1BVIA

Ribonuclease t1 (wildtype) complexed with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Dissection of the structural and functional role of a conserved hydration site in RNase T1.
pubmed rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bviA00
5GSPA 1GSPA 1RNTA 1BNJA 1TRPA 1RN1A 8RNTA 1FZUA 3DH2A 4GSPA 1IYYA 1BOXA 1I70A 4HAAA 1AQZA 1MGRA 3A5EA 1ZGXA 2GSPA 2C4BA 2KF4A 2RNTA 1I2GA 1I2FA 1BNSA 1RNBA 5RNTA 1FUTA 1X1XA 1BIRA 1BNGA 3BU4A 1GOUA 6RNTA 1RGCA 1BRGA 3AHSA 1I2EA 1I0XA 1HYFA 1GMPA 1YGWA 1G02A 2RBIA 1RGGA 4GHOA 1RGEA 1B27A 1DETA 1CH0A 2BU4A 2KF6A 1A2PA 1BGSA 4BU4A 1B2MA 1LRAA 4J5GA 1HZ1A 2ZA4A 5HOHA 4RNTA 1BSBA 5BU4A 6GSPA 1BNIA 4BIRA 1RGKA 4HOHA 1GOYA 2F4YA 3D5GA 1RHLA 1PYLA 1RGFA 2BIRA 1BUJA 1TRQA 1AY7A 1RMSA 1JBRA 3DGYA 1UCIA 1X1YA 2KAAA 5BIRA 1T2HA 1UCLA 3BIRA 1BSDA 1RGHA 1YNVX 4J5KA 1BU4A 7GSPA 1RTUA 1BRSA 1FUSA 1YVSA 3GSPA 1MGWA 3URPA 1I8VA 3Q3FA 1FW7A 1BSAA 2KF3A 3AGOA 1B2ZA 3WR2A 1SARA 9RNTA 1R4YA 1BRHA 2F5WA 1T2IA 2AADA 3KCHA 1RN4A 3WHOA 1JBTA 2F5MA 3RNTA 1BNEA 1X1UA 3D5IA 3AHWA 1TTOA 1B21A 1B2XA 1BSCA 7RNTA 1DE3A 1BANA 1B2UA 1BSEA 1B2SA 1LOWA 1X1WA 1FYSA 1RLSA 1GMQA 2SARA 1C54A 1B3SA 3HOHA 1UCJA 1B20A 1BVIA 1UCKA 1RCLA 1RGAA 1BAOA 1I3IA 1Q9EA 1BNRA 1PY3A 1GMRA 1LOVA 1BRKA 1RDSA 1RCKA 3D4AA 2F56A 3AGNA 1RSNA 3SYUA 1BRNL 2AAEA 1LNIA 1GOVA 1BRIA 1BRJA 1RGLA 2HOHA 1JBSA 1LOYA 1I0VA 1BNFA 1I3FA 2KF5A
chains in the Genus database with same CATH superfamily
2CKFB 1E3RA 1W2ZA 2CC3A 3OX9A 5IG3A 1U5OA 4KFFA 2XRXB 2RGQA 4HVNA 3F9SA 4GSPA 1IYYA 4K61A 2KXGA 2XH9A 4XB5A 5M1AA 2IMJA 2IY2A 3PYJA 1MGRA 3V98A 3J7Yd 1ZGXA 3DGNA 2PNCA 2C4BA 1OH0A 3K9MC 3NHXA 3LTAA 1VQQA 1I2FA 3GRDA 2D42A 3PZWA 2WOFA 1UUGB 3HZPA 1GOUA 1TUHA 2UGIA 4XBYA 3UB1A 6RNTA 5IG0A 1SIIA 1US1A 4LEHA 1I0XA 1YGWA 1HYFA 2D1WA 2L1SA 3L0RA 4K1UA 5CXOA 4GHOA 1WMNA 3G8ZA 1SQWA 4RBNA 4EXRA 3NUVA 1B27A 1DETA 2BU4A 1EKMA 1W7CA 1BGSA 3HI7A 3GZBA 3T0UA 3FG4A 1TIJA 2KRTA 1LRAA 1O7PB 1HZ1A 1W6CA 2ZA4A 2O3OA 3EBYA 3S28A 4RNTA 3OW22 1BSBA 1FGMA 1YI23 1V57A 1UUVB 1UGHI 1GOYA 5CF1A 3B8LA 2ZHXB 2B24B 1RHLA 1PYLA 2SBLA 1LOXA 3LH4A 2CX1A 3CCU3 3A76A 3D79A 3WOEB 4RZMA 4BTXA 4HM1B 1BUJA 2STDA 2P38A 4HM7B 4DKIA 5AI1A 3UL5A 3LOYA 3NBJA 4MEIA 3DGMA 1F8NA 5AIFA 1VQ73 3SX1A 5BIRA 1UCLA 1BSDA 1IVUA 3CCJ3 3U1WA 2LYXA 3EC9A 7GSPA 1DVCA 2IUKA 4BL3A 5IEOA 6STDA 1G0TA 3QRDA 3GSPA 1OHPA 1WMOA 4TX4A 3BNEA 3FG3A 3URPA 2CG0A 1BSAA 2KF3A 2R4IA 1B2ZA 1SARA 2H0IA 1BRHA 3AMOA 4HM3B 2E2VA 2XR8B 1STFI 3G0KA 3T8UA 4WYKA 1AVKA 1FGTA 4IPBA 3EB8A 5HGRA 1J2BA 4WFOA 2FXTA 2GBXB 1EUIC 3EQQB 1O7GB 4CPKA 1E97A 1BSCA 2RSXA 3U97A 3AMOB 4WP5A 3CNXA 2BMOB 3E99A 1YJ93 2YFJB 1FGQA 3MSOA 4WYKB 5G1LA 1AV4A 4MMXB 4LGQA 3WOFB 3LYGA 1FYSA 1HKXA 1RLSA 4FMDA 3EN1B 3CC73 1QAFA 8CHOA 4FMCA 1LNHA 1JZOA 1R4CA 4FMAA 4WWUC 1B20A 1UCKA 3KSPA 1CEWI 1MOLA 1RCLA 3PCSA 3MG3A 1BNRA 5JPPA 1RKYA 1LOVA 1Q7HA 3KSED 3MPHA 3NXJA 3G4S3 3DY5A 2GEXA 2QGUA 1K9M4 2F56A 1MNLA 2AAEA 4HM0B 3LTDA 2BHMA 1BRIA 2RFRA 1RGLA 1IV7A 3QK9A 1LOYA 3VGNA 4XBTA 3PS8A 2Y74A 5JPUA 5GSPA 3I563 4FMBA 2K3DA 2BMQB 2P09A 3IMAB 1D6UA 2ZDJA 4K1VA 4KFDA 1RN1A 4HM6B 4N3VA 2BNGA 4STDA 5STDA 2J8XB 1FZUA 4KFEA 3SVAA 3DH2A 3EBTA 1BOXA 4J9AA 3FLJA 1GY5A 4OVMA 3CCS3 2GU1A 1KD14 3FGYA 1MWRA 1ULJB 4JF8A 1RJOA 1AQZA 3F8HA 4OUQA 2XEPA 4NREA 2W2CA 5D82A 2YFLB 2MC8A 3FH1A 3MKIA 1A67A 4X2HA 5CK6A 2CX0A 2L4VA 2R41A 2CW9A 3OXAA 3BU4A 1BIRA 1JNQA 1NU3A 4N6NB 3DXOA 1NNVA 3CD63 1IT8A 2W6JH 5IW9A 4EBGA 1G02A 4EYCA 1IDPA 1CQSA 1K41A 4XDVA 5A0OB 1JZDA 4FR9A 2OTL3 3EN8A 1DVDA 1FUWA 2KF6A 1M1K4 1FA3A 1NWWA 3CCL3 1Q40A 4R4KA 3TDGA 1VQM3 2JQ5A 4IIAA 4N6OB 3WDGB 2HMJB 5HOHA 3IJEB 3SLUA 2XF3A 1WTHA 5BU4A 4KVHA 2YX9A 3ZFZA 1BNIA 6GSPA 4BIRA 1CYVA 4HOHA 4EC6A 1N8R4 2CFWA 3D5GA 1T5YA 3ECFA 3SXXA 5IF6A 2E2UA 3B4OA 5AYRB 3CCM3 3HK4A 5LC6A 2HMOB 3I0YA 3KZTA 3MHEA 3Q2PA 4ORLA 1RGFA 3N9HA 1ULIB 2IA7A 2ML6A 3JUPA 4I4KA 4U13A 3N8BA 1RMSA 3DGYA 2GBWB 4L8OA 1CYUA 2JDIH 3BIRA 3LZAA 1QVF2 4LYLB 3ROBA 1QMAA 4H3UA 4BTWA 3IPTA 3LXUX 2ZL8A 1Q814 1TP6A 3JUNA 2P05A 1YIT3 1AR0A 1S5AA 2WOHA 4KT3B 5IG5A 3AGOA 1EG9B 3BNBA 3CXC2 1T2IA 2AADA 4N6UA 2O9UX 3KCHA 1OUNA 1MWSA 3B7CA 2A15A 3X3ZA 3AHWA 5FGOA 1OPYA 3NQYA 1Q7Y4 1W6YA 3Q90A 3WA3A 4PEJA 1OHOA 3S29A 3X3YA 4G1MB 2MF7A 1B2SA 2OWPA 2K54A 4HBRA 3CMA3 3SEDA 1LOWA 4NHFA 1M1XB 4HM8B 3BB9A 4H61A 2SARA 2CK3H 3HOHA 3X41A 1UI8A 1BVIA 1RGAA 2GXFA 1ROAA 2KCDA 4MMZB 4AKYA 3CCE3 1Q9EA 3DGLA 1GMRA 1VZZA 2W56A 1BRKA 1JV2B 1RDSA 3ER7A 4R9KA 3AGNA 5M18A 4CJNA 1IVWA 2K0MA 1BRJA 1JBSA 1C7HA 3FCSB 2CFKA 1I0VA 2F5WA 2KF5A 1V58A 3LTCA 4HZBB 3EHCA 2FGTA 1GSPA 4BL2A 3FKAA 5FW5A 1BNJA 1TRPA 3MG1A 3PGBA 2UX0A 3CNMA 2F98A 2ML5A 3KKGA 8RNTA 1D6YA 2LQVA 2Z76A 2W03A 5AIHA 3GZRA 1MWTA 2Q07A 3DZLA 4MJDA 1OF5A 1BUQA 1JN5A 4HAAA 4RNYA 1QALA 3NV0A 5M19A 3A5EA 1KQS2 2KF4A 3ZG5A 2RNTA 3GZXB 1K28A 1RN7A 1O7WB 3CPOA 3G16A 5CLKA 1RNBA 2OTJ3 1EEJA 1FUTA 2Y73A 1BNGA 4R1KA 3KIIA 1WNHA 4HM5B 1RGCA 1BRGA 3F8XA 1OF5B 4N6V0 1PU4A 1IQXA 1GMPA 4O02B 5AEUB 1U8CB 1W02A 2QIYA 2RBIA 1RGGA 3PXMA 1TFOA 2H0HA 1FGOA 2CWUA 1A2KA 2XGLA 3EX9A 3FG1A 4XM4A 1JB4A 1L5GB 1Q42A 5JBSA 1B2MA 1RRLA 1A2PA 2OQEC 4BU4A 2V1LA 2BO9B 3GAXA 1LQMB 4JRFA 3SOYA 4J5GA 5KP1A 3H3HA 4XDWA 1VQ83 2CFGA 1N8QA 1JB5A 1N9EA 1EA2A 2WGQA 1TU5A 1DMMA 3HX8A 2XGNA 1D6ZA 1IVVA 1VQ63 3NBBA 3V99A 2CH9A 1Q864 1W01A 4FCZA 2BIRA 3GWRA 4HM4B 1TRQA 1W5ZA 4LZIA 3RGAA 1QJGA 1WMPA 3K63A 1JBRA 2QEX3 5LC7A 1UW1A 1TFKA 1UCIA 4RNZA 7STDA 1ZS7A 1X1YA 4HKVB 1KSIA 2XFSA 2INXA 5AIGA 1RGHA 1YNVX 2GU3A 1DYUA 1DMQA 4KZ1A 1RTUA 4FCJA 4Q53A 5D81A 2CWTA 3STDA 1YVSA 2OOVC 1UUWB 1UGIA 3FF2A 2XFTA 1NB3I 1HU9A 1MGWA 5I97A 3Q3FA 3S27A 3UL6A 1O7NB 3B4PA 1FW7A 2M7OA 1A2VA 1NJI4 1R4YA 3KFQC 4K90B 5DREA 3WODG 4QWTA 4O2HA 1Q40B 2QA43 1E3VA 3CCQ3 1O7HB 5KP3A 1N5PA 3OV4A 3I553 1Y4KA 1PFPA 2F5MA 3RNTA 4R9LA 2C10A 1BNEA 1X1UA 4EW5A 1TTOA 1NO3A 1B21A 2CFDA 3FSDA 3O8YA 1B2XA 1GY6A 7RNTA 3F40A 1BANA 1B2UA 3K7CA 1YJW3 1KC84 3EJVA 1KWIA 3VF1A 1VQO3 4L8PA 2C11A 2GEYA 1K8A4 1X1WA 2FNQA 4MMYB 2W9QA 3F14A 5G1KA 1C54A 2P0XA 1AVLA 3CCR3 3PCRA 1UCJA 1GD4A 3MG2A 5DRVA 2B1XB 3RGRA 1I3IA 1YJN3 4LMIA 1PY3A 3M8CA 3DGOA 4EV5A 1GS3A 3G713 1RCKA 5IEPA 1RSNA 4ILFA 1STDA 2IYJA 1ISKA 1LXEA 1GOVA 2CIUA 2HMNB 3X3XA 5EEOA 3LT9A 5TGNA 1GYBA 1DMNA 3GZYB 1BNFA 2OQEA 1I3FA 3G6E3 1W2B2 3EE1A 1NB5I 1T3BA 5AEWB 3K5TA 1ROVA 1GD3A 4NPBA 1RNTA 5IG4A 1G96A 2HMMB 5IERA 3ZG0A 1ZO2A 1S723 1M9GA 3JVCA 1JKGA 1OACA 2F86B 4HJLB 5EVHA 1I70A 5ELUA 1NDOB 3WA2X 1VQ93 1JB2A 2CHCA 4LSOA 2GSPA 3NX0A 1YHQ3 3LT8A 1A90A 1I2GA 3FZWA 1SPUA 1BNSA 4X2OA 5RNTA 1M904 4L7KA 1X1XA 1W00A 2XSOB 1JKGB 3KE7A 1ZX2A 4N6MA 4R80A 3S67A 3CC23 2Z7AA 1I2EA 3AHSA 3EF8A 3BLZA 3OWYA 3UNLA 3CME3 1QVG2 1GY7A 1O7MB 5ELJA 1RGEA 3NM2A 2IUJA 3WMDA 4I5QA 1CH0A 4OK0A 4FCMA 4CCVA 2HMLB 4N6TA 2OOVA 2H0GA 1V74A 2CWVA 1LQGC 2W56B 3CPW2 3SOAA 2RCDA 1FGRA 3BNCA 3NBRA 4IT7A 4AEQA 3BNDA 3K0ZA 1IQYA 2HMKB 1ASKA 1RGKA 3MWZA 3D9RA 2F4YA 3NQZA 3X42A 3NM7A 1VQK3 3H51A 2W9PA 1YVBI 5D83A 4AKZA 3JUOA 1AY7A 1IQ8A 5BVBA 1VQN3 1SIHA 1UI7A 1IU7A 1W6GA 3DM8A 3T8NA 1JN5B 3UJMA 4O8SA 3NV0B 3CC43 1Q824 2OCTA 1JRQA 3JUMA 2KAAA 3CU3A 3DMCA 1T2HA 3HIIA 3ALAA 3MYTA 4XBXA 4J5KA 2BMRB 1BU4A 4HM2B 1UDII 1VQ53 1BRSA 1MWUA 5G2GA 1FUSA 1IK3A 1YIJ3 4GB5A 4HYZA 1K734 4O3VA 1I8VA 2PZVA 2XSHB 1N9JA 3DUKA 2Z77A 3S5CA 1WQLB 3WR2A 9RNTA 1IVXA 1EQKA 1OGXA 5IENA 1Z1SA 1IV9A 2P0MA 2YFIB 5BXQA 2W0QA 2WGOA 1OCVA 3OWUA 1W4NA 2CG1A 3LMLA 1RN4A 4GL6A 3WHOA 4N6LA 1JBTA 3D3LA 4ZM8A 3D5IA 1VQ43 3OWSA 2E2TA 1IT7A 3F7XA 1DE3A 1BSEA 5AYSC 1N5HA 3LTBA 2W04A 2Z6BA 2UUGC 3FF0A 3HIGA 4J8TA 3RDEA 1GMQA 5KP4A 1VQP3 1OHSA 2BT3A 1B3SA 1VQL3 5CF2A 2WO0A 3KN4A 4WHAA 1YGEA 1BAOA 5AIIA 1RRHA 4BTYA 4CDLA 3CCV3 2I9WA 3V92A 3JUQA 1QAKA 3X40A 5EQLA 3D4AA 1BRNL 1SJWA 1OGZA 2CFLA 3F7SA 3SYUA 1JJ22 4HZ9B 1LNIA 2F99A 1LVNA 1TJDA 3Q1CA 2HOHA 3VSYA 3N54B 4EV2A
chains in the Genus database with same CATH topology
5GSPA 1GSPA 1RNTA 1BNJA 1TRPA 1RN1A 8RNTA 1FZUA 3DH2A 4GSPA 1IYYA 1BOXA 1I70A 4HAAA 1AQZA 1MGRA 3A5EA 1ZGXA 2GSPA 2C4BA 2KF4A 2RNTA 1I2GA 1I2FA 1BNSA 1RNBA 5RNTA 1FUTA 1X1XA 1BIRA 1BNGA 3BU4A 1GOUA 6RNTA 1RGCA 1BRGA 3AHSA 1I2EA 1I0XA 1HYFA 1GMPA 1YGWA 1G02A 2RBIA 1RGGA 4GHOA 1RGEA 1B27A 1DETA 1CH0A 2BU4A 2KF6A 1A2PA 1BGSA 4BU4A 1B2MA 1LRAA 4J5GA 1HZ1A 2ZA4A 5HOHA 4RNTA 1BSBA 5BU4A 6GSPA 1BNIA 4BIRA 1RGKA 4HOHA 1GOYA 2F4YA 3D5GA 1RHLA 1PYLA 1RGFA 2BIRA 1BUJA 1TRQA 1AY7A 1RMSA 1JBRA 3DGYA 1UCIA 1X1YA 2KAAA 5BIRA 1T2HA 1UCLA 3BIRA 1BSDA 1RGHA 1YNVX 4J5KA 1BU4A 7GSPA 1RTUA 1BRSA 1FUSA 1YVSA 3GSPA 1MGWA 3URPA 1I8VA 3Q3FA 1FW7A 1BSAA 2KF3A 3AGOA 1B2ZA 3WR2A 1SARA 9RNTA 1R4YA 1BRHA 2F5WA 1T2IA 2AADA 3KCHA 1RN4A 3WHOA 1JBTA 2F5MA 3RNTA 1BNEA 1X1UA 3D5IA 3AHWA 1TTOA 1B21A 1B2XA 1BSCA 7RNTA 1DE3A 1BANA 1B2UA 1BSEA 1B2SA 1LOWA 1X1WA 1FYSA 1RLSA 1GMQA 2SARA 1C54A 1B3SA 3HOHA 1UCJA 1B20A 1BVIA 1UCKA 1RCLA 1RGAA 1BAOA 1I3IA 1Q9EA 1BNRA 1PY3A 1GMRA 1LOVA 1BRKA 1RDSA 1RCKA 3D4AA 2F56A 3AGNA 1RSNA 3SYUA 1BRNL 2AAEA 1LNIA 1GOVA 1BRIA 1BRJA 1RGLA 2HOHA 1JBSA 1LOYA 1I0VA 1BNFA 1I3FA 2KF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSP A;  1GSP A;  1RNT A;  1BNJ A;  1TRP A;  1RN1 A;  8RNT A;  1FZU A;  3DH2 A;  4GSP A;  1IYY A;  1BOX A;  1I70 A;  4HAA A;  1AQZ A;  1MGR A;  3A5E A;  1ZGX A;  2GSP A;  2C4B A;  2KF4 A;  2RNT A;  1I2G A;  1I2F A;  1BNS A;  1RNB A;  5RNT A;  1FUT A;  1X1X A;  1BIR A;  1BNG A;  3BU4 A;  1GOU A;  6RNT A;  1RGC A;  1BRG A;  3AHS A;  1I2E A;  1I0X A;  1HYF A;  1GMP A;  1YGW A;  1G02 A;  2RBI A;  1RGG A;  4GHO A;  1RGE A;  1B27 A;  1DET A;  1CH0 A;  2BU4 A;  2KF6 A;  1A2P A;  1BGS A;  4BU4 A;  1B2M A;  1LRA A;  4J5G A;  1HZ1 A;  2ZA4 A;  5HOH A;  4RNT A;  1BSB A;  5BU4 A;  6GSP A;  1BNI A;  4BIR A;  1RGK A;  4HOH A;  1GOY A;  2F4Y A;  3D5G A;  1RHL A;  1PYL A;  1RGF A;  2BIR A;  1BUJ A;  1TRQ A;  1AY7 A;  1RMS A;  1JBR A;  3DGY A;  1UCI A;  1X1Y A;  2KAA A;  5BIR A;  1T2H A;  1UCL A;  3BIR A;  1BSD A;  1RGH A;  1YNV X;  4J5K A;  1BU4 A;  7GSP A;  1RTU A;  1BRS A;  1FUS A;  1YVS A;  3GSP A;  1MGW A;  3URP A;  1I8V A;  3Q3F A;  1FW7 A;  1BSA A;  2KF3 A;  3AGO A;  1B2Z A;  3WR2 A;  1SAR A;  9RNT A;  1R4Y A;  1BRH A;  2F5W A;  1T2I A;  2AAD A;  3KCH A;  1RN4 A;  3WHO A;  1JBT A;  2F5M A;  3RNT A;  1BNE A;  1X1U A;  3D5I A;  3AHW A;  1TTO A;  1B21 A;  1B2X A;  1BSC A;  7RNT A;  1DE3 A;  1BAN A;  1B2U A;  1BSE A;  1B2S A;  1LOW A;  1X1W A;  1FYS A;  1RLS A;  1GMQ A;  2SAR A;  1C54 A;  1B3S A;  3HOH A;  1UCJ A;  1B20 A;  1BVI A;  1UCK A;  1RCL A;  1RGA A;  1BAO A;  1I3I A;  1Q9E A;  1BNR A;  1PY3 A;  1GMR A;  1LOV A;  1BRK A;  1RDS A;  1RCK A;  3D4A A;  2F56 A;  3AGN A;  1RSN A;  3SYU A;  1BRN L;  2AAE A;  1LNI A;  1GOV A;  1BRI A;  1BRJ A;  1RGL A;  2HOH A;  1JBS A;  1LOY A;  1I0V A;  1BNF A;  1I3F A;  2KF5 A; 
#chains in the Genus database with same CATH topology
 2CKF B;  1E3R A;  1W2Z A;  2CC3 A;  3OX9 A;  5IG3 A;  1U5O A;  4KFF A;  2XRX B;  2RGQ A;  4HVN A;  3F9S A;  4GSP A;  1IYY A;  4K61 A;  2KXG A;  2XH9 A;  4XB5 A;  5M1A A;  2IMJ A;  2IY2 A;  3PYJ A;  1MGR A;  3V98 A;  3J7Y d;  1ZGX A;  3DGN A;  2PNC A;  2C4B A;  1OH0 A;  3K9M C;  3NHX A;  3LTA A;  1VQQ A;  1I2F A;  3GRD A;  2D42 A;  3PZW A;  2WOF A;  1UUG B;  3HZP A;  1GOU A;  1TUH A;  2UGI A;  4XBY A;  3UB1 A;  6RNT A;  5IG0 A;  1SII A;  1US1 A;  4LEH A;  1I0X A;  1YGW A;  1HYF A;  2D1W A;  2L1S A;  3L0R A;  4K1U A;  5CXO A;  4GHO A;  1WMN A;  3G8Z A;  1SQW A;  4RBN A;  4EXR A;  3NUV A;  1B27 A;  1DET A;  2BU4 A;  1EKM A;  1W7C A;  1BGS A;  3HI7 A;  3GZB A;  3T0U A;  3FG4 A;  1TIJ A;  2KRT A;  1LRA A;  1O7P B;  1HZ1 A;  1W6C A;  2ZA4 A;  2O3O A;  3EBY A;  3S28 A;  4RNT A;  3OW2 2;  1BSB A;  1FGM A;  1YI2 3;  1V57 A;  1UUV B;  1UGH I;  1GOY A;  5CF1 A;  3B8L A;  2ZHX B;  2B24 B;  1RHL A;  1PYL A;  2SBL A;  1LOX A;  3LH4 A;  2CX1 A;  3CCU 3;  3A76 A;  3D79 A;  3WOE B;  4RZM A;  4BTX A;  4HM1 B;  1BUJ A;  2STD A;  2P38 A;  4HM7 B;  4DKI A;  5AI1 A;  3UL5 A;  3LOY A;  3NBJ A;  4MEI A;  3DGM A;  1F8N A;  5AIF A;  1VQ7 3;  3SX1 A;  5BIR A;  1UCL A;  1BSD A;  1IVU A;  3CCJ 3;  3U1W A;  2LYX A;  3EC9 A;  7GSP A;  1DVC A;  2IUK A;  4BL3 A;  5IEO A;  6STD A;  1G0T A;  3QRD A;  3GSP A;  1OHP A;  1WMO A;  4TX4 A;  3BNE A;  3FG3 A;  3URP A;  2CG0 A;  1BSA A;  2KF3 A;  2R4I A;  1B2Z A;  1SAR A;  2H0I A;  1BRH A;  3AMO A;  4HM3 B;  2E2V A;  2XR8 B;  1STF I;  3G0K A;  3T8U A;  4WYK A;  1AVK A;  1FGT A;  4IPB A;  3EB8 A;  5HGR A;  1J2B A;  4WFO A;  2FXT A;  2GBX B;  1EUI C;  3EQQ B;  1O7G B;  4CPK A;  1E97 A;  1BSC A;  2RSX A;  3U97 A;  3AMO B;  4WP5 A;  3CNX A;  2BMO B;  3E99 A;  1YJ9 3;  2YFJ B;  1FGQ A;  3MSO A;  4WYK B;  5G1L A;  1AV4 A;  4MMX B;  4LGQ A;  3WOF B;  3LYG A;  1FYS A;  1HKX A;  1RLS A;  4FMD A;  3EN1 B;  3CC7 3;  1QAF A;  8CHO A;  4FMC A;  1LNH A;  1JZO A;  1R4C A;  4FMA A;  4WWU C;  1B20 A;  1UCK A;  3KSP A;  1CEW I;  1MOL A;  1RCL A;  3PCS A;  3MG3 A;  1BNR A;  5JPP A;  1RKY A;  1LOV A;  1Q7H A;  3KSE D;  3MPH A;  3NXJ A;  3G4S 3;  3DY5 A;  2GEX A;  2QGU A;  1K9M 4;  2F56 A;  1MNL A;  2AAE A;  4HM0 B;  3LTD A;  2BHM A;  1BRI A;  2RFR A;  1RGL A;  1IV7 A;  3QK9 A;  1LOY A;  3VGN A;  4XBT A;  3PS8 A;  2Y74 A;  5JPU A;  5GSP A;  3I56 3;  4FMB A;  2K3D A;  2BMQ B;  2P09 A;  3IMA B;  1D6U A;  2ZDJ A;  4K1V A;  4KFD A;  1RN1 A;  4HM6 B;  4N3V A;  2BNG A;  4STD A;  5STD A;  2J8X B;  1FZU A;  4KFE A;  3SVA A;  3DH2 A;  3EBT A;  1BOX A;  4J9A A;  3FLJ A;  1GY5 A;  4OVM A;  3CCS 3;  2GU1 A;  1KD1 4;  3FGY A;  1MWR A;  1ULJ B;  4JF8 A;  1RJO A;  1AQZ A;  3F8H A;  4OUQ A;  2XEP A;  4NRE A;  2W2C A;  5D82 A;  2YFL B;  2MC8 A;  3FH1 A;  3MKI A;  1A67 A;  4X2H A;  5CK6 A;  2CX0 A;  2L4V A;  2R41 A;  2CW9 A;  3OXA A;  3BU4 A;  1BIR A;  1JNQ A;  1NU3 A;  4N6N B;  3DXO A;  1NNV A;  3CD6 3;  1IT8 A;  2W6J H;  5IW9 A;  4EBG A;  1G02 A;  4EYC A;  1IDP A;  1CQS A;  1K41 A;  4XDV A;  5A0O B;  1JZD A;  4FR9 A;  2OTL 3;  3EN8 A;  1DVD A;  1FUW A;  2KF6 A;  1M1K 4;  1FA3 A;  1NWW A;  3CCL 3;  1Q40 A;  4R4K A;  3TDG A;  1VQM 3;  2JQ5 A;  4IIA A;  4N6O B;  3WDG B;  2HMJ B;  5HOH A;  3IJE B;  3SLU A;  2XF3 A;  1WTH A;  5BU4 A;  4KVH A;  2YX9 A;  3ZFZ A;  1BNI A;  6GSP A;  4BIR A;  1CYV A;  4HOH A;  4EC6 A;  1N8R 4;  2CFW A;  3D5G A;  1T5Y A;  3ECF A;  3SXX A;  5IF6 A;  2E2U A;  3B4O A;  5AYR B;  3CCM 3;  3HK4 A;  5LC6 A;  2HMO B;  3I0Y A;  3KZT A;  3MHE A;  3Q2P A;  4ORL A;  1RGF A;  3N9H A;  1ULI B;  2IA7 A;  2ML6 A;  3JUP A;  4I4K A;  4U13 A;  3N8B A;  1RMS A;  3DGY A;  2GBW B;  4L8O A;  1CYU A;  2JDI H;  3BIR A;  3LZA A;  1QVF 2;  4LYL B;  3ROB A;  1QMA A;  4H3U A;  4BTW A;  3IPT A;  3LXU X;  2ZL8 A;  1Q81 4;  1TP6 A;  3JUN A;  2P05 A;  1YIT 3;  1AR0 A;  1S5A A;  2WOH A;  4KT3 B;  5IG5 A;  3AGO A;  1EG9 B;  3BNB A;  3CXC 2;  1T2I A;  2AAD A;  4N6U A;  2O9U X;  3KCH A;  1OUN A;  1MWS A;  3B7C A;  2A15 A;  3X3Z A;  3AHW A;  5FGO A;  1OPY A;  3NQY A;  1Q7Y 4;  1W6Y A;  3Q90 A;  3WA3 A;  4PEJ A;  1OHO A;  3S29 A;  3X3Y A;  4G1M B;  2MF7 A;  1B2S A;  2OWP A;  2K54 A;  4HBR A;  3CMA 3;  3SED A;  1LOW A;  4NHF A;  1M1X B;  4HM8 B;  3BB9 A;  4H61 A;  2SAR A;  2CK3 H;  3HOH A;  3X41 A;  1UI8 A;  1BVI A;  1RGA A;  2GXF A;  1ROA A;  2KCD A;  4MMZ B;  4AKY A;  3CCE 3;  1Q9E A;  3DGL A;  1GMR A;  1VZZ A;  2W56 A;  1BRK A;  1JV2 B;  1RDS A;  3ER7 A;  4R9K A;  3AGN A;  5M18 A;  4CJN A;  1IVW A;  2K0M A;  1BRJ A;  1JBS A;  1C7H A;  3FCS B;  2CFK A;  1I0V A;  2F5W A;  2KF5 A;  1V58 A;  3LTC A;  4HZB B;  3EHC A;  2FGT A;  1GSP A;  4BL2 A;  3FKA A;  5FW5 A;  1BNJ A;  1TRP A;  3MG1 A;  3PGB A;  2UX0 A;  3CNM A;  2F98 A;  2ML5 A;  3KKG A;  8RNT A;  1D6Y A;  2LQV A;  2Z76 A;  2W03 A;  5AIH A;  3GZR A;  1MWT A;  2Q07 A;  3DZL A;  4MJD A;  1OF5 A;  1BUQ A;  1JN5 A;  4HAA A;  4RNY A;  1QAL A;  3NV0 A;  5M19 A;  3A5E A;  1KQS 2;  2KF4 A;  3ZG5 A;  2RNT A;  3GZX B;  1K28 A;  1RN7 A;  1O7W B;  3CPO A;  3G16 A;  5CLK A;  1RNB A;  2OTJ 3;  1EEJ A;  1FUT A;  2Y73 A;  1BNG A;  4R1K A;  3KII A;  1WNH A;  4HM5 B;  1RGC A;  1BRG A;  3F8X A;  1OF5 B;  4N6V 0;  1PU4 A;  1IQX A;  1GMP A;  4O02 B;  5AEU B;  1U8C B;  1W02 A;  2QIY A;  2RBI A;  1RGG A;  3PXM A;  1TFO A;  2H0H A;  1FGO A;  2CWU A;  1A2K A;  2XGL A;  3EX9 A;  3FG1 A;  4XM4 A;  1JB4 A;  1L5G B;  1Q42 A;  5JBS A;  1B2M A;  1RRL A;  1A2P A;  2OQE C;  4BU4 A;  2V1L A;  2BO9 B;  3GAX A;  1LQM B;  4JRF A;  3SOY A;  4J5G A;  5KP1 A;  3H3H A;  4XDW A;  1VQ8 3;  2CFG A;  1N8Q A;  1JB5 A;  1N9E A;  1EA2 A;  2WGQ A;  1TU5 A;  1DMM A;  3HX8 A;  2XGN A;  1D6Z A;  1IVV A;  1VQ6 3;  3NBB A;  3V99 A;  2CH9 A;  1Q86 4;  1W01 A;  4FCZ A;  2BIR A;  3GWR A;  4HM4 B;  1TRQ A;  1W5Z A;  4LZI A;  3RGA A;  1QJG A;  1WMP A;  3K63 A;  1JBR A;  2QEX 3;  5LC7 A;  1UW1 A;  1TFK A;  1UCI A;  4RNZ A;  7STD A;  1ZS7 A;  1X1Y A;  4HKV B;  1KSI A;  2XFS A;  2INX A;  5AIG A;  1RGH A;  1YNV X;  2GU3 A;  1DYU A;  1DMQ A;  4KZ1 A;  1RTU A;  4FCJ A;  4Q53 A;  5D81 A;  2CWT A;  3STD A;  1YVS A;  2OOV C;  1UUW B;  1UGI A;  3FF2 A;  2XFT A;  1NB3 I;  1HU9 A;  1MGW A;  5I97 A;  3Q3F A;  3S27 A;  3UL6 A;  1O7N B;  3B4P A;  1FW7 A;  2M7O A;  1A2V A;  1NJI 4;  1R4Y A;  3KFQ C;  4K90 B;  5DRE A;  3WOD G;  4QWT A;  4O2H A;  1Q40 B;  2QA4 3;  1E3V A;  3CCQ 3;  1O7H B;  5KP3 A;  1N5P A;  3OV4 A;  3I55 3;  1Y4K A;  1PFP A;  2F5M A;  3RNT A;  4R9L A;  2C10 A;  1BNE A;  1X1U A;  4EW5 A;  1TTO A;  1NO3 A;  1B21 A;  2CFD A;  3FSD A;  3O8Y A;  1B2X A;  1GY6 A;  7RNT A;  3F40 A;  1BAN A;  1B2U A;  3K7C A;  1YJW 3;  1KC8 4;  3EJV A;  1KWI A;  3VF1 A;  1VQO 3;  4L8P A;  2C11 A;  2GEY A;  1K8A 4;  1X1W A;  2FNQ A;  4MMY B;  2W9Q A;  3F14 A;  5G1K A;  1C54 A;  2P0X A;  1AVL A;  3CCR 3;  3PCR A;  1UCJ A;  1GD4 A;  3MG2 A;  5DRV A;  2B1X B;  3RGR A;  1I3I A;  1YJN 3;  4LMI A;  1PY3 A;  3M8C A;  3DGO A;  4EV5 A;  1GS3 A;  3G71 3;  1RCK A;  5IEP A;  1RSN A;  4ILF A;  1STD A;  2IYJ A;  1ISK A;  1LXE A;  1GOV A;  2CIU A;  2HMN B;  3X3X A;  5EEO A;  3LT9 A;  5TGN A;  1GYB A;  1DMN A;  3GZY B;  1BNF A;  2OQE A;  1I3F A;  3G6E 3;  1W2B 2;  3EE1 A;  1NB5 I;  1T3B A;  5AEW B;  3K5T A;  1ROV A;  1GD3 A;  4NPB A;  1RNT A;  5IG4 A;  1G96 A;  2HMM B;  5IER A;  3ZG0 A;  1ZO2 A;  1S72 3;  1M9G A;  3JVC A;  1JKG A;  1OAC A;  2F86 B;  4HJL B;  5EVH A;  1I70 A;  5ELU A;  1NDO B;  3WA2 X;  1VQ9 3;  1JB2 A;  2CHC A;  4LSO A;  2GSP A;  3NX0 A;  1YHQ 3;  3LT8 A;  1A90 A;  1I2G A;  3FZW A;  1SPU A;  1BNS A;  4X2O A;  5RNT A;  1M90 4;  4L7K A;  1X1X A;  1W00 A;  2XSO B;  1JKG B;  3KE7 A;  1ZX2 A;  4N6M A;  4R80 A;  3S67 A;  3CC2 3;  2Z7A A;  1I2E A;  3AHS A;  3EF8 A;  3BLZ A;  3OWY A;  3UNL A;  3CME 3;  1QVG 2;  1GY7 A;  1O7M B;  5ELJ A;  1RGE A;  3NM2 A;  2IUJ A;  3WMD A;  4I5Q A;  1CH0 A;  4OK0 A;  4FCM A;  4CCV A;  2HML B;  4N6T A;  2OOV A;  2H0G A;  1V74 A;  2CWV A;  1LQG C;  2W56 B;  3CPW 2;  3SOA A;  2RCD A;  1FGR A;  3BNC A;  3NBR A;  4IT7 A;  4AEQ A;  3BND A;  3K0Z A;  1IQY A;  2HMK B;  1ASK A;  1RGK A;  3MWZ A;  3D9R A;  2F4Y A;  3NQZ A;  3X42 A;  3NM7 A;  1VQK 3;  3H51 A;  2W9P A;  1YVB I;  5D83 A;  4AKZ A;  3JUO A;  1AY7 A;  1IQ8 A;  5BVB A;  1VQN 3;  1SIH A;  1UI7 A;  1IU7 A;  1W6G A;  3DM8 A;  3T8N A;  1JN5 B;  3UJM A;  4O8S A;  3NV0 B;  3CC4 3;  1Q82 4;  2OCT A;  1JRQ A;  3JUM A;  2KAA A;  3CU3 A;  3DMC A;  1T2H A;  3HII A;  3ALA A;  3MYT A;  4XBX A;  4J5K A;  2BMR B;  1BU4 A;  4HM2 B;  1UDI I;  1VQ5 3;  1BRS A;  1MWU A;  5G2G A;  1FUS A;  1IK3 A;  1YIJ 3;  4GB5 A;  4HYZ A;  1K73 4;  4O3V A;  1I8V A;  2PZV A;  2XSH B;  1N9J A;  3DUK A;  2Z77 A;  3S5C A;  1WQL B;  3WR2 A;  9RNT A;  1IVX A;  1EQK A;  1OGX A;  5IEN A;  1Z1S A;  1IV9 A;  2P0M A;  2YFI B;  5BXQ A;  2W0Q A;  2WGO A;  1OCV A;  3OWU A;  1W4N A;  2CG1 A;  3LML A;  1RN4 A;  4GL6 A;  3WHO A;  4N6L A;  1JBT A;  3D3L A;  4ZM8 A;  3D5I A;  1VQ4 3;  3OWS A;  2E2T A;  1IT7 A;  3F7X A;  1DE3 A;  1BSE A;  5AYS C;  1N5H A;  3LTB A;  2W04 A;  2Z6B A;  2UUG C;  3FF0 A;  3HIG A;  4J8T A;  3RDE A;  1GMQ A;  5KP4 A;  1VQP 3;  1OHS A;  2BT3 A;  1B3S A;  1VQL 3;  5CF2 A;  2WO0 A;  3KN4 A;  4WHA A;  1YGE A;  1BAO A;  5AII A;  1RRH A;  4BTY A;  4CDL A;  3CCV 3;  2I9W A;  3V92 A;  3JUQ A;  1QAK A;  3X40 A;  5EQL A;  3D4A A;  1BRN L;  1SJW A;  1OGZ A;  2CFL A;  3F7S A;  3SYU A;  1JJ2 2;  4HZ9 B;  1LNI A;  2F99 A;  1LVN A;  1TJD A;  3Q1C A;  2HOH A;  3VSY A;  3N54 B;  4EV2 A; 
#chains in the Genus database with same CATH homology
 5GSP A;  1GSP A;  1RNT A;  1BNJ A;  1TRP A;  1RN1 A;  8RNT A;  1FZU A;  3DH2 A;  4GSP A;  1IYY A;  1BOX A;  1I70 A;  4HAA A;  1AQZ A;  1MGR A;  3A5E A;  1ZGX A;  2GSP A;  2C4B A;  2KF4 A;  2RNT A;  1I2G A;  1I2F A;  1BNS A;  1RNB A;  5RNT A;  1FUT A;  1X1X A;  1BIR A;  1BNG A;  3BU4 A;  1GOU A;  6RNT A;  1RGC A;  1BRG A;  3AHS A;  1I2E A;  1I0X A;  1HYF A;  1GMP A;  1YGW A;  1G02 A;  2RBI A;  1RGG A;  4GHO A;  1RGE A;  1B27 A;  1DET A;  1CH0 A;  2BU4 A;  2KF6 A;  1A2P A;  1BGS A;  4BU4 A;  1B2M A;  1LRA A;  4J5G A;  1HZ1 A;  2ZA4 A;  5HOH A;  4RNT A;  1BSB A;  5BU4 A;  6GSP A;  1BNI A;  4BIR A;  1RGK A;  4HOH A;  1GOY A;  2F4Y A;  3D5G A;  1RHL A;  1PYL A;  1RGF A;  2BIR A;  1BUJ A;  1TRQ A;  1AY7 A;  1RMS A;  1JBR A;  3DGY A;  1UCI A;  1X1Y A;  2KAA A;  5BIR A;  1T2H A;  1UCL A;  3BIR A;  1BSD A;  1RGH A;  1YNV X;  4J5K A;  1BU4 A;  7GSP A;  1RTU A;  1BRS A;  1FUS A;  1YVS A;  3GSP A;  1MGW A;  3URP A;  1I8V A;  3Q3F A;  1FW7 A;  1BSA A;  2KF3 A;  3AGO A;  1B2Z A;  3WR2 A;  1SAR A;  9RNT A;  1R4Y A;  1BRH A;  2F5W A;  1T2I A;  2AAD A;  3KCH A;  1RN4 A;  3WHO A;  1JBT A;  2F5M A;  3RNT A;  1BNE A;  1X1U A;  3D5I A;  3AHW A;  1TTO A;  1B21 A;  1B2X A;  1BSC A;  7RNT A;  1DE3 A;  1BAN A;  1B2U A;  1BSE A;  1B2S A;  1LOW A;  1X1W A;  1FYS A;  1RLS A;  1GMQ A;  2SAR A;  1C54 A;  1B3S A;  3HOH A;  1UCJ A;  1B20 A;  1BVI A;  1UCK A;  1RCL A;  1RGA A;  1BAO A;  1I3I A;  1Q9E A;  1BNR A;  1PY3 A;  1GMR A;  1LOV A;  1BRK A;  1RDS A;  1RCK A;  3D4A A;  2F56 A;  3AGN A;  1RSN A;  3SYU A;  1BRN L;  2AAE A;  1LNI A;  1GOV A;  1BRI A;  1BRJ A;  1RGL A;  2HOH A;  1JBS A;  1LOY A;  1I0V A;  1BNF A;  1I3F A;  2KF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...