1BVIA

Ribonuclease t1 (wildtype) complexed with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Dissection of the structural and functional role of a conserved hydration site in RNase T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 25
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bviA00
9RNTA 1BGSA 2KAAA 3AHWA 1I0VA 1I70A 1RGEA 2RBIA 1BNJA 1B2UA 4RNTA 5GSPA 5BU4A 3Q3FA 1BRKA 1LRAA 2AAEA 3GSPA 1BSDA 1BNIA 2BU4A 1PY3A 2F4YA 1BRIA 1RHLA 1MGWA 1RN1A 1TTOA 1RN4A 1PYLA 2KF3A 4HAAA 4J5GA 3RNTA 1FUSA 1B2MA 2GSPA 1BNEA 1BNGA 2F5WA 1X1XA 4J5KA 1BUJA 1DETA 1UCJA 3HOHA 5BIRA 3WHOA 1FW7A 1I2FA 1B3SA 1BOXA 1LNIA 1BNFA 1I3FA 1GMRA 1JBSA 1UCLA 1I2GA 1CH0A 1RGLA 1X1YA 1I2EA 1BSBA 1GMPA 1G02A 1I0XA 1T2HA 1BRGA 1T2IA 1A2PA 1BVIA 1RGAA 1BANA 1RTUA 1JBTA 2SARA 4GSPA 5HOHA 1BNSA 2BIRA 1Q9EA 1B20A 3SYUA 3AHSA 1FZUA 3BU4A 3WR2A 1GOVA 1RCKA 1R4YA 1RGGA 3URPA 1X1WA 1B21A 1BAOA 1BIRA 1FYSA 1BRJA 1RNTA 1I3IA 3KCHA 1LOWA 2F5MA 1RGKA 1RLSA 3A5EA 1TRPA 1BSAA 1IYYA 1SARA 7RNTA 1UCIA 3BIRA 1RGFA 1AY7A 1B2ZA 1GOYA 1RDSA 2KF5A 2ZA4A 3DGYA 7GSPA 1TRQA 1LOVA 1YNVX 2C4BA 1HYFA 1I8VA 1X1UA 6GSPA 1AQZA 1RCLA 3DH2A 1C54A 3AGNA 1BRSA 3D5GA 1MGRA 1BRNL 1BRHA 1UCKA 1JBRA 2KF4A 1RNBA 1LOYA 1RSNA 6RNTA 1BNRA 1DE3A 2F56A 1HZ1A 1BU4A 4HOHA 3AGOA 1RGCA 1RMSA 1RGHA 4BIRA 2AADA 3D4AA 1YGWA 1BSCA 1ZGXA 4BU4A 1GMQA 1B27A 2KF6A 1GSPA 4GHOA 1GOUA 2RNTA 1BSEA 1FUTA 3D5IA 8RNTA 1YVSA 2HOHA 1B2SA 1B2XA 5RNTA
chains in the Genus database with same CATH superfamily
1ULIB 3AMOA 2W03A 1FA3A 1GS3A 1RN7A 5GSPA 4RNTA 3CCL3 2ZDJA 2PNCA 3Q3FA 3LMLA 3HIIA 2XGLA 2W56B 1LRAA 1ROAA 2AAEA 3F8HA 3KIIA 4X2OA 3KZTA 3T0UA 1OHPA 4JRFA 2CFGA 1RN1A 4J5GA 3ROBA 4HM8B 2F5WA 4EC6A 2IUKA 4J5KA 3DUKA 1DETA 2BMOB 2RFRA 1LXEA 1UCJA 2P0MA 3HOHA 2JDIH 3UB1A 3NM2A 5LC7A 5AEUB 1ROVA 5BIRA 2FGTA 5AIFA 1FW7A 3DM8A 3NV0B 1YIJ3 3CU3A 3KSPA 1FGTA 1Q7HA 3V98A 4KFEA 3LZAA 4O02B 4XDWA 2CFWA 2FXTA 1EA2A 2OTJ3 3HK4A 5G1KA 1EEJA 1OGZA 1O7WB 4RNYA 1OGXA 1Q40B 1YJ93 3PGBA 1G02A 2CX1A 3SLUA 3G713 1VQ93 3GZXB 2UX0A 4XBYA 3BNDA 2CFDA 1RGAA 1BANA 3FG3A 2SARA 4GSPA 4CPKA 2BIRA 1GYBA 1Q9EA 3ZG5A 3EBTA 3GZRA 1Q814 3CCJ3 3AHSA 4H61A 2K54A 4BTXA 3EBYA 4BL2A 4MMXB 3B7CA 3BU4A 3OX9A 3U1WA 2CX0A 2WO0A 4R1KA 1C7HA 1DVCA 1KQS2 5JBSA 2QGUA 1UGIA 1LOWA 3QK9A 4XDVA 1LNHA 2HMOB 3WA2X 3MG2A 3EHCA 1S5AA 1RGKA 3FSDA 4HJLB 5HGRA 5AEWB 2F98A 3NXJA 7RNTA 3B8LA 2UUGC 3KN4A 1W00A 1NB3I 3DGOA 2QIYA 1AR0A 5M1AA 1ASKA 2E2TA 1WQLB 1PU4A 1OF5B 1LOVA 1SJWA 3DGMA 1IVUA 1WTHA 1HYFA 1X1UA 5RNTA 3K63A 6GSPA 1N8R4 1EG9B 1G96A 3CCU3 3EC9A 3CC73 3ZFZA 3FGYA 3CC23 4LYLB 4OVMA 3DH2A 4WFOA 3B4PA 3D5GA 3K9MC 1QAKA 1BRNL 1JBRA 3NX0A 4KFDA 2IA7A 4HM1B 1N8QA 2CH9A 1VQQA 4XBTA 3MG1A 4FCJA 3CCE3 1YJW3 3I553 1VQ83 4N6TA 3FLJA 3D9RA 3AGOA 4HBRA 1OHOA 2AADA 3WA3A 1ZX2A 1BSCA 4BU4A 1JV2B 4HM0B 1QVF2 1B27A 1QJGA 1RJOA 1IV7A 3OWSA 3S28A 1Y4KA 2WOFA 1GOUA 2H0HA 1BSEA 2CWUA 3HZPA 1VQ43 2Z6BA 3O8YA 3NQZA 3D5IA 1Q864 1DMNA 1WNHA 3JUOA 4FCMA 3VF1A 1KSIA 3K7CA 1NJI4 2Z77A 8CHOA 4X2HA 3HX8A 5M19A 3U97A 2CW9A 1N5PA 1RGEA 2ML6A 3BNCA 2RBIA 1B2UA 1D6UA 1AVLA 1O7MB 5AIIA 3T8NA 2F86B 5IG4A 1QALA 3ECFA 5JPPA 1O7HB 1O7PB 1W6GA 2F4YA 2B1XB 1BRIA 1RHLA 3STDA 4MEIA 1N9JA 3PYJA 5AIHA 2KF3A 4QWTA 1RN4A 1ZO2A 4KFFA 1FUSA 4LZIA 3N8BA 4WYKB 3T8UA 2CK3H 4ILFA 5FGOA 1BUJA 4O3VA 3WDGB 1SPUA 4BL3A 1UUVB 4RBNA 3UL5A 5A0OB 4LGQA 3EN1B 1B3SA 1BOXA 1MWUA 1TP6A 4PEJA 3IJEB 4CDLA 3OWUA 3B4OA 2Z7AA 4U13A 3GZBA 1ISKA 1V58A 3NBBA 3NUVA 1IT8A 2HMNB 1JBSA 2UGIA 2Q07A 4LSOA 1CH0A 1TUHA 1OCVA 3VGNA 1X1YA 3K0ZA 3OV4A 5CLKA 1I2EA 4BTYA 1GMPA 5G1LA 4KVHA 4WP5A 1I0XA 1T2HA 1RRLA 3MSOA 1A2PA 2INXA 1BVIA 1GY6A 4LMIA 1W4NA 1BNSA 1ZS7A 3S29A 3FH1A 3SYUA 2IYJA 3PCSA 1OPYA 1IK3A 5CF2A 5EVHA 2W6JH 5FW5A 1NWWA 1FZUA 1FUWA 2KXGA 2ML5A 1UI8A 3EN8A 2QA43 2OOVC 1R4YA 1QMAA 1RGGA 3URPA 1O7NB 3LT9A 1OH0A 1JNQA 1I3IA 1JKGB 3LTDA 3FCSB 4FR9A 2KRTA 4HZ9B 3CCQ3 1GD4A 1FGQA 2W9PA 3A5EA 3EB8A 3GRDA 1JN5B 3DZLA 2I9WA 2LQVA 1UCIA 3CNMA 2CC3A 4HM7B 1B2ZA 4OUQA 1DMMA 1GOYA 2KF5A 2XRXB 3SEDA 1CYVA 1LOXA 3WOEB 4EW5A 3DGYA 3EX9A 2OQEA 3NM7A 1TRQA 3G0KA 1Q42A 1R4CA 2RCDA 1AV4A 1VQ63 2R41A 1AQZA 1OUNA 1NDOB 3BLZA 4H3UA 5G2GA 2O3OA 3JUQA 3AGNA 1BRSA 1U8CB 1MGRA 4R4KA 4FMAA 2STDA 1RSNA 3PS8A 4HKVB 3F7XA 1UDII 1RRHA 1TFKA 3D79A 4N6MA 4NPBA 1HZ1A 1A90A 1BU4A 1VQ73 3LTBA 1LVNA 3D4AA 2E2VA 2P05A 2W04A 1ULJB 4R9KA 1NO3A 1A2VA 3N9HA 3OWYA 2HMKB 3F14A 1SIHA 3J7Yd 3EJVA 3AMOB 3RGAA 1YI23 1FUTA 8RNTA 1YVSA 2WGOA 3FG4A 4WYKA 4K90B 5LC6A 1W2ZA 4N6NB 1W6CA 3G4S3 3LOYA 5I97A 1YVBI 3UNLA 9RNTA 1CYUA 2BO9B 1UGHI 4RZMA 1BNJA 1MWRA 2F99A 2H0IA 4MMYB 5BU4A 2XH9A 2ZL8A 1E97A 3BB9A 3FG1A 1W01A 3GSPA 5IG3A 4MMZB 3LT8A 3LYGA 2BU4A 1PY3A 2XSHB 3FF2A 5JPUA 4ORLA 4WWUC 3E99A 1PYLA 1TIJA 1JZDA 4HAAA 1QAFA 1KC84 1J2BA 1B2MA 3LH4A 2GSPA 1BNEA 1BNGA 4XM4A 1X1XA 2W56A 3X3YA 4EV2A 3GWRA 1JB2A 3NBRA 1K41A 4IIAA 6STDA 3CCR3 4N3VA 1AVKA 4N6V0 5CK6A 4GL6A 1UUWB 3V92A 3X3ZA 3EF8A 3NQYA 2GXFA 3K5TA 1I2FA 3NHXA 3Q1CA 1LNIA 2BNGA 5AI1A 1IV9A 1CQSA 1I3FA 3ALAA 1GMRA 3Q90A 4CCVA 4EXRA 1M904 2YFLB 3EE1A 3G6E3 4WHAA 3CD63 1UCLA 2Y74A 1DMQA 4XBXA 3WODG 1I2GA 4XB5A 3QRDA 1M1K4 4HYZA 3NV0A 4HM6B 1LQGC 1BSBA 2OOVA 3X42A 3I0YA 1VQP3 4Q53A 2H0GA 1JKGA 4HM3B 1A67A 2P38A 3DGNA 2OWPA 5EEOA 1JBTA 4OK0A 5IEPA 1Q40A 3H3HA 4L7KA 4KT3B 2C11A 3DXOA 2B24B 2FNQA 1IQ8A 1Q7Y4 1CEWI 2GBWB 1DYUA 2CG0A 2P09A 3DY5A 7STDA 1VQM3 1RCKA 3MPHA 5DREA 3CCM3 3UJMA 2YX9A 1OACA 3JUPA 1Q824 4K61A 1G0TA 1X1WA 3BNBA 1B21A 3A76A 3KE7A 3LTCA 3PZWA 1BIRA 1FYSA 4STDA 1BRJA 1TFOA 3IMAB 3ER7A 2LYXA 2GBXB 4K1UA 2F5MA 1IU7A 1VZZA 1GY5A 1RLSA 1O7GB 1BSAA 1IYYA 1VQN3 1SARA 3F7SA 4EV5A 5KP4A 1TJDA 3BIRA 1RGFA 1AY7A 1US1A 3MG3A 3JUNA 4R9LA 1FGMA 2WGQA 5BVBA 3DMCA 7GSPA 4HVNA 1M9GA 1WMOA 5ELUA 5KP3A 2CG1A 3SOAA 5IERA 1D6YA 1GD3A 3S27A 2L1SA 3CCV3 1W5ZA 4NREA 4HM5B 2OTL3 1STFI 2HMMB 2P0XA 1T3BA 3DGLA 1JJ22 4RNZA 4JF8A 4J9AA 5CXOA 3G8ZA 1OF5A 1K9M4 1GY7A 1BRHA 1W2B2 3EQQB 1KWIA 2KF4A 5M18A 1RKYA 3CME3 1LOYA 1DE3A 2K0MA 4N6LA 2F56A 1EKMA 2CWVA 3SVAA 1K734 1IQYA 5TGNA 1JB5A 2CFLA 2D1WA 4HOHA 3UL6A 3ZG0A 1RGCA 1RMSA 3PCRA 4FCZA 4FMCA 4BIRA 4KZ1A 2ZHXB 1IVXA 2IMJA 5IW9A 2QEX3 2CWTA 1GMQA 2WOHA 2KF6A 1SIIA 4O2HA 1FGRA 4BTWA 5IG5A 4GHOA 1KD14 2RNTA 1VQ53 1YGEA 1VQO3 5D82A 5IEOA 2BMRB 5IF6A 3JVCA 2Y73A 3GAXA 1V57A 3I563 4CJNA 3LXUX 4HM4B 1B2SA 1N5HA 2XEPA 1FGOA 1B2XA 3GZYB 1T5YA 5D83A 1BGSA 2KAAA 3AHWA 1I0VA 1I70A 3X3XA 4AKYA 4I4KA 4N6OB 1DVDA 2XFTA 2CKFB 2MF7A 4AEQA 1BRKA 2GEYA 1BSDA 1U5OA 1BNIA 1STDA 3WOFB 3NBJA 3SXXA 1IDPA 2GU3A 3F9SA 1MGWA 1TTOA 3M8CA 2YFIB 3RNTA 3FZWA 1JZOA 3CMA3 1QVG2 1OHSA 3KKGA 3CC43 5AYRB 1K28A 2BMQB 2PZVA 2C10A 2W9QA 3MKIA 5D81A 3RDEA 1NU3A 2D42A 1F8NA 1SQWA 1WMPA 2SBLA 3S67A 3WHOA 2M7OA 1BNFA 2OCTA 3FF0A 4LEHA 5AYSC 3D3LA 5STDA 1MNLA 2IY2A 5CF1A 4ZM8A 4HZBB 2KCDA 5BXQA 1TU5A 1S723 1LQMB 1YIT3 1UUGB 2JQ5A 5DRVA 3WMDA 1IVVA 1RGLA 1A2KA 1E3VA 3IPTA 2XF3A 2BT3A 3F40A 3L0RA 2CHCA 3TDGA 1PFPA 4N6UA 1HU9A 3SX1A 5IENA 2R4IA 2HMJB 1BRGA 1T2IA 4G1MB 5AIGA 3RGRA 1VQL3 1RTUA 5HOHA 5ELJA 1UW1A 2YFJB 4EBGA 1B20A 3OXAA 2IUJA 2J8XB 2W0QA 3G16A 3HIGA 4J8TA 2L4VA 2K3DA 1HKXA 1GOVA 2A15A 4DKIA 4IPBA 1W7CA 2V1LA 1JB4A 4K1VA 1BAOA 1RNTA 3KCHA 3H51A 3MYTA 1Z1SA 3N54B 2RGQA 2OQEC 1TRPA 2GEXA 2XGNA 3CPOA 2XFSA 1MWTA 4L8OA 1YHQ3 2BHMA 5EQLA 1W6YA 2O9UX 4MJDA 1M1XB 1RDSA 2ZA4A 3KFQC 3MWZA 4I5QA 2XSOB 3Q2PA 4NHFA 4O8SA 4FMDA 2MC8A 2CIUA 1MWSA 1YNVX 2C4BA 5IG0A 1JN5A 1I8VA 3LTAA 1EQKA 4IT7A 1RCLA 1E3RA 1W02A 4AKZA 3MHEA 3PXMA 4L8PA 1C54A 3FKAA 3HI7A 1EUIC 3KSED 3S5CA 3BNEA 3CNXA 3SOYA 1UCKA 3V99A 1RNBA 1UI7A 6RNTA 1BNRA 1K8A4 1WMNA 3CCS3 3X40A 4EYCA 1L5GB 4HM2B 1YJN3 1RGHA 5KP1A 1N9EA 1YGWA 1JRQA 1NB5I 1IQXA 1ZGXA 3JUMA 1IVWA 4TX4A 3CXC2 1NNVA 3OW22 1GSPA 2Z76A 2HMLB 4GB5A 3X41A 2CFKA 1MOLA 1V74A 4FMBA 4R80A 2E2UA 1VQK3 1BUQA 1D6ZA 3F8XA 2HOHA 2RSXA 2XR8B 3CPW2 3VSYA 1IT7A 3WR2A 2GU1A 2W2CA
chains in the Genus database with same CATH topology
9RNTA 1BGSA 2KAAA 3AHWA 1I0VA 1I70A 1RGEA 2RBIA 1BNJA 1B2UA 4RNTA 5GSPA 5BU4A 3Q3FA 1BRKA 1LRAA 2AAEA 3GSPA 1BSDA 1BNIA 2BU4A 1PY3A 2F4YA 1BRIA 1RHLA 1MGWA 1RN1A 1TTOA 1RN4A 1PYLA 2KF3A 4HAAA 4J5GA 3RNTA 1FUSA 1B2MA 2GSPA 1BNEA 1BNGA 2F5WA 1X1XA 4J5KA 1BUJA 1DETA 1UCJA 3HOHA 5BIRA 3WHOA 1FW7A 1I2FA 1B3SA 1BOXA 1LNIA 1BNFA 1I3FA 1GMRA 1JBSA 1UCLA 1I2GA 1CH0A 1RGLA 1X1YA 1I2EA 1BSBA 1GMPA 1G02A 1I0XA 1T2HA 1BRGA 1T2IA 1A2PA 1BVIA 1RGAA 1BANA 1RTUA 1JBTA 2SARA 4GSPA 5HOHA 1BNSA 2BIRA 1Q9EA 1B20A 3SYUA 3AHSA 1FZUA 3BU4A 3WR2A 1GOVA 1RCKA 1R4YA 1RGGA 3URPA 1X1WA 1B21A 1BAOA 1BIRA 1FYSA 1BRJA 1RNTA 1I3IA 3KCHA 1LOWA 2F5MA 1RGKA 1RLSA 3A5EA 1TRPA 1BSAA 1IYYA 1SARA 7RNTA 1UCIA 3BIRA 1RGFA 1AY7A 1B2ZA 1GOYA 1RDSA 2KF5A 2ZA4A 3DGYA 7GSPA 1TRQA 1LOVA 1YNVX 2C4BA 1HYFA 1I8VA 1X1UA 6GSPA 1AQZA 1RCLA 3DH2A 1C54A 3AGNA 1BRSA 3D5GA 1MGRA 1BRNL 1BRHA 1UCKA 1JBRA 2KF4A 1RNBA 1LOYA 1RSNA 6RNTA 1BNRA 1DE3A 2F56A 1HZ1A 1BU4A 4HOHA 3AGOA 1RGCA 1RMSA 1RGHA 4BIRA 2AADA 3D4AA 1YGWA 1BSCA 1ZGXA 4BU4A 1GMQA 1B27A 2KF6A 1GSPA 4GHOA 1GOUA 2RNTA 1BSEA 1FUTA 3D5IA 8RNTA 1YVSA 2HOHA 1B2SA 1B2XA 5RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9RNT A;  1BGS A;  2KAA A;  3AHW A;  1I0V A;  1I70 A;  1RGE A;  2RBI A;  1BNJ A;  1B2U A;  4RNT A;  5GSP A;  5BU4 A;  3Q3F A;  1BRK A;  1LRA A;  2AAE A;  3GSP A;  1BSD A;  1BNI A;  2BU4 A;  1PY3 A;  2F4Y A;  1BRI A;  1RHL A;  1MGW A;  1RN1 A;  1TTO A;  1RN4 A;  1PYL A;  2KF3 A;  4HAA A;  4J5G A;  3RNT A;  1FUS A;  1B2M A;  2GSP A;  1BNE A;  1BNG A;  2F5W A;  1X1X A;  4J5K A;  1BUJ A;  1DET A;  1UCJ A;  3HOH A;  5BIR A;  3WHO A;  1FW7 A;  1I2F A;  1B3S A;  1BOX A;  1LNI A;  1BNF A;  1I3F A;  1GMR A;  1JBS A;  1UCL A;  1I2G A;  1CH0 A;  1RGL A;  1X1Y A;  1I2E A;  1BSB A;  1GMP A;  1G02 A;  1I0X A;  1T2H A;  1BRG A;  1T2I A;  1A2P A;  1BVI A;  1RGA A;  1BAN A;  1RTU A;  1JBT A;  2SAR A;  4GSP A;  5HOH A;  1BNS A;  2BIR A;  1Q9E A;  1B20 A;  3SYU A;  3AHS A;  1FZU A;  3BU4 A;  3WR2 A;  1GOV A;  1RCK A;  1R4Y A;  1RGG A;  3URP A;  1X1W A;  1B21 A;  1BAO A;  1BIR A;  1FYS A;  1BRJ A;  1RNT A;  1I3I A;  3KCH A;  1LOW A;  2F5M A;  1RGK A;  1RLS A;  3A5E A;  1TRP A;  1BSA A;  1IYY A;  1SAR A;  7RNT A;  1UCI A;  3BIR A;  1RGF A;  1AY7 A;  1B2Z A;  1GOY A;  1RDS A;  2KF5 A;  2ZA4 A;  3DGY A;  7GSP A;  1TRQ A;  1LOV A;  1YNV X;  2C4B A;  1HYF A;  1I8V A;  1X1U A;  6GSP A;  1AQZ A;  1RCL A;  3DH2 A;  1C54 A;  3AGN A;  1BRS A;  3D5G A;  1MGR A;  1BRN L;  1BRH A;  1UCK A;  1JBR A;  2KF4 A;  1RNB A;  1LOY A;  1RSN A;  6RNT A;  1BNR A;  1DE3 A;  2F56 A;  1HZ1 A;  1BU4 A;  4HOH A;  3AGO A;  1RGC A;  1RMS A;  1RGH A;  4BIR A;  2AAD A;  3D4A A;  1YGW A;  1BSC A;  1ZGX A;  4BU4 A;  1GMQ A;  1B27 A;  2KF6 A;  1GSP A;  4GHO A;  1GOU A;  2RNT A;  1BSE A;  1FUT A;  3D5I A;  8RNT A;  1YVS A;  2HOH A;  1B2S A;  1B2X A;  5RNT A; 
#chains in the Genus database with same CATH topology
 1ULI B;  3AMO A;  2W03 A;  1FA3 A;  1GS3 A;  1RN7 A;  5GSP A;  4RNT A;  3CCL 3;  2ZDJ A;  2PNC A;  3Q3F A;  3LML A;  3HII A;  2XGL A;  2W56 B;  1LRA A;  1ROA A;  2AAE A;  3F8H A;  3KII A;  4X2O A;  3KZT A;  3T0U A;  1OHP A;  4JRF A;  2CFG A;  1RN1 A;  4J5G A;  3ROB A;  4HM8 B;  2F5W A;  4EC6 A;  2IUK A;  4J5K A;  3DUK A;  1DET A;  2BMO B;  2RFR A;  1LXE A;  1UCJ A;  2P0M A;  3HOH A;  2JDI H;  3UB1 A;  3NM2 A;  5LC7 A;  5AEU B;  1ROV A;  5BIR A;  2FGT A;  5AIF A;  1FW7 A;  3DM8 A;  3NV0 B;  1YIJ 3;  3CU3 A;  3KSP A;  1FGT A;  1Q7H A;  3V98 A;  4KFE A;  3LZA A;  4O02 B;  4XDW A;  2CFW A;  2FXT A;  1EA2 A;  2OTJ 3;  3HK4 A;  5G1K A;  1EEJ A;  1OGZ A;  1O7W B;  4RNY A;  1OGX A;  1Q40 B;  1YJ9 3;  3PGB A;  1G02 A;  2CX1 A;  3SLU A;  3G71 3;  1VQ9 3;  3GZX B;  2UX0 A;  4XBY A;  3BND A;  2CFD A;  1RGA A;  1BAN A;  3FG3 A;  2SAR A;  4GSP A;  4CPK A;  2BIR A;  1GYB A;  1Q9E A;  3ZG5 A;  3EBT A;  3GZR A;  1Q81 4;  3CCJ 3;  3AHS A;  4H61 A;  2K54 A;  4BTX A;  3EBY A;  4BL2 A;  4MMX B;  3B7C A;  3BU4 A;  3OX9 A;  3U1W A;  2CX0 A;  2WO0 A;  4R1K A;  1C7H A;  1DVC A;  1KQS 2;  5JBS A;  2QGU A;  1UGI A;  1LOW A;  3QK9 A;  4XDV A;  1LNH A;  2HMO B;  3WA2 X;  3MG2 A;  3EHC A;  1S5A A;  1RGK A;  3FSD A;  4HJL B;  5HGR A;  5AEW B;  2F98 A;  3NXJ A;  7RNT A;  3B8L A;  2UUG C;  3KN4 A;  1W00 A;  1NB3 I;  3DGO A;  2QIY A;  1AR0 A;  5M1A A;  1ASK A;  2E2T A;  1WQL B;  1PU4 A;  1OF5 B;  1LOV A;  1SJW A;  3DGM A;  1IVU A;  1WTH A;  1HYF A;  1X1U A;  5RNT A;  3K63 A;  6GSP A;  1N8R 4;  1EG9 B;  1G96 A;  3CCU 3;  3EC9 A;  3CC7 3;  3ZFZ A;  3FGY A;  3CC2 3;  4LYL B;  4OVM A;  3DH2 A;  4WFO A;  3B4P A;  3D5G A;  3K9M C;  1QAK A;  1BRN L;  1JBR A;  3NX0 A;  4KFD A;  2IA7 A;  4HM1 B;  1N8Q A;  2CH9 A;  1VQQ A;  4XBT A;  3MG1 A;  4FCJ A;  3CCE 3;  1YJW 3;  3I55 3;  1VQ8 3;  4N6T A;  3FLJ A;  3D9R A;  3AGO A;  4HBR A;  1OHO A;  2AAD A;  3WA3 A;  1ZX2 A;  1BSC A;  4BU4 A;  1JV2 B;  4HM0 B;  1QVF 2;  1B27 A;  1QJG A;  1RJO A;  1IV7 A;  3OWS A;  3S28 A;  1Y4K A;  2WOF A;  1GOU A;  2H0H A;  1BSE A;  2CWU A;  3HZP A;  1VQ4 3;  2Z6B A;  3O8Y A;  3NQZ A;  3D5I A;  1Q86 4;  1DMN A;  1WNH A;  3JUO A;  4FCM A;  3VF1 A;  1KSI A;  3K7C A;  1NJI 4;  2Z77 A;  8CHO A;  4X2H A;  3HX8 A;  5M19 A;  3U97 A;  2CW9 A;  1N5P A;  1RGE A;  2ML6 A;  3BNC A;  2RBI A;  1B2U A;  1D6U A;  1AVL A;  1O7M B;  5AII A;  3T8N A;  2F86 B;  5IG4 A;  1QAL A;  3ECF A;  5JPP A;  1O7H B;  1O7P B;  1W6G A;  2F4Y A;  2B1X B;  1BRI A;  1RHL A;  3STD A;  4MEI A;  1N9J A;  3PYJ A;  5AIH A;  2KF3 A;  4QWT A;  1RN4 A;  1ZO2 A;  4KFF A;  1FUS A;  4LZI A;  3N8B A;  4WYK B;  3T8U A;  2CK3 H;  4ILF A;  5FGO A;  1BUJ A;  4O3V A;  3WDG B;  1SPU A;  4BL3 A;  1UUV B;  4RBN A;  3UL5 A;  5A0O B;  4LGQ A;  3EN1 B;  1B3S A;  1BOX A;  1MWU A;  1TP6 A;  4PEJ A;  3IJE B;  4CDL A;  3OWU A;  3B4O A;  2Z7A A;  4U13 A;  3GZB A;  1ISK A;  1V58 A;  3NBB A;  3NUV A;  1IT8 A;  2HMN B;  1JBS A;  2UGI A;  2Q07 A;  4LSO A;  1CH0 A;  1TUH A;  1OCV A;  3VGN A;  1X1Y A;  3K0Z A;  3OV4 A;  5CLK A;  1I2E A;  4BTY A;  1GMP A;  5G1L A;  4KVH A;  4WP5 A;  1I0X A;  1T2H A;  1RRL A;  3MSO A;  1A2P A;  2INX A;  1BVI A;  1GY6 A;  4LMI A;  1W4N A;  1BNS A;  1ZS7 A;  3S29 A;  3FH1 A;  3SYU A;  2IYJ A;  3PCS A;  1OPY A;  1IK3 A;  5CF2 A;  5EVH A;  2W6J H;  5FW5 A;  1NWW A;  1FZU A;  1FUW A;  2KXG A;  2ML5 A;  1UI8 A;  3EN8 A;  2QA4 3;  2OOV C;  1R4Y A;  1QMA A;  1RGG A;  3URP A;  1O7N B;  3LT9 A;  1OH0 A;  1JNQ A;  1I3I A;  1JKG B;  3LTD A;  3FCS B;  4FR9 A;  2KRT A;  4HZ9 B;  3CCQ 3;  1GD4 A;  1FGQ A;  2W9P A;  3A5E A;  3EB8 A;  3GRD A;  1JN5 B;  3DZL A;  2I9W A;  2LQV A;  1UCI A;  3CNM A;  2CC3 A;  4HM7 B;  1B2Z A;  4OUQ A;  1DMM A;  1GOY A;  2KF5 A;  2XRX B;  3SED A;  1CYV A;  1LOX A;  3WOE B;  4EW5 A;  3DGY A;  3EX9 A;  2OQE A;  3NM7 A;  1TRQ A;  3G0K A;  1Q42 A;  1R4C A;  2RCD A;  1AV4 A;  1VQ6 3;  2R41 A;  1AQZ A;  1OUN A;  1NDO B;  3BLZ A;  4H3U A;  5G2G A;  2O3O A;  3JUQ A;  3AGN A;  1BRS A;  1U8C B;  1MGR A;  4R4K A;  4FMA A;  2STD A;  1RSN A;  3PS8 A;  4HKV B;  3F7X A;  1UDI I;  1RRH A;  1TFK A;  3D79 A;  4N6M A;  4NPB A;  1HZ1 A;  1A90 A;  1BU4 A;  1VQ7 3;  3LTB A;  1LVN A;  3D4A A;  2E2V A;  2P05 A;  2W04 A;  1ULJ B;  4R9K A;  1NO3 A;  1A2V A;  3N9H A;  3OWY A;  2HMK B;  3F14 A;  1SIH A;  3J7Y d;  3EJV A;  3AMO B;  3RGA A;  1YI2 3;  1FUT A;  8RNT A;  1YVS A;  2WGO A;  3FG4 A;  4WYK A;  4K90 B;  5LC6 A;  1W2Z A;  4N6N B;  1W6C A;  3G4S 3;  3LOY A;  5I97 A;  1YVB I;  3UNL A;  9RNT A;  1CYU A;  2BO9 B;  1UGH I;  4RZM A;  1BNJ A;  1MWR A;  2F99 A;  2H0I A;  4MMY B;  5BU4 A;  2XH9 A;  2ZL8 A;  1E97 A;  3BB9 A;  3FG1 A;  1W01 A;  3GSP A;  5IG3 A;  4MMZ B;  3LT8 A;  3LYG A;  2BU4 A;  1PY3 A;  2XSH B;  3FF2 A;  5JPU A;  4ORL A;  4WWU C;  3E99 A;  1PYL A;  1TIJ A;  1JZD A;  4HAA A;  1QAF A;  1KC8 4;  1J2B A;  1B2M A;  3LH4 A;  2GSP A;  1BNE A;  1BNG A;  4XM4 A;  1X1X A;  2W56 A;  3X3Y A;  4EV2 A;  3GWR A;  1JB2 A;  3NBR A;  1K41 A;  4IIA A;  6STD A;  3CCR 3;  4N3V A;  1AVK A;  4N6V 0;  5CK6 A;  4GL6 A;  1UUW B;  3V92 A;  3X3Z A;  3EF8 A;  3NQY A;  2GXF A;  3K5T A;  1I2F A;  3NHX A;  3Q1C A;  1LNI A;  2BNG A;  5AI1 A;  1IV9 A;  1CQS A;  1I3F A;  3ALA A;  1GMR A;  3Q90 A;  4CCV A;  4EXR A;  1M90 4;  2YFL B;  3EE1 A;  3G6E 3;  4WHA A;  3CD6 3;  1UCL A;  2Y74 A;  1DMQ A;  4XBX A;  3WOD G;  1I2G A;  4XB5 A;  3QRD A;  1M1K 4;  4HYZ A;  3NV0 A;  4HM6 B;  1LQG C;  1BSB A;  2OOV A;  3X42 A;  3I0Y A;  1VQP 3;  4Q53 A;  2H0G A;  1JKG A;  4HM3 B;  1A67 A;  2P38 A;  3DGN A;  2OWP A;  5EEO A;  1JBT A;  4OK0 A;  5IEP A;  1Q40 A;  3H3H A;  4L7K A;  4KT3 B;  2C11 A;  3DXO A;  2B24 B;  2FNQ A;  1IQ8 A;  1Q7Y 4;  1CEW I;  2GBW B;  1DYU A;  2CG0 A;  2P09 A;  3DY5 A;  7STD A;  1VQM 3;  1RCK A;  3MPH A;  5DRE A;  3CCM 3;  3UJM A;  2YX9 A;  1OAC A;  3JUP A;  1Q82 4;  4K61 A;  1G0T A;  1X1W A;  3BNB A;  1B21 A;  3A76 A;  3KE7 A;  3LTC A;  3PZW A;  1BIR A;  1FYS A;  4STD A;  1BRJ A;  1TFO A;  3IMA B;  3ER7 A;  2LYX A;  2GBX B;  4K1U A;  2F5M A;  1IU7 A;  1VZZ A;  1GY5 A;  1RLS A;  1O7G B;  1BSA A;  1IYY A;  1VQN 3;  1SAR A;  3F7S A;  4EV5 A;  5KP4 A;  1TJD A;  3BIR A;  1RGF A;  1AY7 A;  1US1 A;  3MG3 A;  3JUN A;  4R9L A;  1FGM A;  2WGQ A;  5BVB A;  3DMC A;  7GSP A;  4HVN A;  1M9G A;  1WMO A;  5ELU A;  5KP3 A;  2CG1 A;  3SOA A;  5IER A;  1D6Y A;  1GD3 A;  3S27 A;  2L1S A;  3CCV 3;  1W5Z A;  4NRE A;  4HM5 B;  2OTL 3;  1STF I;  2HMM B;  2P0X A;  1T3B A;  3DGL A;  1JJ2 2;  4RNZ A;  4JF8 A;  4J9A A;  5CXO A;  3G8Z A;  1OF5 A;  1K9M 4;  1GY7 A;  1BRH A;  1W2B 2;  3EQQ B;  1KWI A;  2KF4 A;  5M18 A;  1RKY A;  3CME 3;  1LOY A;  1DE3 A;  2K0M A;  4N6L A;  2F56 A;  1EKM A;  2CWV A;  3SVA A;  1K73 4;  1IQY A;  5TGN A;  1JB5 A;  2CFL A;  2D1W A;  4HOH A;  3UL6 A;  3ZG0 A;  1RGC A;  1RMS A;  3PCR A;  4FCZ A;  4FMC A;  4BIR A;  4KZ1 A;  2ZHX B;  1IVX A;  2IMJ A;  5IW9 A;  2QEX 3;  2CWT A;  1GMQ A;  2WOH A;  2KF6 A;  1SII A;  4O2H A;  1FGR A;  4BTW A;  5IG5 A;  4GHO A;  1KD1 4;  2RNT A;  1VQ5 3;  1YGE A;  1VQO 3;  5D82 A;  5IEO A;  2BMR B;  5IF6 A;  3JVC A;  2Y73 A;  3GAX A;  1V57 A;  3I56 3;  4CJN A;  3LXU X;  4HM4 B;  1B2S A;  1N5H A;  2XEP A;  1FGO A;  1B2X A;  3GZY B;  1T5Y A;  5D83 A;  1BGS A;  2KAA A;  3AHW A;  1I0V A;  1I70 A;  3X3X A;  4AKY A;  4I4K A;  4N6O B;  1DVD A;  2XFT A;  2CKF B;  2MF7 A;  4AEQ A;  1BRK A;  2GEY A;  1BSD A;  1U5O A;  1BNI A;  1STD A;  3WOF B;  3NBJ A;  3SXX A;  1IDP A;  2GU3 A;  3F9S A;  1MGW A;  1TTO A;  3M8C A;  2YFI B;  3RNT A;  3FZW A;  1JZO A;  3CMA 3;  1QVG 2;  1OHS A;  3KKG A;  3CC4 3;  5AYR B;  1K28 A;  2BMQ B;  2PZV A;  2C10 A;  2W9Q A;  3MKI A;  5D81 A;  3RDE A;  1NU3 A;  2D42 A;  1F8N A;  1SQW A;  1WMP A;  2SBL A;  3S67 A;  3WHO A;  2M7O A;  1BNF A;  2OCT A;  3FF0 A;  4LEH A;  5AYS C;  3D3L A;  5STD A;  1MNL A;  2IY2 A;  5CF1 A;  4ZM8 A;  4HZB B;  2KCD A;  5BXQ A;  1TU5 A;  1S72 3;  1LQM B;  1YIT 3;  1UUG B;  2JQ5 A;  5DRV A;  3WMD A;  1IVV A;  1RGL A;  1A2K A;  1E3V A;  3IPT A;  2XF3 A;  2BT3 A;  3F40 A;  3L0R A;  2CHC A;  3TDG A;  1PFP A;  4N6U A;  1HU9 A;  3SX1 A;  5IEN A;  2R4I A;  2HMJ B;  1BRG A;  1T2I A;  4G1M B;  5AIG A;  3RGR A;  1VQL 3;  1RTU A;  5HOH A;  5ELJ A;  1UW1 A;  2YFJ B;  4EBG A;  1B20 A;  3OXA A;  2IUJ A;  2J8X B;  2W0Q A;  3G16 A;  3HIG A;  4J8T A;  2L4V A;  2K3D A;  1HKX A;  1GOV A;  2A15 A;  4DKI A;  4IPB A;  1W7C A;  2V1L A;  1JB4 A;  4K1V A;  1BAO A;  1RNT A;  3KCH A;  3H51 A;  3MYT A;  1Z1S A;  3N54 B;  2RGQ A;  2OQE C;  1TRP A;  2GEX A;  2XGN A;  3CPO A;  2XFS A;  1MWT A;  4L8O A;  1YHQ 3;  2BHM A;  5EQL A;  1W6Y A;  2O9U X;  4MJD A;  1M1X B;  1RDS A;  2ZA4 A;  3KFQ C;  3MWZ A;  4I5Q A;  2XSO B;  3Q2P A;  4NHF A;  4O8S A;  4FMD A;  2MC8 A;  2CIU A;  1MWS A;  1YNV X;  2C4B A;  5IG0 A;  1JN5 A;  1I8V A;  3LTA A;  1EQK A;  4IT7 A;  1RCL A;  1E3R A;  1W02 A;  4AKZ A;  3MHE A;  3PXM A;  4L8P A;  1C54 A;  3FKA A;  3HI7 A;  1EUI C;  3KSE D;  3S5C A;  3BNE A;  3CNX A;  3SOY A;  1UCK A;  3V99 A;  1RNB A;  1UI7 A;  6RNT A;  1BNR A;  1K8A 4;  1WMN A;  3CCS 3;  3X40 A;  4EYC A;  1L5G B;  4HM2 B;  1YJN 3;  1RGH A;  5KP1 A;  1N9E A;  1YGW A;  1JRQ A;  1NB5 I;  1IQX A;  1ZGX A;  3JUM A;  1IVW A;  4TX4 A;  3CXC 2;  1NNV A;  3OW2 2;  1GSP A;  2Z76 A;  2HML B;  4GB5 A;  3X41 A;  2CFK A;  1MOL A;  1V74 A;  4FMB A;  4R80 A;  2E2U A;  1VQK 3;  1BUQ A;  1D6Z A;  3F8X A;  2HOH A;  2RSX A;  2XR8 B;  3CPW 2;  3VSY A;  1IT7 A;  3WR2 A;  2GU1 A;  2W2C A; 
#chains in the Genus database with same CATH homology
 9RNT A;  1BGS A;  2KAA A;  3AHW A;  1I0V A;  1I70 A;  1RGE A;  2RBI A;  1BNJ A;  1B2U A;  4RNT A;  5GSP A;  5BU4 A;  3Q3F A;  1BRK A;  1LRA A;  2AAE A;  3GSP A;  1BSD A;  1BNI A;  2BU4 A;  1PY3 A;  2F4Y A;  1BRI A;  1RHL A;  1MGW A;  1RN1 A;  1TTO A;  1RN4 A;  1PYL A;  2KF3 A;  4HAA A;  4J5G A;  3RNT A;  1FUS A;  1B2M A;  2GSP A;  1BNE A;  1BNG A;  2F5W A;  1X1X A;  4J5K A;  1BUJ A;  1DET A;  1UCJ A;  3HOH A;  5BIR A;  3WHO A;  1FW7 A;  1I2F A;  1B3S A;  1BOX A;  1LNI A;  1BNF A;  1I3F A;  1GMR A;  1JBS A;  1UCL A;  1I2G A;  1CH0 A;  1RGL A;  1X1Y A;  1I2E A;  1BSB A;  1GMP A;  1G02 A;  1I0X A;  1T2H A;  1BRG A;  1T2I A;  1A2P A;  1BVI A;  1RGA A;  1BAN A;  1RTU A;  1JBT A;  2SAR A;  4GSP A;  5HOH A;  1BNS A;  2BIR A;  1Q9E A;  1B20 A;  3SYU A;  3AHS A;  1FZU A;  3BU4 A;  3WR2 A;  1GOV A;  1RCK A;  1R4Y A;  1RGG A;  3URP A;  1X1W A;  1B21 A;  1BAO A;  1BIR A;  1FYS A;  1BRJ A;  1RNT A;  1I3I A;  3KCH A;  1LOW A;  2F5M A;  1RGK A;  1RLS A;  3A5E A;  1TRP A;  1BSA A;  1IYY A;  1SAR A;  7RNT A;  1UCI A;  3BIR A;  1RGF A;  1AY7 A;  1B2Z A;  1GOY A;  1RDS A;  2KF5 A;  2ZA4 A;  3DGY A;  7GSP A;  1TRQ A;  1LOV A;  1YNV X;  2C4B A;  1HYF A;  1I8V A;  1X1U A;  6GSP A;  1AQZ A;  1RCL A;  3DH2 A;  1C54 A;  3AGN A;  1BRS A;  3D5G A;  1MGR A;  1BRN L;  1BRH A;  1UCK A;  1JBR A;  2KF4 A;  1RNB A;  1LOY A;  1RSN A;  6RNT A;  1BNR A;  1DE3 A;  2F56 A;  1HZ1 A;  1BU4 A;  4HOH A;  3AGO A;  1RGC A;  1RMS A;  1RGH A;  4BIR A;  2AAD A;  3D4A A;  1YGW A;  1BSC A;  1ZGX A;  4BU4 A;  1GMQ A;  1B27 A;  2KF6 A;  1GSP A;  4GHO A;  1GOU A;  2RNT A;  1BSE A;  1FUT A;  3D5I A;  8RNT A;  1YVS A;  2HOH A;  1B2S A;  1B2X A;  5RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...