1UUGB

Escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Replication, hydrolase
total genus 15
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1uugB00
2UGIA 4LYLB 2J8XB 1UGIA 2UUGC 1LQMB 1LQGC 1UDII 1UGHI 1UUGB 1EUIC 2ZHXB
chains in the Genus database with same CATH superfamily
1DVDA 4ILFA 1JKGB 1G0TA 1TIJA 1ASKA 1V57A 1NJI4 3EBYA 3RDEA 1S723 3FKAA 3DMCA 2KAAA 3CCR3 5ELUA 1BOXA 4L8PA 2K54A 1RN1A 1A2PA 1HYFA 1QJGA 3K7CA 1E3VA 3VF1A 2OQEA 1KSIA 4ZM8A 3GZBA 4WFOA 3F14A 1W02A 3NQZA 4K90B 5CF2A 4BTWA 1PYLA 3CXC2 1S5AA 5A0OB 1DMQA 4EBGA 1B2MA 3RGRA 1TRPA 1YJN3 1IYYA 1O7HB 1AR0A 1UI7A 3D3LA 2YFIB 3JUMA 3CCU3 2WOFA 1N5PA 1RGCA 1WQLB 3B7CA 4XBYA 3KKGA 2D42A 1Q7HA 3MHEA 5FGOA 2B24B 4HM7B 5AEUB 2I9WA 1JB2A 5AYSC 3CCJ3 1Q42A 1W6CA 1X1UA 3PCSA 3X41A 1YI23 1JBSA 3F9SA 2F56A 4O2HA 3B8LA 3STDA 3G8ZA 3JUPA 4N6NB 3BNBA 1JZOA 4LEHA 2P09A 1GOVA 1TUHA 1FA3A 4BTYA 1FW7A 3K5TA 3VGNA 7STDA 5RNTA 1RRHA 1I0VA 3PS8A 5BU4A 1K734 1YGWA 1IK3A 2JDIH 2PNCA 3UJMA 3CCS3 2GXFA 2GEXA 1N5HA 1PY3A 4NPBA 1R4CA 1IVXA 2CX0A 3Q3FA 4BL3A 1C54A 4NREA 4O8SA 1STDA 2UUGC 3PXMA 4WP5A 1JB4A 4HAAA 2OWPA 2WO0A 3BNCA 1RCKA 1RCLA 3MWZA 5GSPA 2XSHB 1VQ53 1NNVA 2CFWA 2R41A 1N8QA 4GSPA 3X40A 1OGZA 1EQKA 2O9UX 5KP3A 1N9EA 1NWWA 3DZLA 3PYJA 2F4YA 4KFFA 5G1KA 1L5GB 4BL2A 2CG0A 1W4NA 2HMOB 1UUWB 2YX9A 3D9RA 3K63A 4EYCA 5FW5A 4RBNA 5IF6A 3CC43 5D83A 3LTDA 2IUJA 4OK0A 1STFI 3KIIA 1BRJA 1NU3A 2F86B 2OOVA 3JUQA 3K9MC 1D6UA 3M8CA 2IMJA 2Z6BA 3JUOA 1LOVA 1FUWA 2XGLA 1Q40A 4GB5A 4O02B 4HYZA 1TJDA 4WWUC 2AAEA 3DGMA 4RNTA 3WHOA 2WGOA 1BSDA 3ECFA 1N9JA 3GSPA 3V99A 3D4AA 1GD3A 3S27A 5CLKA 4MMZB 1YJ93 1IV7A 1QVG2 3BU4A 2QEX3 2CH9A 1WNHA 3LTBA 1CYVA 1GS3A 3GWRA 5G2GA 5I97A 1IVWA 2KF6A 1Q40B 4LGQA 1ROVA 3UL6A 3KCHA 1B2XA 3IMAB 1FUSA 1LVNA 5EQLA 2HMKB 7RNTA 3CMA3 4LMIA 1RGLA 1U5OA 3NBRA 1FGQA 1TTOA 2K0MA 3DGNA 3WA3A 1BNEA 1FUTA 1OPYA 4RNZA 3EN1B 3ROBA 1BGSA 2E2UA 1DMMA 1GOYA 1T5YA 3URPA 3KN4A 1IT7A 1UCKA 3PZWA 1RN7A 1I0XA 2W03A 2ZA4A 1NB3I 2MC8A 2Y74A 2RBIA 1JBTA 5M18A 1RGFA 4N6OB 1BRNL 1SARA 2XF3A 1OHOA 2IUKA 3JVCA 3LXUX 5DRVA 2XGNA 3KZTA 4FMDA 3LYGA 5AIGA 3CCE3 1BRGA 3DM8A 1OF5A 4N6LA 3CC23 2MF7A 4MEIA 1GOUA 2CIUA 3K0ZA 3CCV3 2F5MA 3N54B 1IQXA 3DUKA 2V1LA 3BLZA 4GL6A 1GSPA 3UNLA 3VSYA 2W56A 3NQYA 3NUVA 3NV0B 3OX9A 5G1LA 2CG1A 3H51A 3JUNA 1BNJA 2CWVA 4K1VA 5AIHA 6GSPA 1B3SA 2CC3A 2QIYA 2W2CA 1O7NB 1PU4A 5LC7A 1X1YA 3AMOA 1JJ22 4AKYA 4N6MA 3WOEB 1MWUA 2W56B 3BB9A 1VQ63 2W0QA 3BNEA 2FXTA 4J9AA 3DGOA 1MNLA 3NM2A 4FR9A 4HM6B 4CJNA 5JPPA 2WGQA 3NBJA 1RMSA 3LMLA 3HOHA 1JN5A 1F8NA 3S5CA 1OUNA 2OTJ3 4J8TA 4IPBA 4BTXA 3DH2A 5STDA 3AMOB 3HK4A 1RNTA 3WMDA 3AHSA 3CNMA 2L4VA 2RGQA 3UL5A 1ROAA 3ALAA 3PCRA 4XDWA 2LYXA 1OH0A 1JN5B 4FCZA 3DY5A 3SX1A 3O8YA 2INXA 3CNXA 3FH1A 2K3DA 2BT3A 3LZAA 4PEJA 2ML6A 1T2HA 1HKXA 3QRDA 1GD4A 5KP1A 2FNQA 3GAXA 5EEOA 3OXAA 1B2UA 1AVLA 1VQO3 1VQ43 1X1XA 1YNVX 1E97A 2ZL8A 1FGMA 1MWSA 2ML5A 3MG2A 1LOXA 5IERA 5KP4A 2Z77A 2XR8B 1BNSA 3CPW2 1N8R4 1AY7A 3F40A 1B21A 4HZBB 4BIRA 1O7GB 1B27A 3N9HA 1WMNA 3OWYA 5TGNA 4I5QA 3DXOA 3S67A 5ELJA 1TFOA 1OCVA 2ZDJA 1I2GA 3CD63 3RNTA 1BU4A 4L8OA 1MGRA 1RGKA 5CF1A 1FZUA 1M1K4 1X1WA 1W2ZA 3LOYA 1BUQA 3D5IA 3FCSB 2Z7AA 1NB5I 1ISKA 1EEJA 3KFQC 3EX9A 1KD14 4X2OA 1Y4KA 1UUGB 1UW1A 1BUJA 4HM1B 1I3IA 4CDLA 3EE1A 1CH0A 4EW5A 1KWIA 2RSXA 1A2KA 1SIHA 3CCL3 1RLSA 1IVUA 2HMJB 3MYTA 4N3VA 3X3YA 1IDPA 2E2VA 3GZRA 3CU3A 3LT9A 4HJLB 4J5KA 2QA43 3F8HA 3I0YA 5M19A 1BSCA 3B4OA 1G02A 3F7XA 2GBXB 3EN8A 3NBBA 3MG1A 2CX1A 3A76A 1GMRA 2Y73A 3LTCA 4JRFA 3PGBA 3J7Yd 1CQSA 1ULJB 3A5EA 5AI1A 1W2B2 5IW9A 3KSED 4XBTA 3G6E3 3S28A 3SXXA 1K8A4 1A67A 4MJDA 1SPUA 3ZFZA 8CHOA 2XH9A 3NM7A 1VQ73 1KC84 1JNQA 2AADA 4OVMA 1UI8A 4FMAA 4H61A 1EG9B 1W7CA 5AIFA 1W6GA 3OWUA 4AEQA 2IY2A 1MOLA 3LH4A 2L1SA 5AIIA 3OWSA 4MMYB 1T2IA 2J8XB 3X3ZA 1LQGC 4FCMA 1BRSA 1RGAA 1I3FA 3QK9A 1YGEA 2UGIA 1MWRA 4HM4B 1O7PB 3GZYB 2P38A 5CK6A 3WODG 1BNIA 1A2VA 1I8VA 2RNTA 1YIJ3 1R4YA 5EVHA 4R1KA 1HU9A 2HMLB 1I2FA 3NX0A 2IYJA 4KVHA 1GMQA 3EF8A 3G713 1YHQ3 3SVAA 1UUVB 3EB8A 1QALA 2BMOB 2HOHA 4ORLA 3F8XA 2CWUA 1AVKA 3NV0A 4WYKB 4WHAA 2H0IA 2Z76A 3IJEB 4OUQA 3FSDA 1VQQA 3G16A 4U13A 1VZZA 3KE7A 4LYLB 4KFEA 1BSAA 1LOYA 2M7OA 4HM3B 3U97A 1SQWA 1YIT3 3H3HA 1VQL3 3FG1A 4XBXA 2W9QA 2H0GA 3ZG5A 3T8UA 2RCDA 1Z1SA 1B2ZA 3OW22 2GU3A 3MSOA 5HOHA 2BNGA 4HVNA 1IQYA 1SIIA 2CKFB 1AQZA 9RNTA 2XFTA 4JF8A 2W04A 3G4S3 3CCQ3 5BVBA 4HM2B 2O3OA 4EXRA 3OV4A 2GBWB 1ZS7A 2SARA 1FGRA 4N6UA 1TU5A 1QAFA 3B4PA 4Q53A 1YVSA 1WTHA 4RZMA 1BVIA 1FGOA 5IG0A 1ZX2A 4EV2A 1E3RA 2CWTA 1D6ZA 3CPOA 4AKZA 1LNHA 1RDSA 2BIRA 4EC6A 3V92A 1M1XB 1UGIA 3N8BA 4DKIA 1W6YA 1DMNA 2CW9A 4HM8B 3X42A 2F5WA 4R80A 1YJW3 3EBTA 1W00A 7GSPA 4KT3B 1VQ93 1C7HA 2KXGA 2D1WA 4EV5A 1MWTA 1UDII 1JV2B 4KFDA 3UB1A 2CK3H 4HM0B 5IEPA 2RFRA 5M1AA 5JPUA 2C10A 4RNYA 1RNBA 2H0HA 1Q864 2BMRB 4R9LA 5JBSA 1Q824 1BRIA 1O7WB 3SEDA 4QWTA 3SYUA 1UCLA 2A15A 3HI7A 1BIRA 1B20A 2Q07A 1LXEA 3HIGA 2IA7A 4N6TA 1LQMB 5D81A 3LTAA 2E2TA 3F7SA 3FGYA 1Q7Y4 5LC6A 3GZXB 1LRAA 1OGXA 3U1WA 5BIRA 1JZDA 2CFKA 1RJOA 1G96A 5IG3A 3HIIA 1JBRA 2FGTA 2QGUA 1QVF2 1WMOA 2BHMA 4R4KA 1A90A 2P0MA 2W6JH 4STDA 1NDOB 4CPKA 3S29A 1IVVA 1WMPA 1U8CB 1PFPA 4H3UA 2R4IA 4G1MB 3EHCA 1ZO2A 3FG4A 4KZ1A 4N6V0 1IV9A 1MGWA 1RSNA 1GY5A 1D6YA 1RGGA 1V58A 3AHWA 3ZG0A 3Q2PA 2SBLA 4CCVA 2OTL3 3NHXA 2KCDA 1UCIA 1M904 1BNRA 2CHCA 3T8NA 1TRQA 3SOAA 1VQN3 2P05A 2YFLB 3D79A 1BSEA 1V74A 2OQEC 3GRDA 3FLJA 1QAKA 5DREA 3X3XA 2BO9B 1HZ1A 2GEYA 1K41A 5CXOA 3AGNA 1GY6A 1OHSA 2F99A 3KSPA 4GHOA 3DGYA 3WOFB 3MPHA 2C4BA 3EC9A 3CC73 1QMAA 1W5ZA 2KF3A 2CFLA 2YFJB 3HZPA 1EUIC 2WOHA 2PZVA 3FF0A 1EKMA 3CME3 2KRTA 3MG3A 1RGHA 2BU4A 2GU1A 2STDA 1BANA 1DVCA 2JQ5A 2F98A 2KF5A 1BRKA 1Q814 4IIAA 1IT8A 3SOYA 3D5GA 1J2BA 1US1A 1FGTA 4FCJA 3TDGA 1BAOA 3IPTA 3EQQB 3ER7A 6RNTA 4WYKA 3V98A 1ULIB 1I70A 1JRQA 1RHLA 1RTUA 4HBRA 4K1UA 1DETA 4X2HA 1LNIA 5AEWB 3Q90A 1JB5A 2C11A 4TX4A 4FMBA 5BXQA 2UX0A 4R9KA 1BNFA 1BRHA 1YVBI 3BIRA 4LZIA 1KQS2 3DGLA 3FG3A 2HMNB 1GY7A 2CFDA 4HKVB 1I2EA 4K61A 4XB5A 3WDGB 3E99A 5D82A 4BU4A 2KF4A 1NO3A 2XEPA 4HOHA 1O7MB 1VQ83 1GMPA 3FF2A 5AYRB 1EA2A 1VQM3 1BSBA 3Q1CA 4HZ9B 5IG4A 1UCJA 1UGHI 1T3BA 1IU7A 2HMMB 1BNGA 2ZHXB 3EJVA 2B1XB 4L7KA 8RNTA 2GSPA 3BNDA 4O3VA 2XFSA 2CFGA 2P0XA 1OHPA 4NHFA 1CYUA 1OACA 3I553 1RRLA 1ZGXA 3LT8A 1RN4A 1RKYA 4LSOA 2W9PA 1W01A 3HX8A 4XM4A 1RGEA 1TP6A 4HM5B 2XSOB 3G0KA 4J5GA 1CEWI 1DE3A 2OCTA 1IQ8A 1LOWA 4FMCA 5IG5A 1AV4A 3T0UA 6STDA 2LQVA 2OOVC 1GYBA 3WA2X 3AGOA 3RGAA 1K9M4 1FYSA 3FZWA 2XRXB 1Q9EA 4MMXB 1JKGA 2BMQB 3L0RA 4I4KA 1DYUA 3CCM3 4IT7A 1TFKA 3NXJA 1K28A 1M9GA 5HGRA 1OF5B 1VQK3 3MKIA 5IEOA 4XDVA 5IENA 1VQP3 3SLUA 1B2SA 3WR2A 1SJWA 3I563
chains in the Genus database with same CATH topology
2UGIA 4LYLB 2J8XB 1UGIA 2UUGC 1LQMB 1LQGC 1UDII 1UGHI 1UUGB 1EUIC 2ZHXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UGI A;  4LYL B;  2J8X B;  1UGI A;  2UUG C;  1LQM B;  1LQG C;  1UDI I;  1UGH I;  1UUG B;  1EUI C;  2ZHX B; 
#chains in the Genus database with same CATH topology
 1DVD A;  4ILF A;  1JKG B;  1G0T A;  1TIJ A;  1ASK A;  1V57 A;  1NJI 4;  3EBY A;  3RDE A;  1S72 3;  3FKA A;  3DMC A;  2KAA A;  3CCR 3;  5ELU A;  1BOX A;  4L8P A;  2K54 A;  1RN1 A;  1A2P A;  1HYF A;  1QJG A;  3K7C A;  1E3V A;  3VF1 A;  2OQE A;  1KSI A;  4ZM8 A;  3GZB A;  4WFO A;  3F14 A;  1W02 A;  3NQZ A;  4K90 B;  5CF2 A;  4BTW A;  1PYL A;  3CXC 2;  1S5A A;  5A0O B;  1DMQ A;  4EBG A;  1B2M A;  3RGR A;  1TRP A;  1YJN 3;  1IYY A;  1O7H B;  1AR0 A;  1UI7 A;  3D3L A;  2YFI B;  3JUM A;  3CCU 3;  2WOF A;  1N5P A;  1RGC A;  1WQL B;  3B7C A;  4XBY A;  3KKG A;  2D42 A;  1Q7H A;  3MHE A;  5FGO A;  2B24 B;  4HM7 B;  5AEU B;  2I9W A;  1JB2 A;  5AYS C;  3CCJ 3;  1Q42 A;  1W6C A;  1X1U A;  3PCS A;  3X41 A;  1YI2 3;  1JBS A;  3F9S A;  2F56 A;  4O2H A;  3B8L A;  3STD A;  3G8Z A;  3JUP A;  4N6N B;  3BNB A;  1JZO A;  4LEH A;  2P09 A;  1GOV A;  1TUH A;  1FA3 A;  4BTY A;  1FW7 A;  3K5T A;  3VGN A;  7STD A;  5RNT A;  1RRH A;  1I0V A;  3PS8 A;  5BU4 A;  1K73 4;  1YGW A;  1IK3 A;  2JDI H;  2PNC A;  3UJM A;  3CCS 3;  2GXF A;  2GEX A;  1N5H A;  1PY3 A;  4NPB A;  1R4C A;  1IVX A;  2CX0 A;  3Q3F A;  4BL3 A;  1C54 A;  4NRE A;  4O8S A;  1STD A;  2UUG C;  3PXM A;  4WP5 A;  1JB4 A;  4HAA A;  2OWP A;  2WO0 A;  3BNC A;  1RCK A;  1RCL A;  3MWZ A;  5GSP A;  2XSH B;  1VQ5 3;  1NNV A;  2CFW A;  2R41 A;  1N8Q A;  4GSP A;  3X40 A;  1OGZ A;  1EQK A;  2O9U X;  5KP3 A;  1N9E A;  1NWW A;  3DZL A;  3PYJ A;  2F4Y A;  4KFF A;  5G1K A;  1L5G B;  4BL2 A;  2CG0 A;  1W4N A;  2HMO B;  1UUW B;  2YX9 A;  3D9R A;  3K63 A;  4EYC A;  5FW5 A;  4RBN A;  5IF6 A;  3CC4 3;  5D83 A;  3LTD A;  2IUJ A;  4OK0 A;  1STF I;  3KII A;  1BRJ A;  1NU3 A;  2F86 B;  2OOV A;  3JUQ A;  3K9M C;  1D6U A;  3M8C A;  2IMJ A;  2Z6B A;  3JUO A;  1LOV A;  1FUW A;  2XGL A;  1Q40 A;  4GB5 A;  4O02 B;  4HYZ A;  1TJD A;  4WWU C;  2AAE A;  3DGM A;  4RNT A;  3WHO A;  2WGO A;  1BSD A;  3ECF A;  1N9J A;  3GSP A;  3V99 A;  3D4A A;  1GD3 A;  3S27 A;  5CLK A;  4MMZ B;  1YJ9 3;  1IV7 A;  1QVG 2;  3BU4 A;  2QEX 3;  2CH9 A;  1WNH A;  3LTB A;  1CYV A;  1GS3 A;  3GWR A;  5G2G A;  5I97 A;  1IVW A;  2KF6 A;  1Q40 B;  4LGQ A;  1ROV A;  3UL6 A;  3KCH A;  1B2X A;  3IMA B;  1FUS A;  1LVN A;  5EQL A;  2HMK B;  7RNT A;  3CMA 3;  4LMI A;  1RGL A;  1U5O A;  3NBR A;  1FGQ A;  1TTO A;  2K0M A;  3DGN A;  3WA3 A;  1BNE A;  1FUT A;  1OPY A;  4RNZ A;  3EN1 B;  3ROB A;  1BGS A;  2E2U A;  1DMM A;  1GOY A;  1T5Y A;  3URP A;  3KN4 A;  1IT7 A;  1UCK A;  3PZW A;  1RN7 A;  1I0X A;  2W03 A;  2ZA4 A;  1NB3 I;  2MC8 A;  2Y74 A;  2RBI A;  1JBT A;  5M18 A;  1RGF A;  4N6O B;  1BRN L;  1SAR A;  2XF3 A;  1OHO A;  2IUK A;  3JVC A;  3LXU X;  5DRV A;  2XGN A;  3KZT A;  4FMD A;  3LYG A;  5AIG A;  3CCE 3;  1BRG A;  3DM8 A;  1OF5 A;  4N6L A;  3CC2 3;  2MF7 A;  4MEI A;  1GOU A;  2CIU A;  3K0Z A;  3CCV 3;  2F5M A;  3N54 B;  1IQX A;  3DUK A;  2V1L A;  3BLZ A;  4GL6 A;  1GSP A;  3UNL A;  3VSY A;  2W56 A;  3NQY A;  3NUV A;  3NV0 B;  3OX9 A;  5G1L A;  2CG1 A;  3H51 A;  3JUN A;  1BNJ A;  2CWV A;  4K1V A;  5AIH A;  6GSP A;  1B3S A;  2CC3 A;  2QIY A;  2W2C A;  1O7N B;  1PU4 A;  5LC7 A;  1X1Y A;  3AMO A;  1JJ2 2;  4AKY A;  4N6M A;  3WOE B;  1MWU A;  2W56 B;  3BB9 A;  1VQ6 3;  2W0Q A;  3BNE A;  2FXT A;  4J9A A;  3DGO A;  1MNL A;  3NM2 A;  4FR9 A;  4HM6 B;  4CJN A;  5JPP A;  2WGQ A;  3NBJ A;  1RMS A;  3LML A;  3HOH A;  1JN5 A;  1F8N A;  3S5C A;  1OUN A;  2OTJ 3;  4J8T A;  4IPB A;  4BTX A;  3DH2 A;  5STD A;  3AMO B;  3HK4 A;  1RNT A;  3WMD A;  3AHS A;  3CNM A;  2L4V A;  2RGQ A;  3UL5 A;  1ROA A;  3ALA A;  3PCR A;  4XDW A;  2LYX A;  1OH0 A;  1JN5 B;  4FCZ A;  3DY5 A;  3SX1 A;  3O8Y A;  2INX A;  3CNX A;  3FH1 A;  2K3D A;  2BT3 A;  3LZA A;  4PEJ A;  2ML6 A;  1T2H A;  1HKX A;  3QRD A;  1GD4 A;  5KP1 A;  2FNQ A;  3GAX A;  5EEO A;  3OXA A;  1B2U A;  1AVL A;  1VQO 3;  1VQ4 3;  1X1X A;  1YNV X;  1E97 A;  2ZL8 A;  1FGM A;  1MWS A;  2ML5 A;  3MG2 A;  1LOX A;  5IER A;  5KP4 A;  2Z77 A;  2XR8 B;  1BNS A;  3CPW 2;  1N8R 4;  1AY7 A;  3F40 A;  1B21 A;  4HZB B;  4BIR A;  1O7G B;  1B27 A;  3N9H A;  1WMN A;  3OWY A;  5TGN A;  4I5Q A;  3DXO A;  3S67 A;  5ELJ A;  1TFO A;  1OCV A;  2ZDJ A;  1I2G A;  3CD6 3;  3RNT A;  1BU4 A;  4L8O A;  1MGR A;  1RGK A;  5CF1 A;  1FZU A;  1M1K 4;  1X1W A;  1W2Z A;  3LOY A;  1BUQ A;  3D5I A;  3FCS B;  2Z7A A;  1NB5 I;  1ISK A;  1EEJ A;  3KFQ C;  3EX9 A;  1KD1 4;  4X2O A;  1Y4K A;  1UUG B;  1UW1 A;  1BUJ A;  4HM1 B;  1I3I A;  4CDL A;  3EE1 A;  1CH0 A;  4EW5 A;  1KWI A;  2RSX A;  1A2K A;  1SIH A;  3CCL 3;  1RLS A;  1IVU A;  2HMJ B;  3MYT A;  4N3V A;  3X3Y A;  1IDP A;  2E2V A;  3GZR A;  3CU3 A;  3LT9 A;  4HJL B;  4J5K A;  2QA4 3;  3F8H A;  3I0Y A;  5M19 A;  1BSC A;  3B4O A;  1G02 A;  3F7X A;  2GBX B;  3EN8 A;  3NBB A;  3MG1 A;  2CX1 A;  3A76 A;  1GMR A;  2Y73 A;  3LTC A;  4JRF A;  3PGB A;  3J7Y d;  1CQS A;  1ULJ B;  3A5E A;  5AI1 A;  1W2B 2;  5IW9 A;  3KSE D;  4XBT A;  3G6E 3;  3S28 A;  3SXX A;  1K8A 4;  1A67 A;  4MJD A;  1SPU A;  3ZFZ A;  8CHO A;  2XH9 A;  3NM7 A;  1VQ7 3;  1KC8 4;  1JNQ A;  2AAD A;  4OVM A;  1UI8 A;  4FMA A;  4H61 A;  1EG9 B;  1W7C A;  5AIF A;  1W6G A;  3OWU A;  4AEQ A;  2IY2 A;  1MOL A;  3LH4 A;  2L1S A;  5AII A;  3OWS A;  4MMY B;  1T2I A;  2J8X B;  3X3Z A;  1LQG C;  4FCM A;  1BRS A;  1RGA A;  1I3F A;  3QK9 A;  1YGE A;  2UGI A;  1MWR A;  4HM4 B;  1O7P B;  3GZY B;  2P38 A;  5CK6 A;  3WOD G;  1BNI A;  1A2V A;  1I8V A;  2RNT A;  1YIJ 3;  1R4Y A;  5EVH A;  4R1K A;  1HU9 A;  2HML B;  1I2F A;  3NX0 A;  2IYJ A;  4KVH A;  1GMQ A;  3EF8 A;  3G71 3;  1YHQ 3;  3SVA A;  1UUV B;  3EB8 A;  1QAL A;  2BMO B;  2HOH A;  4ORL A;  3F8X A;  2CWU A;  1AVK A;  3NV0 A;  4WYK B;  4WHA A;  2H0I A;  2Z76 A;  3IJE B;  4OUQ A;  3FSD A;  1VQQ A;  3G16 A;  4U13 A;  1VZZ A;  3KE7 A;  4LYL B;  4KFE A;  1BSA A;  1LOY A;  2M7O A;  4HM3 B;  3U97 A;  1SQW A;  1YIT 3;  3H3H A;  1VQL 3;  3FG1 A;  4XBX A;  2W9Q A;  2H0G A;  3ZG5 A;  3T8U A;  2RCD A;  1Z1S A;  1B2Z A;  3OW2 2;  2GU3 A;  3MSO A;  5HOH A;  2BNG A;  4HVN A;  1IQY A;  1SII A;  2CKF B;  1AQZ A;  9RNT A;  2XFT A;  4JF8 A;  2W04 A;  3G4S 3;  3CCQ 3;  5BVB A;  4HM2 B;  2O3O A;  4EXR A;  3OV4 A;  2GBW B;  1ZS7 A;  2SAR A;  1FGR A;  4N6U A;  1TU5 A;  1QAF A;  3B4P A;  4Q53 A;  1YVS A;  1WTH A;  4RZM A;  1BVI A;  1FGO A;  5IG0 A;  1ZX2 A;  4EV2 A;  1E3R A;  2CWT A;  1D6Z A;  3CPO A;  4AKZ A;  1LNH A;  1RDS A;  2BIR A;  4EC6 A;  3V92 A;  1M1X B;  1UGI A;  3N8B A;  4DKI A;  1W6Y A;  1DMN A;  2CW9 A;  4HM8 B;  3X42 A;  2F5W A;  4R80 A;  1YJW 3;  3EBT A;  1W00 A;  7GSP A;  4KT3 B;  1VQ9 3;  1C7H A;  2KXG A;  2D1W A;  4EV5 A;  1MWT A;  1UDI I;  1JV2 B;  4KFD A;  3UB1 A;  2CK3 H;  4HM0 B;  5IEP A;  2RFR A;  5M1A A;  5JPU A;  2C10 A;  4RNY A;  1RNB A;  2H0H A;  1Q86 4;  2BMR B;  4R9L A;  5JBS A;  1Q82 4;  1BRI A;  1O7W B;  3SED A;  4QWT A;  3SYU A;  1UCL A;  2A15 A;  3HI7 A;  1BIR A;  1B20 A;  2Q07 A;  1LXE A;  3HIG A;  2IA7 A;  4N6T A;  1LQM B;  5D81 A;  3LTA A;  2E2T A;  3F7S A;  3FGY A;  1Q7Y 4;  5LC6 A;  3GZX B;  1LRA A;  1OGX A;  3U1W A;  5BIR A;  1JZD A;  2CFK A;  1RJO A;  1G96 A;  5IG3 A;  3HII A;  1JBR A;  2FGT A;  2QGU A;  1QVF 2;  1WMO A;  2BHM A;  4R4K A;  1A90 A;  2P0M A;  2W6J H;  4STD A;  1NDO B;  4CPK A;  3S29 A;  1IVV A;  1WMP A;  1U8C B;  1PFP A;  4H3U A;  2R4I A;  4G1M B;  3EHC A;  1ZO2 A;  3FG4 A;  4KZ1 A;  4N6V 0;  1IV9 A;  1MGW A;  1RSN A;  1GY5 A;  1D6Y A;  1RGG A;  1V58 A;  3AHW A;  3ZG0 A;  3Q2P A;  2SBL A;  4CCV A;  2OTL 3;  3NHX A;  2KCD A;  1UCI A;  1M90 4;  1BNR A;  2CHC A;  3T8N A;  1TRQ A;  3SOA A;  1VQN 3;  2P05 A;  2YFL B;  3D79 A;  1BSE A;  1V74 A;  2OQE C;  3GRD A;  3FLJ A;  1QAK A;  5DRE A;  3X3X A;  2BO9 B;  1HZ1 A;  2GEY A;  1K41 A;  5CXO A;  3AGN A;  1GY6 A;  1OHS A;  2F99 A;  3KSP A;  4GHO A;  3DGY A;  3WOF B;  3MPH A;  2C4B A;  3EC9 A;  3CC7 3;  1QMA A;  1W5Z A;  2KF3 A;  2CFL A;  2YFJ B;  3HZP A;  1EUI C;  2WOH A;  2PZV A;  3FF0 A;  1EKM A;  3CME 3;  2KRT A;  3MG3 A;  1RGH A;  2BU4 A;  2GU1 A;  2STD A;  1BAN A;  1DVC A;  2JQ5 A;  2F98 A;  2KF5 A;  1BRK A;  1Q81 4;  4IIA A;  1IT8 A;  3SOY A;  3D5G A;  1J2B A;  1US1 A;  1FGT A;  4FCJ A;  3TDG A;  1BAO A;  3IPT A;  3EQQ B;  3ER7 A;  6RNT A;  4WYK A;  3V98 A;  1ULI B;  1I70 A;  1JRQ A;  1RHL A;  1RTU A;  4HBR A;  4K1U A;  1DET A;  4X2H A;  1LNI A;  5AEW B;  3Q90 A;  1JB5 A;  2C11 A;  4TX4 A;  4FMB A;  5BXQ A;  2UX0 A;  4R9K A;  1BNF A;  1BRH A;  1YVB I;  3BIR A;  4LZI A;  1KQS 2;  3DGL A;  3FG3 A;  2HMN B;  1GY7 A;  2CFD A;  4HKV B;  1I2E A;  4K61 A;  4XB5 A;  3WDG B;  3E99 A;  5D82 A;  4BU4 A;  2KF4 A;  1NO3 A;  2XEP A;  4HOH A;  1O7M B;  1VQ8 3;  1GMP A;  3FF2 A;  5AYR B;  1EA2 A;  1VQM 3;  1BSB A;  3Q1C A;  4HZ9 B;  5IG4 A;  1UCJ A;  1UGH I;  1T3B A;  1IU7 A;  2HMM B;  1BNG A;  2ZHX B;  3EJV A;  2B1X B;  4L7K A;  8RNT A;  2GSP A;  3BND A;  4O3V A;  2XFS A;  2CFG A;  2P0X A;  1OHP A;  4NHF A;  1CYU A;  1OAC A;  3I55 3;  1RRL A;  1ZGX A;  3LT8 A;  1RN4 A;  1RKY A;  4LSO A;  2W9P A;  1W01 A;  3HX8 A;  4XM4 A;  1RGE A;  1TP6 A;  4HM5 B;  2XSO B;  3G0K A;  4J5G A;  1CEW I;  1DE3 A;  2OCT A;  1IQ8 A;  1LOW A;  4FMC A;  5IG5 A;  1AV4 A;  3T0U A;  6STD A;  2LQV A;  2OOV C;  1GYB A;  3WA2 X;  3AGO A;  3RGA A;  1K9M 4;  1FYS A;  3FZW A;  2XRX B;  1Q9E A;  4MMX B;  1JKG A;  2BMQ B;  3L0R A;  4I4K A;  1DYU A;  3CCM 3;  4IT7 A;  1TFK A;  3NXJ A;  1K28 A;  1M9G A;  5HGR A;  1OF5 B;  1VQK 3;  3MKI A;  5IEO A;  4XDV A;  5IEN A;  1VQP 3;  3SLU A;  1B2S A;  3WR2 A;  1SJW A;  3I56 3; 
#chains in the Genus database with same CATH homology
 2UGI A;  4LYL B;  2J8X B;  1UGI A;  2UUG C;  1LQM B;  1LQG C;  1UDI I;  1UGH I;  1UUG B;  1EUI C;  2ZHX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...