NBBA 2F98A 3HK4A 1I2EA 1Q814 1VQ53 1I0XA 1OGXA 1JBRA 2V1LA 3HI7A 3CCV3 2WOHA 1BGSA 1OHPA 5ELUA 2F5MA 3JUNA 2QIYA 3EBYA 3F9SA 1RTUA 3S67A 1RHLA 3LZAA 5D83A 1BNSA 3VF1A 1LQMB 4CDLA 1O7HB 3PXMA 2RFRA 4KFFA 3CME3 1Q864 1JKGB 4HZBB 5IW9A 1D6ZA 3EQQB 3JVCA 3BNDA 1TJDA 5FW5A 1TIJA 1EG9B 1GY5A 4N6UA 3J7Yd 1DMNA 5TGNA 3KIIA 5EVHA 4JRFA 1F8NA 1GOUA 1LNHA 1ZO2A 2HMNB 3BB9A 5DREA 4KT3B 3E99A 2YX9A 1HU9A 1V57A 1I3IA 2Z76A 3H3HA 3LTBA 3G16A 1FGMA 3PCRA 1ZS7A 3K9MC 4FMCA 3CU3A 4RNYA 3CCS3 2K54A 4G1MB 1B2UA 4MMYB 4RZMA 1B2MA 4HOHA 3NBJA 1RGCA 1JKGA 3LH4A 5G1LA 1FGRA 1GMQA 1RDSA 3ALAA 2W04A 4HBRA 5BU4A 1C54A 3KFQC 2CKFB 2AADA 3L0RA 3B4OA 2BNGA 1IQYA 1I3FA 2HMJB 3DH2A 4ORLA 1B27A 2RBIA 1RGAA 4O2HA 1QVG2 1N5PA 1RKYA 1VQ73 3BNEA 4GSPA 1JNQA 1KSIA 4HM7B 1Q824 1U8CB 4R9LA 4FR9A 3F8HA 3ROBA 1KD14 2Z77A 1W2ZA 3D3LA 3U97A 1JBTA 4J5KA 1LOYA 1TUHA 3GRDA 1BSCA 1NNVA 2R4IA 5EQLA 4EXRA 2XRXB 2P09A 4EV5A 2P0XA 3F7SA 2BHMA 3B4PA 1QAFA 3G6E3 3DGYA 2CFWA 1RGLA 3WHOA 1BNJA 2RCDA 3ZG5A 1LOWA 3A5EA 4O8SA 3PCSA 3ECFA 1YJW3 1RSNA 4LZIA 4LEHA 3OWSA 1A90A 2QGUA 1R4CA 1BSBA 2W6JH 3GAXA 1W01A 4RNZA 1L5GB 4O3VA 1X1WA 1X1YA 4BTXA 2XFSA 1LOVA 1FGTA 1UGHI 2H0GA 3UL6A 2IY2A 3H51A 3AHWA 2F4YA 1ROAA 3LYGA 1BRGA 1B20A 2BIRA 2CK3H 1J2BA 3G0KA 3NQYA 1YVBI 2ZL8A 3HIGA 5AI1A 1RGEA 2UUGC 3O8YA 4HVNA 2C11A 4O02B 4WWUC 1YIJ3 1OGZA 2AAEA 3OW22 4K1UA 1UI8A 1GS3A 1AY7A 3DGLA 4HM5B 1CYVA 1UI7A 5LC7A 5IG3A 4XDWA 2W2CA 1N9JA 1RJOA 3RGAA 3EB8A 1K8A4 1MWTA 3RGRA 1UCIA 1BVIA 3V98A 2XH9A 1VQP3 2ZHXB 4K61A 3JUPA 2ML6A 3DGOA 1LNIA 3EHCA 3GZXB 1GD4A 2OQEA 3OV4A 2FNQA 3DXOA 4R80A 1BNFA 4OK0A 3D4AA 1VZZA 3MG3A 6GSPA 1W5ZA 3DM8A 4IIAA 1MGWA 4GB5A 1LXEA 2XGNA 4BTWA 1K9M4 2CG0A 1RLSA 1HKXA 3HX8A 3EJVA 4LSOA 4IPBA 4MEIA 1UUGB 2D42A 4H61A 1JBSA 4TX4A 3V99A 1GOYA 1Q40B 6RNTA 1GSPA 1CQSA 3FZWA 3MHEA 3T8UA 2GU1A 2XR8B 1PY3A 1FUWA 3IPTA 1IVVA 1M1K4 2GXFA 1IU7A 3EE1A 1QALA 2LYXA 3KZTA 5G2GA 4L8OA 3SVAA 4R4KA 3NM2A 3K5TA 2IYJA 1N8R4 2ZA4A 4HM4B 4ZM8A 1N9EA 4WP5A 3AMOA 1RGKA 3DGMA 3KE7A 3OXAA 1BRJA 5IG4A 3UNLA 3N8BA 3WA2X 4CPKA 1FYSA 1IVXA 1Q40A 2E2TA 1KC84 1AR0A 4GL6A 4XBTA 1A67A 3CMA3 2YFLB 5M18A 1ASKA 2BMQB 5RNTA 4WFOA 5IEPA 1MNLA 2BMRB 2K0MA 1R4YA 2SARA 3AGOA 3AGNA 4HM2B 2W0QA 4HM6B 3ZG0A 2WO0A 4AKZA 5KP4A 5M19A 2OCTA 1BOXA 3OWUA 3SOAA 1EEJA 2XEPA 1TP6A 1BNEA 3FH1A 3LMLA 1NB5I 2UGIA 1RNTA 1BSEA 3MG2A 3CPW2 2BT3A 1VQO3 4KFDA 3M8CA 1E3VA 2OTJ3 5AIFA 2PZVA 5IERA 4HYZA 2CG1A 1SARA 1FGOA 1KWIA 5AEWB 2J8XB 1AV4A 1JZOA 1ULIB 4BL3A 2KRTA 5AYRB 3GZBA 1BRHA 2H0HA 3S5CA 3FGYA 3GZYB 1YVSA 1QMAA 1PU4A 3IJEB 1EKMA 2H0IA 2W56B 3GWRA 3KCHA 3N54B 2XSHB 1RN4A 1GMPA 2FGTA 3BIRA 3FG1A 4CJNA 3PYJA 1YJ93 1BU4A 1I8VA 2RSXA 1JN5B 1STDA 3NX0A 3BLZA 5AIIA 5IG0A 3V92A 4KFEA 2E2UA 1RRHA 1RRLA 2IUKA 4OVMA 8CHOA 2OWPA 4U13A 3CCL3 1VQ93 2CIUA 2Y73A 1EA2A 3MSOA 4FMBA 3X3YA 1YGWA 1US1A 1W6CA 4HAAA 1G0TA 1JZDA 2B24B 2W03A 2L4VA 3NQZA 2W56A 2CFGA 3DY5A 3Q2PA 1UUVB 5GSPA 5IG5A 1LVNA 1BAOA 1FUSA 5D82A 2FXTA 2YFJB 4EBGA 3CCM3 4XM4A 1BRSA 1MWSA 5CK6A 4K90B 1BRNL 2ML5A 3LT8A 1YGEA 3OWYA 4NHFA 4GHOA 3LT9A 2INXA
chains in the Genus database with same CATH topology
4LYLB 1UDII 1LQMB 2UUGC 1EUIC 2UGIA 1UUGB 1LQGC 2J8XB 1UGHI 1UGIA 2ZHXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYL B;  1UDI I;  1LQM B;  2UUG C;  1EUI C;  2UGI A;  1UUG B;  1LQG C;  2J8X B;  1UGH I;  1UGI A;  2ZHX B; 
#chains in the Genus database with same CATH topology
 4DKI A;  2Z7A A;  2CFK A;  3CD6 3;  1OPY A;  1TRQ A;  5AIH A;  3UB1 A;  1UCL A;  2B1X B;  5CF1 A;  4PEJ A;  4AEQ A;  5JPP A;  4EW5 A;  2HOH A;  1Z1S A;  3K63 A;  4LGQ A;  1TTO A;  1I2F A;  3WDG B;  3JUO A;  2YFI B;  1YI2 3;  2ZDJ A;  2HML B;  3WA3 A;  1AQZ A;  1GD3 A;  3EF8 A;  1BSA A;  1TFK A;  4MMZ B;  4LMI A;  1IDP A;  5ELJ A;  3S28 A;  1VQN 3;  2XGL A;  2F86 B;  1OHS A;  2O9U X;  1UUW B;  3FG3 A;  4N6M A;  1DET A;  4FCJ A;  1NO3 A;  2P38 A;  1VQK 3;  3F40 A;  3LTD A;  3SLU A;  2GSP A;  3CXC 2;  1JJ2 2;  1VQQ A;  1V74 A;  3D79 A;  1I70 A;  1DVD A;  3IMA B;  4R1K A;  1Q42 A;  3NBR A;  4N6V 0;  5KP3 A;  3HOH A;  1IQX A;  1E97 A;  2F5W A;  3EN1 B;  3SYU A;  3FLJ A;  4RNT A;  1T2H A;  2CHC A;  1RNB A;  2Y74 A;  1PFP A;  1Q9E A;  1UDI I;  1O7P B;  5HOH A;  1V58 A;  1WMP A;  2JDI H;  1D6Y A;  3K7C A;  4NPB A;  1SJW A;  4J5G A;  1IVU A;  3I55 3;  1Q7Y 4;  1BNR A;  5LC6 A;  1MOL A;  1S5A A;  1IV7 A;  1W7C A;  1LOX A;  1DMQ A;  3DGN A;  3I0Y A;  1OH0 A;  3KSP A;  2QA4 3;  1S72 3;  2HMM B;  1UCJ A;  1DE3 A;  3G71 3;  3F14 A;  4WYK B;  3T8N A;  2MF7 A;  4WHA A;  4XBX A;  3UL5 A;  5IEO A;  2GU3 A;  3S27 A;  3CC2 3;  3GSP A;  1M9G A;  4L7K A;  1CH0 A;  3FSD A;  4N3V A;  1ULJ B;  5STD A;  5AIG A;  1NU3 A;  2KF3 A;  1JV2 B;  1DVC A;  3MPH A;  1A2V A;  1B3S A;  3KSE D;  3JUM A;  1BRI A;  1EUI C;  4FMA A;  3GZR A;  1E3R A;  7RNT A;  4BIR A;  1JB2 A;  4LYL B;  2GEX A;  1WTH A;  2OQE C;  1RGH A;  1FZU A;  4STD A;  4X2O A;  1M90 4;  1D6U A;  4HZ9 B;  5BXQ A;  1HYF A;  1Q7H A;  5DRV A;  5A0O B;  3TDG A;  1SQW A;  1B21 A;  2CFL A;  1LRA A;  2CX0 A;  1IVW A;  2OOV C;  4KZ1 A;  4R9K A;  1FA3 A;  1VQL 3;  5JPU A;  1STF I;  2IMJ A;  1BAN A;  3CCQ 3;  1OAC A;  4QWT A;  1M1X B;  1NDO B;  1VQ4 3;  1BUQ A;  1IYY A;  2C10 A;  2P0M A;  1MGR A;  3JUQ A;  1N5H A;  3URP A;  4CCV A;  3RNT A;  3FCS B;  3SED A;  1WQL B;  4N6N B;  1Y4K A;  2XSO B;  1K28 A;  2P05 A;  4HM8 B;  2IUJ A;  3WMD A;  1OF5 B;  5BIR A;  1B2X A;  2WOF A;  1UW1 A;  1W6Y A;  4K1V A;  1GOV A;  5CF2 A;  3U1W A;  3Q90 A;  1IV9 A;  1FGQ A;  3WOE B;  1BUJ A;  2KCD A;  2CFD A;  1YNV X;  5BVB A;  3D5I A;  3UJM A;  3SXX A;  3X3X A;  5AEU B;  7GSP A;  1BIR A;  1BRK A;  2WGO A;  2XF3 A;  3I56 3;  1W6G A;  1BNI A;  4J9A A;  1B2S A;  3PS8 A;  2W9P A;  2RNT A;  2IA7 A;  1WMN A;  1O7G B;  2Z6B A;  3Q3F A;  1OF5 A;  3G8Z A;  3VGN A;  1OUN A;  2KF4 A;  3KKG A;  1I0V A;  4FCM A;  3T0U A;  3WOF B;  1GYB A;  1BSD A;  2CH9 A;  5I97 A;  4HKV B;  1CEW I;  1UGI A;  5M1A A;  4JF8 A;  3N9H A;  3EC9 A;  3CNM A;  1KQS 2;  1BNG A;  4NRE A;  4N6L A;  1QVF 2;  1JB4 A;  5IF6 A;  1PYL A;  2BU4 A;  3CPO A;  5EEO A;  1UCK A;  1AVK A;  1B2Z A;  1DMM A;  3CC7 3;  3F8X A;  2F56 A;  1W00 A;  1OHO A;  1ROV A;  3B8L A;  3CC4 3;  2Q07 A;  3MYT A;  1JRQ A;  2R41 A;  1IT8 A;  2HMK B;  3NXJ A;  1RCL A;  1YJN 3;  1TRP A;  1AVL A;  3A76 A;  2XFT A;  3MG1 A;  1X1U A;  2CWV A;  3X40 A;  3HII A;  8RNT A;  3AHS A;  1G96 A;  1K41 A;  3DMC A;  4H3U A;  3G4S 3;  4RBN A;  2KXG A;  3MWZ A;  3LXU X;  5AYS C;  3Q1C A;  5G1K A;  1O7N B;  3CCE 3;  2KAA A;  1RN1 A;  2BO9 B;  2CC3 A;  1VQM 3;  1JN5 A;  1K73 4;  3NM7 A;  1O7W B;  1G02 A;  2C4B A;  2CW9 A;  2KF6 A;  1T2I A;  1A2P A;  1RCK A;  3SOY A;  3ZFZ A;  3NHX A;  1VQ8 3;  3BNB A;  2STD A;  3FKA A;  5HGR A;  4AKY A;  3NV0 B;  1RGG A;  4N6T A;  1YIT 3;  2WGQ A;  1MWR A;  2SBL A;  3D9R A;  3LOY A;  4HM1 B;  1EQK A;  3DUK A;  1RMS A;  4HJL B;  1LQG C;  1IT7 A;  2L1S A;  4XDV A;  2BMO B;  3QK9 A;  1I2G A;  1SII A;  4IT7 A;  3QRD A;  1NWW A;  2GBX B;  2CX1 A;  4I5Q A;  2K3D A;  1DYU A;  3D5G A;  1SPU A;  1C7H A;  2KF5 A;  3EX9 A;  3NV0 A;  4XBY A;  1ISK A;  1WMO A;  2CWU A;  2JQ5 A;  4OUQ A;  4L8P A;  1U5O A;  1T5Y A;  1TFO A;  1FUT A;  2MC8 A;  6STD A;  2OTL 3;  3F7X A;  3BNC A;  4BU4 A;  1N8Q A;  1YHQ 3;  4BTY A;  3B7C A;  1JB5 A;  2E2V A;  3DZL A;  4N6O B;  1WNH A;  1MWU A;  3FF0 A;  4MMX B;  3SX1 A;  3WR2 A;  3LTA A;  5FGO A;  3ER7 A;  3K0Z A;  1SIH A;  3X42 A;  2HMO B;  3RDE A;  3PGB A;  4MJD A;  4EC6 A;  5JBS A;  2PNC A;  4KVH A;  3FF2 A;  2RGQ A;  9RNT A;  1W4N A;  1ZX2 A;  1QAK A;  2I9W A;  3NUV A;  3HZP A;  4J8T A;  4BL2 A;  2CWT A;  4EYC A;  1X1X A;  1TU5 A;  1HZ1 A;  3PZW A;  1OCV A;  1O7M B;  1GY6 A;  3FG4 A;  3OX9 A;  1NJI 4;  3LTC A;  4WYK A;  3CNX A;  1NB3 I;  3BU4 A;  4I4K A;  1FW7 A;  7STD A;  4ILF A;  1IK3 A;  5KP1 A;  2M7O A;  2W9Q A;  2OOV A;  3CCU 3;  1W02 A;  4FCZ A;  5CXO A;  1GY7 A;  3EBT A;  1QJG A;  1RN7 A;  2GBW B;  2F99 A;  2UX0 A;  4XB5 A;  3CCR 3;  4Q53 A;  3S29 A;  1RGF A;  3X3Z A;  1A2K A;  1IQ8 A;  3AMO B;  1ZGX A;  4HM0 B;  5IEN A;  1VQ6 3;  2LQV A;  3EN8 A;  3STD A;  4FMD A;  4X2H A;  1W2B 2;  3X41 A;  5CLK A;  1GMR A;  4EV2 A;  2A15 A;  2GEY A;  5D81 A;  3VSY A;  3WOD G;  2O3O A;  3MKI A;  4HM3 B;  2QEX 3;  1CYU A;  2D1W A;  3CCJ 3;  3KN4 A;  1T3B A;  3NBB A;  2F98 A;  3HK4 A;  1I2E A;  1Q81 4;  1VQ5 3;  1I0X A;  1OGX A;  1JBR A;  2V1L A;  3HI7 A;  3CCV 3;  2WOH A;  1BGS A;  1OHP A;  5ELU A;  2F5M A;  3JUN A;  2QIY A;  3EBY A;  3F9S A;  1RTU A;  3S67 A;  1RHL A;  3LZA A;  5D83 A;  1BNS A;  3VF1 A;  1LQM B;  4CDL A;  1O7H B;  3PXM A;  2RFR A;  4KFF A;  3CME 3;  1Q86 4;  1JKG B;  4HZB B;  5IW9 A;  1D6Z A;  3EQQ B;  3JVC A;  3BND A;  1TJD A;  5FW5 A;  1TIJ A;  1EG9 B;  1GY5 A;  4N6U A;  3J7Y d;  1DMN A;  5TGN A;  3KII A;  5EVH A;  4JRF A;  1F8N A;  1GOU A;  1LNH A;  1ZO2 A;  2HMN B;  3BB9 A;  5DRE A;  4KT3 B;  3E99 A;  2YX9 A;  1HU9 A;  1V57 A;  1I3I A;  2Z76 A;  3H3H A;  3LTB A;  3G16 A;  1FGM A;  3PCR A;  1ZS7 A;  3K9M C;  4FMC A;  3CU3 A;  4RNY A;  3CCS 3;  2K54 A;  4G1M B;  1B2U A;  4MMY B;  4RZM A;  1B2M A;  4HOH A;  3NBJ A;  1RGC A;  1JKG A;  3LH4 A;  5G1L A;  1FGR A;  1GMQ A;  1RDS A;  3ALA A;  2W04 A;  4HBR A;  5BU4 A;  1C54 A;  3KFQ C;  2CKF B;  2AAD A;  3L0R A;  3B4O A;  2BNG A;  1IQY A;  1I3F A;  2HMJ B;  3DH2 A;  4ORL A;  1B27 A;  2RBI A;  1RGA A;  4O2H A;  1QVG 2;  1N5P A;  1RKY A;  1VQ7 3;  3BNE A;  4GSP A;  1JNQ A;  1KSI A;  4HM7 B;  1Q82 4;  1U8C B;  4R9L A;  4FR9 A;  3F8H A;  3ROB A;  1KD1 4;  2Z77 A;  1W2Z A;  3D3L A;  3U97 A;  1JBT A;  4J5K A;  1LOY A;  1TUH A;  3GRD A;  1BSC A;  1NNV A;  2R4I A;  5EQL A;  4EXR A;  2XRX B;  2P09 A;  4EV5 A;  2P0X A;  3F7S A;  2BHM A;  3B4P A;  1QAF A;  3G6E 3;  3DGY A;  2CFW A;  1RGL A;  3WHO A;  1BNJ A;  2RCD A;  3ZG5 A;  1LOW A;  3A5E A;  4O8S A;  3PCS A;  3ECF A;  1YJW 3;  1RSN A;  4LZI A;  4LEH A;  3OWS A;  1A90 A;  2QGU A;  1R4C A;  1BSB A;  2W6J H;  3GAX A;  1W01 A;  4RNZ A;  1L5G B;  4O3V A;  1X1W A;  1X1Y A;  4BTX A;  2XFS A;  1LOV A;  1FGT A;  1UGH I;  2H0G A;  3UL6 A;  2IY2 A;  3H51 A;  3AHW A;  2F4Y A;  1ROA A;  3LYG A;  1BRG A;  1B20 A;  2BIR A;  2CK3 H;  1J2B A;  3G0K A;  3NQY A;  1YVB I;  2ZL8 A;  3HIG A;  5AI1 A;  1RGE A;  2UUG C;  3O8Y A;  4HVN A;  2C11 A;  4O02 B;  4WWU C;  1YIJ 3;  1OGZ A;  2AAE A;  3OW2 2;  4K1U A;  1UI8 A;  1GS3 A;  1AY7 A;  3DGL A;  4HM5 B;  1CYV A;  1UI7 A;  5LC7 A;  5IG3 A;  4XDW A;  2W2C A;  1N9J A;  1RJO A;  3RGA A;  3EB8 A;  1K8A 4;  1MWT A;  3RGR A;  1UCI A;  1BVI A;  3V98 A;  2XH9 A;  1VQP 3;  2ZHX B;  4K61 A;  3JUP A;  2ML6 A;  3DGO A;  1LNI A;  3EHC A;  3GZX B;  1GD4 A;  2OQE A;  3OV4 A;  2FNQ A;  3DXO A;  4R80 A;  1BNF A;  4OK0 A;  3D4A A;  1VZZ A;  3MG3 A;  6GSP A;  1W5Z A;  3DM8 A;  4IIA A;  1MGW A;  4GB5 A;  1LXE A;  2XGN A;  4BTW A;  1K9M 4;  2CG0 A;  1RLS A;  1HKX A;  3HX8 A;  3EJV A;  4LSO A;  4IPB A;  4MEI A;  1UUG B;  2D42 A;  4H61 A;  1JBS A;  4TX4 A;  3V99 A;  1GOY A;  1Q40 B;  6RNT A;  1GSP A;  1CQS A;  3FZW A;  3MHE A;  3T8U A;  2GU1 A;  2XR8 B;  1PY3 A;  1FUW A;  3IPT A;  1IVV A;  1M1K 4;  2GXF A;  1IU7 A;  3EE1 A;  1QAL A;  2LYX A;  3KZT A;  5G2G A;  4L8O A;  3SVA A;  4R4K A;  3NM2 A;  3K5T A;  2IYJ A;  1N8R 4;  2ZA4 A;  4HM4 B;  4ZM8 A;  1N9E A;  4WP5 A;  3AMO A;  1RGK A;  3DGM A;  3KE7 A;  3OXA A;  1BRJ A;  5IG4 A;  3UNL A;  3N8B A;  3WA2 X;  4CPK A;  1FYS A;  1IVX A;  1Q40 A;  2E2T A;  1KC8 4;  1AR0 A;  4GL6 A;  4XBT A;  1A67 A;  3CMA 3;  2YFL B;  5M18 A;  1ASK A;  2BMQ B;  5RNT A;  4WFO A;  5IEP A;  1MNL A;  2BMR B;  2K0M A;  1R4Y A;  2SAR A;  3AGO A;  3AGN A;  4HM2 B;  2W0Q A;  4HM6 B;  3ZG0 A;  2WO0 A;  4AKZ A;  5KP4 A;  5M19 A;  2OCT A;  1BOX A;  3OWU A;  3SOA A;  1EEJ A;  2XEP A;  1TP6 A;  1BNE A;  3FH1 A;  3LML A;  1NB5 I;  2UGI A;  1RNT A;  1BSE A;  3MG2 A;  3CPW 2;  2BT3 A;  1VQO 3;  4KFD A;  3M8C A;  1E3V A;  2OTJ 3;  5AIF A;  2PZV A;  5IER A;  4HYZ A;  2CG1 A;  1SAR A;  1FGO A;  1KWI A;  5AEW B;  2J8X B;  1AV4 A;  1JZO A;  1ULI B;  4BL3 A;  2KRT A;  5AYR B;  3GZB A;  1BRH A;  2H0H A;  3S5C A;  3FGY A;  3GZY B;  1YVS A;  1QMA A;  1PU4 A;  3IJE B;  1EKM A;  2H0I A;  2W56 B;  3GWR A;  3KCH A;  3N54 B;  2XSH B;  1RN4 A;  1GMP A;  2FGT A;  3BIR A;  3FG1 A;  4CJN A;  3PYJ A;  1YJ9 3;  1BU4 A;  1I8V A;  2RSX A;  1JN5 B;  1STD A;  3NX0 A;  3BLZ A;  5AII A;  5IG0 A;  3V92 A;  4KFE A;  2E2U A;  1RRH A;  1RRL A;  2IUK A;  4OVM A;  8CHO A;  2OWP A;  4U13 A;  3CCL 3;  1VQ9 3;  2CIU A;  2Y73 A;  1EA2 A;  3MSO A;  4FMB A;  3X3Y A;  1YGW A;  1US1 A;  1W6C A;  4HAA A;  1G0T A;  1JZD A;  2B24 B;  2W03 A;  2L4V A;  3NQZ A;  2W56 A;  2CFG A;  3DY5 A;  3Q2P A;  1UUV B;  5GSP A;  5IG5 A;  1LVN A;  1BAO A;  1FUS A;  5D82 A;  2FXT A;  2YFJ B;  4EBG A;  3CCM 3;  4XM4 A;  1BRS A;  1MWS A;  5CK6 A;  4K90 B;  1BRN L;  2ML5 A;  3LT8 A;  1YGE A;  3OWY A;  4NHF A;  4GHO A;  3LT9 A;  2INX A; 
#chains in the Genus database with same CATH homology
 4LYL B;  1UDI I;  1LQM B;  2UUG C;  1EUI C;  2UGI A;  1UUG B;  1LQG C;  2J8X B;  1UGH I;  1UGI A;  2ZHX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...