3CCL3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccl300
3CC23 1YI23 1VQ53 3CC43 3CCJ3 3G4S3 3CCV3 1K9M4 3CCU3 3CCL3 1K734 1VQK3 1M1K4 1YIT3 1JJ22 1M904 3CPW2 3CC73 1VQN3 1VQ43 1VQO3 1VQP3 3CMA3 1K8A4 3CCS3 1W2B2 3CCQ3 1VQ63 1S723 3CD63 1YJN3 1VQ83 3CXC2 2QA43 1KD14 3CME3 3G713 3I563 1YHQ3 1KC84 1VQM3 1N8R4 3OW22 1YIJ3 1Q824 1VQL3 3CCR3 2QEX3 1QVF2 1Q864 3CCE3 1KQS2 2OTL3 3I553 2OTJ3 1YJ93 1NJI4 1VQ73 1Q7Y4 1YJW3 1Q814 1VQ93 1QVG2 3CCM3 3G6E3
chains in the Genus database with same CATH superfamily
1N5PA 3HZPA 1I2FA 1LOWA 2W6JH 3DGLA 5AIHA 1FGMA 1JKGB 1C54A 3WDGB 4GL6A 1IU7A 4N6V0 4EV2A 4IPBA 1BAOA 5FGOA 3AHSA 1ROVA 4N6NB 3CC73 3MG3A 4MMXB 1B27A 1VQP3 1YVBI 3CMA3 1BUJA 1K28A 2XGLA 1IVXA 1IQ8A 1M9GA 2UX0A 2RNTA 3OWSA 3NX0A 1GOUA 1MGRA 3CXC2 3HOHA 3NBJA 1VQ83 3N54B 3KFQC 1KC84 2Y74A 1W00A 3G713 1BUQA 2V1LA 5DREA 2JQ5A 1TIJA 4FCJA 3FF2A 4I4KA 4HM7B 4LMIA 2C11A 4KFFA 3Q2PA 4HM6B 5IG4A 1JB4A 1W6CA 1JZDA 1RRHA 1KSIA 1YJ93 1FW7A 1IQXA 1I2GA 1SQWA 2CHCA 2B1XB 5JPPA 2FGTA 3CU3A 1G96A 4FR9A 2HMKB 4KVHA 3NXJA 1RNBA 3DM8A 1OACA 1BSEA 3CCL3 3GSPA 4ORLA 1JJ22 1WMNA 1UGIA 2A15A 1CH0A 1K41A 6STDA 1BRNL 4EC6A 5IG0A 1OF5B 1IT8A 1S723 3F9SA 1YJN3 3OXAA 3D79A 2OOVC 3FLJA 2GU3A 3DGMA 1RTUA 1X1WA 1RGLA 3KN4A 1Q824 3FGYA 1Q9EA 3KSPA 3VGNA 3T8NA 3DZLA 1ASKA 4K1UA 1UI8A 2R41A 1CQSA 1OGZA 3D9RA 3HK4A 4QWTA 6GSPA 5LC6A 3ALAA 3B7CA 1E3VA 1SARA 4OUQA 4LYLB 5IG3A 3CCJ3 4BTXA 2QIYA 5ELUA 1CEWI 3F7XA 2CFWA 1TFOA 4FCZA 4R80A 4WP5A 5EVHA 2H0GA 1YIT3 1FGTA 2YFIB 5AIIA 1W01A 5GSPA 2XSHB 3WODG 2XF3A 3CNMA 1SPUA 1WNHA 3S29A 2F5MA 4BIRA 1TJDA 1LOVA 1S5AA 3ZFZA 4IT7A 3DGNA 3QK9A 5G1LA 4EYCA 1AVLA 4PEJA 4R1KA 1JBRA 3GRDA 4BU4A 2XRXB 1VQL3 2E2TA 1MWSA 3EE1A 3BU4A 3E99A 4J8TA 5AIFA 1A67A 1GY6A 3GZXB 3TDGA 3CCM3 1UI7A 2CFKA 1STDA 4OK0A 1DE3A 1VQ53 1I3FA 4HVNA 5M19A 4N6UA 2W9QA 5RNTA 2HMJB 4KFEA 4U13A 4EV5A 3PZWA 4CDLA 1LOYA 1OGXA 2Z76A 3UJMA 2KF4A 1RJOA 4HM2B 3T8UA 4O02B 1TU5A 1RDSA 3G16A 4NPBA 4HBRA 2Y73A 2Z77A 3CCS3 3DGYA 1GYBA 3IMAB 1UUVB 4MMZB 4JF8A 1J2BA 3ZG5A 3ER7A 4HZ9B 5CF1A 4K90B 2OCTA 4ZM8A 3OV4A 3H51A 2IUKA 3DMCA 1W6YA 1BNSA 1GY7A 1DMMA 3D3LA 4L8PA 2OTL3 2KF3A 3DXOA 4WHAA 3EB8A 1VQQA 4LEHA 1RNTA 1BSAA 2F4YA 2K3DA 1OUNA 3CNXA 3G6E3 1VQN3 3S27A 1EQKA 1RLSA 2B24B 1OHOA 4XBYA 3F7SA 1RCLA 3AHWA 3T0UA 2ZL8A 2HMOB 2UUGC 3UL5A 4CJNA 1SIIA 3B4OA 1LNHA 3I0YA 3Q1CA 2CWVA 2QGUA 3V99A 1Y4KA 2RBIA 2P0XA 2GBWB 5LC7A 3WA2X 4N6MA 2QA43 2MF7A 3SX1A 1KD14 4FMDA 4WYKB 1FUTA 3KZTA 1LRAA 2GEXA 3MKIA 4K1VA 2QEX3 2INXA 1RMSA 1DETA 1GOVA 1KQS2 3WOEB 3VF1A 3PCRA 1LQGC 1O7GB 1PY3A 1B21A 1CYUA 2W56B 4Q53A 1RKYA 3CCV3 1UW1A 1C7HA 3K7CA 3PXMA 1JBSA 3O8YA 1IT7A 1SIHA 1A2VA 1GS3A 2F98A 5BVBA 1FYSA 3URPA 3WR2A 4G1MB 1E3RA 1V74A 1WMOA 4OVMA 1OHSA 4HM0B 1U8CB 1W02A 1M1XB 1R4CA 3MWZA 5A0OB 1BRSA 1LVNA 2XH9A 4NHFA 2OWPA 1ZO2A 4ILFA 5IF6A 3LYGA 3EQQB 4I5QA 1KWIA 3EBTA 4R9KA 3LTCA 1WQLB 4XBTA 2HOHA 2W0QA 3KE7A 3NV0A 1A2KA 5AYRB 2P0MA 4EXRA 1N9JA 2OOVA 2CFLA 3LT9A 4JRFA 1RGCA 1UUGB 1BU4A 3WA3A 3A5EA 4LGQA 2IUJA 1JN5A 1B2SA 2KRTA 1GOYA 3EN1B 3LH4A 4KFDA 3PYJA 1SJWA 5ELJA 1O7HB 3CPW2 1Q40B 3FG3A 3SOYA 3SOAA 4BTYA 1VQO3 2F56A 5M1AA 1TRPA 4O8SA 4WWUC 1W6GA 4XDWA 1X1XA 3AGOA 1DYUA 2PNCA 3LOYA 2RSXA 3GWRA 3K9MC 1NB5I 3D4AA 3DY5A 4FMAA 1WMPA 2OQEC 4WFOA 1G0TA 3GAXA 2BMRB 3D5GA 1W5ZA 4FMBA 3X42A 3EJVA 1I70A 3I553 3LMLA 4LZIA 3B8LA 4L8OA 5D81A 1RHLA 1RN4A 2BIRA 2SBLA 3BNEA 3IPTA 4FCMA 1RGHA 2I9WA 4XDVA 1TP6A 5AI1A 1NNVA 1OCVA 1GMQA 2UGIA 2PZVA 1MGWA 4GSPA 3H3HA 3F8XA 1I0VA 1NDOB 1FA3A 1JNQA 1N8R4 1GSPA 4N6LA 2RCDA 3KSED 4R9LA 3Q3FA 3A76A 1O7MB 3F40A 1QAFA 2H0HA 3DH2A 4STDA 1MOLA 1BANA 2D42A 3RGAA 1QVF2 3MSOA 5AEWB 3N8BA 5EEOA 1MWTA 2XFTA 1ZGXA 1TFKA 1BGSA 3GZBA 2HMLB 3WOFB 5KP4A 2FNQA 2XEPA 2XFSA 5D83A 3ROBA 5I97A 2WGQA 1FUSA 2H0IA 2KF6A 1IVWA 2MC8A 1I2EA 1B2ZA 1B2UA 1VQK3 1K734 1O7WB 4NREA 4LSOA 4H61A 2BHMA 1JRQA 4X2OA 2CH9A 5IG5A 3NM7A 2K0MA 2BO9B 5HGRA 3CD63 3X3ZA 3AMOA 3JVCA 1BNIA 3BNDA 2WOHA 1EKMA 2JDIH 3RGRA 2CX1A 2SARA 1HZ1A 2WGOA 1I0XA 1TTOA 3HX8A 1DMQA 1EEJA 2LQVA 1NO3A 2AAEA 3VSYA 1FZUA 1STFI 2AADA 3X40A 2GSPA 3B4PA 4GHOA 1WTHA 2IMJA 4WYKA 1VQ63 3WMDA 3EC9A 3CC43 4RNTA 1IV7A 2YFLB 8CHOA 1B2XA 2O9UX 1N8QA 1RN7A 1UCLA 1AY7A 5FW5A 4J5GA 3CPOA 1NB3I 3DGOA 1MNLA 2R4IA 3X3YA 1W2B2 1JKGA 4BTWA 4HM4B 3LTDA 2CC3A 1PFPA 2WOFA 3G0KA 4HM5B 3KIIA 4H3UA 4CPKA 2M7OA 2E2VA 1V57A 3ECFA 3FZWA 1U5OA 2Z7AA 4XB5A 1N9EA 3WHOA 1JB2A 1PYLA 2BNGA 2K54A 2CWUA 5D82A 2P38A 1V58A 3JUMA 2O3OA 3GZRA 1QVG2 1UDII 2GEYA 4AEQA 1VQ93 4TX4A 4XBXA 3MPHA 2W03A 4N6TA 1YI23 3BLZA 4MEIA 2GU1A 3X3XA 3M8CA 4AKYA 1N5HA 1RGEA 3JUOA 2W2CA 3QRDA 2CK3H 1T2HA 3V92A 1YGEA 1AQZA 3NM2A 1GD4A 2CG0A 1BSDA 2Q07A 1ULIB 4N3VA 1YNVX 1E97A 3RNTA 3FF0A 1EG9B 5KP1A 2W9PA 3S28A 1BRIA 4KZ1A 2C10A 2CX0A 2FXTA 7RNTA 1QMAA 1D6UA 2BT3A 1TRQA 2YX9A 3FG1A 3GZYB 2ZA4A 3OX9A 1OF5A 3BNBA 3DUKA 3N9HA 4GB5A 5G2GA 1G02A 1NJI4 1ROAA 2RGQA 4RNZA 2OQEA 2Z6BA 1FUWA 2HMMB 1IK3A 2ZHXB 1GMRA 1FGOA 1RN1A 1BNGA 2F99A 1AV4A 2KCDA 3MHEA 4HM8B 1LQMB 1OH0A 3KKGA 2J8XB 6RNTA 5G1KA 3EF8A 5HOHA 2IA7A 1NWWA 2BMOB 1TUHA 4RNYA 3LT8A 1AR0A 1RRLA 3CCQ3 1Q7HA 1JBTA 3SLUA 3SEDA 1DVDA 7STDA 1W4NA 3I563 5CLKA 1R4YA 1BRJA 3OW22 3HI7A 1B2MA 1PU4A 3JUPA 3CCR3 3UB1A 5JPUA 1QALA 2W04A 1UUWB 1BRKA 5IW9A 1BVIA 2OTJ3 2D1WA 3NBBA 1BNEA 4HKVB 1Q7Y4 1W2ZA 4J9AA 3ZG0A 1Q814 1IVVA 1EUIC 1HU9A 1BNFA 2GXFA 2IYJA 1IDPA 4L7KA 2XR8B 4N6OB 2CFDA 3LZAA 1Z1SA 3CCU3 4HZBB 5CXOA 1L5GB 3JUQA 1IVUA 2CWTA 4HM3B 3F14A 1F8NA 1ZX2A 1T5YA 2E2UA 1VQ43 3K0ZA 1BSBA 3MG1A 3NV0B 1B20A 1LXEA 2BMQB 3OWUA 2F5WA 2IY2A 1O7PB 3FCSB 4MJDA 3S67A 4IIAA 2CFGA 1YHQ3 5IERA 4KT3B 1VQM3 2C4BA 1BSCA 3EHCA 4EBGA 1AVKA 5BU4A 1JN5B 1BRGA 1BNJA 3V98A 1CYVA 4EW5A 1O7NB 3BNCA 1VQ73 1YJW3 1JV2B 3G8ZA 5IEPA 3MG2A 3CC23 1UCKA 8RNTA 1FGQA 3FG4A 5CK6A 3G4S3 1JZOA 3UL6A 5JBSA 3PCSA 3LTBA 1GMPA 1I3IA 3NQZA 2WO0A 1MWRA 1BOXA 1YVSA 2BU4A 3FH1A 4HYZA 3OWYA 1K8A4 1FGRA 5IENA 1T2IA 5BXQA 3AGNA 1LOXA 2GBXB 3SYUA 3JUNA 1RCKA 3CME3 1W7CA 5TGNA 5AIGA 1UCJA 2STDA 3RDEA 2YFJB 7GSPA 3IJEB 1ZS7A 4BL2A 5STDA 2ML6A 4HJLB 5AYSC 1BNRA 4O3VA 3U97A 4K61A 2HMNB 2P05A 1IV9A 3HIIA 1RGAA 1QAKA 1VZZA 3NUVA 4HAAA 5DRVA 2L4VA 5BIRA 1K9M4 3K63A 1M1K4 1HKXA 1OPYA 3U1WA 1M904 2XSOB 1OHPA 2CIUA 3STDA 3MYTA 3PS8A 1EA2A 1NU3A 3NHXA 1DMNA 1QJGA 2W56A 1IYYA 1A90A 1RSNA 3PGBA 2ZDJA 3EX9A 4HOHA 4XM4A 4O2HA 4RBNA 2L1SA 3EBYA 1YIJ3 1RGFA 1UCIA 4FMCA 5M18A 4X2HA 1JB5A 5CF2A 4R4KA 1Q864 2CKFB 3SVAA 1BRHA 1DVCA 3BIRA 3FSDA 3HIGA 4RZMA 3K5TA 1UGHI 3Q90A 9RNTA 3J7Yd 2KF5A 5EQLA 3EN8A 3S5CA 1YGWA 3FKAA 3AMOB 3D5IA 1T3BA 2KAAA 5IEOA 4CCVA 1US1A 1Q42A 3SXXA 1X1UA 3F8HA 4DKIA 1MWUA 2CW9A 1D6ZA 3L0RA 2F86B 2KXGA 1A2PA 4BL3A 1HYFA 1I8VA 3NBRA 1X1YA 1ISKA 5AEUB 1BIRA 5KP3A 3KCHA 1LNIA 3LXUX 3UNLA 1Q40A 1D6YA 2P09A 4AKZA 4J5KA 2CG1A 1GY5A 2ML5A 4HM1B 1IQYA 1RGKA 2XGNA 3CCE3 1ULJB 1B3SA 1GD3A 3X41A 2RFRA 3BB9A 4MMYB 2LYXA 3LTAA 1RGGA 3NQYA
chains in the Genus database with same CATH topology
1N5PA 3HZPA 2W6JH 3DGLA 5AIHA 1FGMA 1JKGB 3WDGB 4GL6A 1IU7A 4N6V0 4EV2A 4IPBA 5FGOA 1ROVA 4N6NB 3CC73 3MG3A 4MMXB 1VQP3 3CMA3 1YVBI 1K28A 2XGLA 1IVXA 1IQ8A 1M9GA 2UX0A 3OWSA 3NX0A 3CXC2 1VQ83 3NBJA 3N54B 3KFQC 1KC84 2Y74A 1W00A 3G713 1BUQA 2V1LA 5DREA 2JQ5A 1TIJA 4FCJA 3FF2A 4I4KA 4HM7B 4LMIA 2C11A 4KFFA 3Q2PA 4HM6B 5IG4A 1JB4A 1W6CA 1RRHA 1KSIA 1YJ93 1IQXA 1SQWA 2CHCA 2B1XB 5JPPA 2FGTA 3CU3A 1G96A 4FR9A 2HMKB 4KVHA 3NXJA 3DM8A 1OACA 3CCL3 4ORLA 1JJ22 1WMNA 2A15A 1K41A 6STDA 4EC6A 5IG0A 1OF5B 1IT8A 1S723 3F9SA 1YJN3 3OXAA 2OOVC 3FLJA 2GU3A 3DGMA 3KN4A 3FGYA 3KSPA 3VGNA 3T8NA 3DZLA 1ASKA 4K1UA 1UI8A 1CQSA 1OGZA 3D9RA 3HK4A 4QWTA 5LC6A 3ALAA 3B7CA 1E3VA 4OUQA 5IG3A 3CCJ3 4BTXA 2QIYA 5ELUA 1CEWI 3F7XA 2CFWA 1TFOA 4FCZA 4R80A 4WP5A 5EVHA 1YIT3 1FGTA 2YFIB 5AIIA 1W01A 3WODG 2XSHB 2XF3A 3CNMA 1SPUA 1WNHA 3S29A 1S5AA 4IT7A 3DGNA 3QK9A 4EYCA 1AVLA 4PEJA 4R1KA 3GRDA 2XRXB 1VQL3 2E2TA 3EE1A 3E99A 4J8TA 5AIFA 1A67A 1GY6A 3GZXB 3TDGA 3CCM3 1UI7A 2CFKA 1STDA 4OK0A 1VQ53 4HVNA 4N6UA 2W9QA 2HMJB 4KFEA 4U13A 4EV5A 3PZWA 4CDLA 1OGXA 2Z76A 3UJMA 4HM2B 1RJOA 3T8UA 4O02B 1TU5A 3G16A 4HBRA 2Y73A 2Z77A 3CCS3 1GYBA 3IMAB 1UUVB 4MMZB 4JF8A 1J2BA 3ER7A 4HZ9B 5CF1A 4K90B 2OCTA 4ZM8A 3OV4A 3H51A 2IUKA 3DMCA 1W6YA 1GY7A 1DMMA 3D3LA 4L8PA 2OTL3 3DXOA 4WHAA 3EB8A 4LEHA 1VQN3 1OUNA 3CNXA 3G6E3 3S27A 1EQKA 2B24B 1OHOA 4XBYA 3F7SA 3T0UA 2ZL8A 2HMOB 3UL5A 1SIIA 3B4OA 1LNHA 3I0YA 3Q1CA 2CWVA 2QGUA 3V99A 1Y4KA 2P0XA 2GBWB 5LC7A 3WA2X 4N6MA 2QA43 2MF7A 3SX1A 1KD14 4FMDA 4WYKB 3KZTA 2GEXA 3MKIA 4K1VA 2QEX3 2INXA 1KQS2 3WOEB 3VF1A 3PCRA 1O7GB 1CYUA 2W56B 4Q53A 1RKYA 3CCV3 1UW1A 1C7HA 3K7CA 3PXMA 3O8YA 1IT7A 1SIHA 1A2VA 1GS3A 2F98A 5BVBA 4G1MB 1E3RA 1V74A 1WMOA 4OVMA 1OHSA 4HM0B 1U8CB 1W02A 1M1XB 1R4CA 3MWZA 5A0OB 1LVNA 2XH9A 4NHFA 2OWPA 1ZO2A 5IF6A 3LYGA 3EQQB 1Q824 1KWIA 3EBTA 4R9KA 3LTCA 1WQLB 4XBTA 2W0QA 3KE7A 3NV0A 1A2KA 5AYRB 2P0MA 4EXRA 1N9JA 2OOVA 2CFLA 3LT9A 4JRFA 3WA3A 4LGQA 2IUJA 1JN5A 3EN1B 2KRTA 3LH4A 4KFDA 3PYJA 1SJWA 5ELJA 1O7HB 3CPW2 1Q40B 3FG3A 3SOYA 3SOAA 4BTYA 1VQO3 4O8SA 4WWUC 1W6GA 4XDWA 1DYUA 2PNCA 3LOYA 2RSXA 3GWRA 3K9MC 1NB5I 3DY5A 4FMAA 1WMPA 2OQEC 4WFOA 3GAXA 2BMRB 1W5ZA 4FMBA 3X42A 3EJVA 3I553 3LMLA 4LZIA 3B8LA 4L8OA 5D81A 2SBLA 3BNEA 3IPTA 4FCMA 2I9WA 4XDVA 1TP6A 5AI1A 1OCVA 2PZVA 3H3HA 3F8XA 1NDOB 1JNQA 1N8R4 4N6LA 2RCDA 3KSED 4R9LA 3A76A 1O7MB 3F40A 1QAFA 4STDA 3RGAA 1QVF2 1MOLA 2D42A 1FA3A 3MSOA 5AEWB 3N8BA 5EEOA 2XFTA 1TFKA 3GZBA 5KP4A 2HMLB 3WOFB 2FNQA 2XEPA 2XFSA 5D83A 3ROBA 5I97A 2WGQA 1IVWA 2MC8A 1K734 1VQK3 1O7WB 4NREA 4LSOA 4H61A 2BHMA 1JRQA 4X2OA 2CH9A 5IG5A 3NM7A 2K0MA 2BO9B 5HGRA 3CD63 3X3ZA 3AMOA 3JVCA 3BNDA 2WOHA 1EKMA 2JDIH 3RGRA 2WGOA 3HX8A 1DMQA 2LQVA 1NO3A 3VSYA 1STFI 3X40A 3B4PA 1WTHA 2IMJA 4WYKA 1VQ63 3WMDA 3EC9A 3CC43 1IV7A 2YFLB 8CHOA 2O9UX 1N8QA 1RN7A 5FW5A 3CPOA 1NB3I 3DGOA 1MNLA 2R4IA 3X3YA 1W2B2 1JKGA 4BTWA 4HM4B 3LTDA 2CC3A 1PFPA 2WOFA 3G0KA 4HM5B 3KIIA 4H3UA 2M7OA 2E2VA 3ECFA 3FZWA 1U5OA 2Z7AA 4XB5A 1N9EA 1JB2A 2BNGA 2K54A 2CWUA 5D82A 2P38A 3JUMA 1VQ93 2O3OA 3GZRA 1QVG2 2GEYA 4AEQA 4TX4A 4XBXA 3MPHA 2W03A 4N6TA 1YI23 3BLZA 4MEIA 2GU1A 3X3XA 3M8CA 4AKYA 1N5HA 3JUOA 2W2CA 3QRDA 2CK3H 3V92A 1YGEA 3NM2A 1GD4A 2CG0A 2Q07A 1ULIB 4N3VA 1E97A 3FF0A 1EG9B 5KP1A 2W9PA 3S28A 4KZ1A 2C10A 2FXTA 1QMAA 1D6UA 2BT3A 2YX9A 3FG1A 3GZYB 3OX9A 1OF5A 3BNBA 3DUKA 3N9HA 4GB5A 5G2GA 1NJI4 1ROAA 2RGQA 4RNZA 2OQEA 2Z6BA 1FUWA 2HMMB 1IK3A 1FGOA 2F99A 2KCDA 4HM8B 1AV4A 3MHEA 1OH0A 3KKGA 3EF8A 2IA7A 1NWWA 2BMOB 1TUHA 4RNYA 3LT8A 1AR0A 1RRLA 3CCQ3 3SLUA 3SEDA 1DVDA 7STDA 1W4NA 3I563 5CLKA 3OW22 3HI7A 1PU4A 3JUPA 3CCR3 3UB1A 5JPUA 1QALA 2W04A 1UUWB 5IW9A 2OTJ3 2D1WA 3NBBA 4HKVB 1Q7Y4 1W2ZA 4J9AA 1Q814 1IVVA 1HU9A 2GXFA 1IDPA 4L7KA 2XR8B 4N6OB 2CFDA 3LZAA 1Z1SA 3CCU3 4HZBB 5CXOA 1L5GB 3JUQA 1IVUA 2CWTA 4HM3B 3F14A 1F8NA 1ZX2A 1T5YA 2E2UA 1VQ43 3K0ZA 3MG1A 3NV0B 1LXEA 2BMQB 3OWUA 3S67A 3FCSB 1O7PB 4MJDA 4IIAA 2CFGA 1YHQ3 5IERA 1VQM3 3EHCA 4EBGA 1AVKA 1JN5B 3V98A 1CYVA 1O7NB 3BNCA 1VQ73 1YJW3 1JV2B 3G8ZA 5IEPA 3MG2A 3CC23 1FGQA 3FG4A 5CK6A 3G4S3 3UL6A 5JBSA 3PCSA 3LTBA 3NQZA 2WO0A 3FH1A 4HYZA 3OWYA 1K8A4 1FGRA 5IENA 5BXQA 1LOXA 2GBXB 3JUNA 3CME3 1W7CA 5TGNA 5AIGA 2STDA 3RDEA 2YFJB 3IJEB 5STDA 2ML6A 4HJLB 5AYSC 4O3VA 3U97A 4K61A 2HMNB 2P05A 1IV9A 3HIIA 1VZZA 1QAKA 3NUVA 1K9M4 5DRVA 2L4VA 3K63A 1M1K4 1HKXA 1OPYA 3U1WA 1M904 2XSOB 1OHPA 2CIUA 3STDA 3MYTA 3PS8A 1EA2A 1NU3A 3NHXA 1DMNA 1QJGA 2W56A 1A90A 3PGBA 2ZDJA 3EX9A 4XM4A 4O2HA 4RBNA 3EBYA 1YIJ3 4FMCA 4X2HA 1JB5A 5CF2A 4R4KA 1Q864 2CKFB 3SVAA 1DVCA 3HIGA 4RZMA 3FSDA 3K5TA 3Q90A 3J7Yd 5EQLA 3EN8A 3S5CA 3FKAA 3AMOB 5IEOA 4CCVA 1US1A 1Q42A 3SXXA 3F8HA 2CW9A 1D6ZA 3L0RA 2F86B 2KXGA 3NBRA 1ISKA 5AEUB 5KP3A 3LXUX 3UNLA 1Q40A 1D6YA 2P09A 4AKZA 2CG1A 1GY5A 2ML5A 4HM1B 1IQYA 2XGNA 3CCE3 1ULJB 1GD3A 3X41A 2RFRA 3BB9A 4MMYB 2LYXA 3LTAA 3NQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 3;  1YI2 3;  1VQ5 3;  3CC4 3;  3CCJ 3;  3G4S 3;  3CCV 3;  1K9M 4;  3CCU 3;  3CCL 3;  1K73 4;  1VQK 3;  1M1K 4;  1YIT 3;  1JJ2 2;  1M90 4;  3CPW 2;  3CC7 3;  1VQN 3;  1VQ4 3;  1VQO 3;  1VQP 3;  3CMA 3;  1K8A 4;  3CCS 3;  1W2B 2;  3CCQ 3;  1VQ6 3;  1S72 3;  3CD6 3;  1YJN 3;  1VQ8 3;  3CXC 2;  2QA4 3;  1KD1 4;  3CME 3;  3G71 3;  3I56 3;  1YHQ 3;  1KC8 4;  1VQM 3;  1N8R 4;  3OW2 2;  1YIJ 3;  1Q82 4;  1VQL 3;  3CCR 3;  2QEX 3;  1QVF 2;  1Q86 4;  3CCE 3;  1KQS 2;  2OTL 3;  3I55 3;  2OTJ 3;  1YJ9 3;  1NJI 4;  1VQ7 3;  1Q7Y 4;  1YJW 3;  1Q81 4;  1VQ9 3;  1QVG 2;  3CCM 3;  3G6E 3; 
#chains in the Genus database with same CATH topology
 1N5P A;  3HZP A;  1I2F A;  1LOW A;  2W6J H;  3DGL A;  5AIH A;  1FGM A;  1JKG B;  1C54 A;  3WDG B;  4GL6 A;  1IU7 A;  4N6V 0;  4EV2 A;  4IPB A;  1BAO A;  5FGO A;  3AHS A;  1ROV A;  4N6N B;  3CC7 3;  3MG3 A;  4MMX B;  1B27 A;  1VQP 3;  1YVB I;  3CMA 3;  1BUJ A;  1K28 A;  2XGL A;  1IVX A;  1IQ8 A;  1M9G A;  2UX0 A;  2RNT A;  3OWS A;  3NX0 A;  1GOU A;  1MGR A;  3CXC 2;  3HOH A;  3NBJ A;  1VQ8 3;  3N54 B;  3KFQ C;  1KC8 4;  2Y74 A;  1W00 A;  3G71 3;  1BUQ A;  2V1L A;  5DRE A;  2JQ5 A;  1TIJ A;  4FCJ A;  3FF2 A;  4I4K A;  4HM7 B;  4LMI A;  2C11 A;  4KFF A;  3Q2P A;  4HM6 B;  5IG4 A;  1JB4 A;  1W6C A;  1JZD A;  1RRH A;  1KSI A;  1YJ9 3;  1FW7 A;  1IQX A;  1I2G A;  1SQW A;  2CHC A;  2B1X B;  5JPP A;  2FGT A;  3CU3 A;  1G96 A;  4FR9 A;  2HMK B;  4KVH A;  3NXJ A;  1RNB A;  3DM8 A;  1OAC A;  1BSE A;  3CCL 3;  3GSP A;  4ORL A;  1JJ2 2;  1WMN A;  1UGI A;  2A15 A;  1CH0 A;  1K41 A;  6STD A;  1BRN L;  4EC6 A;  5IG0 A;  1OF5 B;  1IT8 A;  1S72 3;  3F9S A;  1YJN 3;  3OXA A;  3D79 A;  2OOV C;  3FLJ A;  2GU3 A;  3DGM A;  1RTU A;  1X1W A;  1RGL A;  3KN4 A;  1Q82 4;  3FGY A;  1Q9E A;  3KSP A;  3VGN A;  3T8N A;  3DZL A;  1ASK A;  4K1U A;  1UI8 A;  2R41 A;  1CQS A;  1OGZ A;  3D9R A;  3HK4 A;  4QWT A;  6GSP A;  5LC6 A;  3ALA A;  3B7C A;  1E3V A;  1SAR A;  4OUQ A;  4LYL B;  5IG3 A;  3CCJ 3;  4BTX A;  2QIY A;  5ELU A;  1CEW I;  3F7X A;  2CFW A;  1TFO A;  4FCZ A;  4R80 A;  4WP5 A;  5EVH A;  2H0G A;  1YIT 3;  1FGT A;  2YFI B;  5AII A;  1W01 A;  5GSP A;  2XSH B;  3WOD G;  2XF3 A;  3CNM A;  1SPU A;  1WNH A;  3S29 A;  2F5M A;  4BIR A;  1TJD A;  1LOV A;  1S5A A;  3ZFZ A;  4IT7 A;  3DGN A;  3QK9 A;  5G1L A;  4EYC A;  1AVL A;  4PEJ A;  4R1K A;  1JBR A;  3GRD A;  4BU4 A;  2XRX B;  1VQL 3;  2E2T A;  1MWS A;  3EE1 A;  3BU4 A;  3E99 A;  4J8T A;  5AIF A;  1A67 A;  1GY6 A;  3GZX B;  3TDG A;  3CCM 3;  1UI7 A;  2CFK A;  1STD A;  4OK0 A;  1DE3 A;  1VQ5 3;  1I3F A;  4HVN A;  5M19 A;  4N6U A;  2W9Q A;  5RNT A;  2HMJ B;  4KFE A;  4U13 A;  4EV5 A;  3PZW A;  4CDL A;  1LOY A;  1OGX A;  2Z76 A;  3UJM A;  2KF4 A;  1RJO A;  4HM2 B;  3T8U A;  4O02 B;  1TU5 A;  1RDS A;  3G16 A;  4NPB A;  4HBR A;  2Y73 A;  2Z77 A;  3CCS 3;  3DGY A;  1GYB A;  3IMA B;  1UUV B;  4MMZ B;  4JF8 A;  1J2B A;  3ZG5 A;  3ER7 A;  4HZ9 B;  5CF1 A;  4K90 B;  2OCT A;  4ZM8 A;  3OV4 A;  3H51 A;  2IUK A;  3DMC A;  1W6Y A;  1BNS A;  1GY7 A;  1DMM A;  3D3L A;  4L8P A;  2OTL 3;  2KF3 A;  3DXO A;  4WHA A;  3EB8 A;  1VQQ A;  4LEH A;  1RNT A;  1BSA A;  2F4Y A;  2K3D A;  1OUN A;  3CNX A;  3G6E 3;  1VQN 3;  3S27 A;  1EQK A;  1RLS A;  2B24 B;  1OHO A;  4XBY A;  3F7S A;  1RCL A;  3AHW A;  3T0U A;  2ZL8 A;  2HMO B;  2UUG C;  3UL5 A;  4CJN A;  1SII A;  3B4O A;  1LNH A;  3I0Y A;  3Q1C A;  2CWV A;  2QGU A;  3V99 A;  1Y4K A;  2RBI A;  2P0X A;  2GBW B;  5LC7 A;  3WA2 X;  4N6M A;  2QA4 3;  2MF7 A;  3SX1 A;  1KD1 4;  4FMD A;  4WYK B;  1FUT A;  3KZT A;  1LRA A;  2GEX A;  3MKI A;  4K1V A;  2QEX 3;  2INX A;  1RMS A;  1DET A;  1GOV A;  1KQS 2;  3WOE B;  3VF1 A;  3PCR A;  1LQG C;  1O7G B;  1PY3 A;  1B21 A;  1CYU A;  2W56 B;  4Q53 A;  1RKY A;  3CCV 3;  1UW1 A;  1C7H A;  3K7C A;  3PXM A;  1JBS A;  3O8Y A;  1IT7 A;  1SIH A;  1A2V A;  1GS3 A;  2F98 A;  5BVB A;  1FYS A;  3URP A;  3WR2 A;  4G1M B;  1E3R A;  1V74 A;  1WMO A;  4OVM A;  1OHS A;  4HM0 B;  1U8C B;  1W02 A;  1M1X B;  1R4C A;  3MWZ A;  5A0O B;  1BRS A;  1LVN A;  2XH9 A;  4NHF A;  2OWP A;  1ZO2 A;  4ILF A;  5IF6 A;  3LYG A;  3EQQ B;  4I5Q A;  1KWI A;  3EBT A;  4R9K A;  3LTC A;  1WQL B;  4XBT A;  2HOH A;  2W0Q A;  3KE7 A;  3NV0 A;  1A2K A;  5AYR B;  2P0M A;  4EXR A;  1N9J A;  2OOV A;  2CFL A;  3LT9 A;  4JRF A;  1RGC A;  1UUG B;  1BU4 A;  3WA3 A;  3A5E A;  4LGQ A;  2IUJ A;  1JN5 A;  1B2S A;  2KRT A;  1GOY A;  3EN1 B;  3LH4 A;  4KFD A;  3PYJ A;  1SJW A;  5ELJ A;  1O7H B;  3CPW 2;  1Q40 B;  3FG3 A;  3SOY A;  3SOA A;  4BTY A;  1VQO 3;  2F56 A;  5M1A A;  1TRP A;  4O8S A;  4WWU C;  1W6G A;  4XDW A;  1X1X A;  3AGO A;  1DYU A;  2PNC A;  3LOY A;  2RSX A;  3GWR A;  3K9M C;  1NB5 I;  3D4A A;  3DY5 A;  4FMA A;  1WMP A;  2OQE C;  4WFO A;  1G0T A;  3GAX A;  2BMR B;  3D5G A;  1W5Z A;  4FMB A;  3X42 A;  3EJV A;  1I70 A;  3I55 3;  3LML A;  4LZI A;  3B8L A;  4L8O A;  5D81 A;  1RHL A;  1RN4 A;  2BIR A;  2SBL A;  3BNE A;  3IPT A;  4FCM A;  1RGH A;  2I9W A;  4XDV A;  1TP6 A;  5AI1 A;  1NNV A;  1OCV A;  1GMQ A;  2UGI A;  2PZV A;  1MGW A;  4GSP A;  3H3H A;  3F8X A;  1I0V A;  1NDO B;  1FA3 A;  1JNQ A;  1N8R 4;  1GSP A;  4N6L A;  2RCD A;  3KSE D;  4R9L A;  3Q3F A;  3A76 A;  1O7M B;  3F40 A;  1QAF A;  2H0H A;  3DH2 A;  4STD A;  1MOL A;  1BAN A;  2D42 A;  3RGA A;  1QVF 2;  3MSO A;  5AEW B;  3N8B A;  5EEO A;  1MWT A;  2XFT A;  1ZGX A;  1TFK A;  1BGS A;  3GZB A;  2HML B;  3WOF B;  5KP4 A;  2FNQ A;  2XEP A;  2XFS A;  5D83 A;  3ROB A;  5I97 A;  2WGQ A;  1FUS A;  2H0I A;  2KF6 A;  1IVW A;  2MC8 A;  1I2E A;  1B2Z A;  1B2U A;  1VQK 3;  1K73 4;  1O7W B;  4NRE A;  4LSO A;  4H61 A;  2BHM A;  1JRQ A;  4X2O A;  2CH9 A;  5IG5 A;  3NM7 A;  2K0M A;  2BO9 B;  5HGR A;  3CD6 3;  3X3Z A;  3AMO A;  3JVC A;  1BNI A;  3BND A;  2WOH A;  1EKM A;  2JDI H;  3RGR A;  2CX1 A;  2SAR A;  1HZ1 A;  2WGO A;  1I0X A;  1TTO A;  3HX8 A;  1DMQ A;  1EEJ A;  2LQV A;  1NO3 A;  2AAE A;  3VSY A;  1FZU A;  1STF I;  2AAD A;  3X40 A;  2GSP A;  3B4P A;  4GHO A;  1WTH A;  2IMJ A;  4WYK A;  1VQ6 3;  3WMD A;  3EC9 A;  3CC4 3;  4RNT A;  1IV7 A;  2YFL B;  8CHO A;  1B2X A;  2O9U X;  1N8Q A;  1RN7 A;  1UCL A;  1AY7 A;  5FW5 A;  4J5G A;  3CPO A;  1NB3 I;  3DGO A;  1MNL A;  2R4I A;  3X3Y A;  1W2B 2;  1JKG A;  4BTW A;  4HM4 B;  3LTD A;  2CC3 A;  1PFP A;  2WOF A;  3G0K A;  4HM5 B;  3KII A;  4H3U A;  4CPK A;  2M7O A;  2E2V A;  1V57 A;  3ECF A;  3FZW A;  1U5O A;  2Z7A A;  4XB5 A;  1N9E A;  3WHO A;  1JB2 A;  1PYL A;  2BNG A;  2K54 A;  2CWU A;  5D82 A;  2P38 A;  1V58 A;  3JUM A;  2O3O A;  3GZR A;  1QVG 2;  1UDI I;  2GEY A;  4AEQ A;  1VQ9 3;  4TX4 A;  4XBX A;  3MPH A;  2W03 A;  4N6T A;  1YI2 3;  3BLZ A;  4MEI A;  2GU1 A;  3X3X A;  3M8C A;  4AKY A;  1N5H A;  1RGE A;  3JUO A;  2W2C A;  3QRD A;  2CK3 H;  1T2H A;  3V92 A;  1YGE A;  1AQZ A;  3NM2 A;  1GD4 A;  2CG0 A;  1BSD A;  2Q07 A;  1ULI B;  4N3V A;  1YNV X;  1E97 A;  3RNT A;  3FF0 A;  1EG9 B;  5KP1 A;  2W9P A;  3S28 A;  1BRI A;  4KZ1 A;  2C10 A;  2CX0 A;  2FXT A;  7RNT A;  1QMA A;  1D6U A;  2BT3 A;  1TRQ A;  2YX9 A;  3FG1 A;  3GZY B;  2ZA4 A;  3OX9 A;  1OF5 A;  3BNB A;  3DUK A;  3N9H A;  4GB5 A;  5G2G A;  1G02 A;  1NJI 4;  1ROA A;  2RGQ A;  4RNZ A;  2OQE A;  2Z6B A;  1FUW A;  2HMM B;  1IK3 A;  2ZHX B;  1GMR A;  1FGO A;  1RN1 A;  1BNG A;  2F99 A;  1AV4 A;  2KCD A;  3MHE A;  4HM8 B;  1LQM B;  1OH0 A;  3KKG A;  2J8X B;  6RNT A;  5G1K A;  3EF8 A;  5HOH A;  2IA7 A;  1NWW A;  2BMO B;  1TUH A;  4RNY A;  3LT8 A;  1AR0 A;  1RRL A;  3CCQ 3;  1Q7H A;  1JBT A;  3SLU A;  3SED A;  1DVD A;  7STD A;  1W4N A;  3I56 3;  5CLK A;  1R4Y A;  1BRJ A;  3OW2 2;  3HI7 A;  1B2M A;  1PU4 A;  3JUP A;  3CCR 3;  3UB1 A;  5JPU A;  1QAL A;  2W04 A;  1UUW B;  1BRK A;  5IW9 A;  1BVI A;  2OTJ 3;  2D1W A;  3NBB A;  1BNE A;  4HKV B;  1Q7Y 4;  1W2Z A;  4J9A A;  3ZG0 A;  1Q81 4;  1IVV A;  1EUI C;  1HU9 A;  1BNF A;  2GXF A;  2IYJ A;  1IDP A;  4L7K A;  2XR8 B;  4N6O B;  2CFD A;  3LZA A;  1Z1S A;  3CCU 3;  4HZB B;  5CXO A;  1L5G B;  3JUQ A;  1IVU A;  2CWT A;  4HM3 B;  3F14 A;  1F8N A;  1ZX2 A;  1T5Y A;  2E2U A;  1VQ4 3;  3K0Z A;  1BSB A;  3MG1 A;  3NV0 B;  1B20 A;  1LXE A;  2BMQ B;  3OWU A;  2F5W A;  2IY2 A;  1O7P B;  3FCS B;  4MJD A;  3S67 A;  4IIA A;  2CFG A;  1YHQ 3;  5IER A;  4KT3 B;  1VQM 3;  2C4B A;  1BSC A;  3EHC A;  4EBG A;  1AVK A;  5BU4 A;  1JN5 B;  1BRG A;  1BNJ A;  3V98 A;  1CYV A;  4EW5 A;  1O7N B;  3BNC A;  1VQ7 3;  1YJW 3;  1JV2 B;  3G8Z A;  5IEP A;  3MG2 A;  3CC2 3;  1UCK A;  8RNT A;  1FGQ A;  3FG4 A;  5CK6 A;  3G4S 3;  1JZO A;  3UL6 A;  5JBS A;  3PCS A;  3LTB A;  1GMP A;  1I3I A;  3NQZ A;  2WO0 A;  1MWR A;  1BOX A;  1YVS A;  2BU4 A;  3FH1 A;  4HYZ A;  3OWY A;  1K8A 4;  1FGR A;  5IEN A;  1T2I A;  5BXQ A;  3AGN A;  1LOX A;  2GBX B;  3SYU A;  3JUN A;  1RCK A;  3CME 3;  1W7C A;  5TGN A;  5AIG A;  1UCJ A;  2STD A;  3RDE A;  2YFJ B;  7GSP A;  3IJE B;  1ZS7 A;  4BL2 A;  5STD A;  2ML6 A;  4HJL B;  5AYS C;  1BNR A;  4O3V A;  3U97 A;  4K61 A;  2HMN B;  2P05 A;  1IV9 A;  3HII A;  1RGA A;  1QAK A;  1VZZ A;  3NUV A;  4HAA A;  5DRV A;  2L4V A;  5BIR A;  1K9M 4;  3K63 A;  1M1K 4;  1HKX A;  1OPY A;  3U1W A;  1M90 4;  2XSO B;  1OHP A;  2CIU A;  3STD A;  3MYT A;  3PS8 A;  1EA2 A;  1NU3 A;  3NHX A;  1DMN A;  1QJG A;  2W56 A;  1IYY A;  1A90 A;  1RSN A;  3PGB A;  2ZDJ A;  3EX9 A;  4HOH A;  4XM4 A;  4O2H A;  4RBN A;  2L1S A;  3EBY A;  1YIJ 3;  1RGF A;  1UCI A;  4FMC A;  5M18 A;  4X2H A;  1JB5 A;  5CF2 A;  4R4K A;  1Q86 4;  2CKF B;  3SVA A;  1BRH A;  1DVC A;  3BIR A;  3FSD A;  3HIG A;  4RZM A;  3K5T A;  1UGH I;  3Q90 A;  9RNT A;  3J7Y d;  2KF5 A;  5EQL A;  3EN8 A;  3S5C A;  1YGW A;  3FKA A;  3AMO B;  3D5I A;  1T3B A;  2KAA A;  5IEO A;  4CCV A;  1US1 A;  1Q42 A;  3SXX A;  1X1U A;  3F8H A;  4DKI A;  1MWU A;  2CW9 A;  1D6Z A;  3L0R A;  2F86 B;  2KXG A;  1A2P A;  4BL3 A;  1HYF A;  1I8V A;  3NBR A;  1X1Y A;  1ISK A;  5AEU B;  1BIR A;  5KP3 A;  3KCH A;  1LNI A;  3LXU X;  3UNL A;  1Q40 A;  1D6Y A;  2P09 A;  4AKZ A;  4J5K A;  2CG1 A;  1GY5 A;  2ML5 A;  4HM1 B;  1IQY A;  1RGK A;  2XGN A;  3CCE 3;  1ULJ B;  1B3S A;  1GD3 A;  3X41 A;  2RFR A;  3BB9 A;  4MMY B;  2LYX A;  3LTA A;  1RGG A;  3NQY A; 
#chains in the Genus database with same CATH homology
 1N5P A;  3HZP A;  2W6J H;  3DGL A;  5AIH A;  1FGM A;  1JKG B;  3WDG B;  4GL6 A;  1IU7 A;  4N6V 0;  4EV2 A;  4IPB A;  5FGO A;  1ROV A;  4N6N B;  3CC7 3;  3MG3 A;  4MMX B;  1VQP 3;  3CMA 3;  1YVB I;  1K28 A;  2XGL A;  1IVX A;  1IQ8 A;  1M9G A;  2UX0 A;  3OWS A;  3NX0 A;  3CXC 2;  1VQ8 3;  3NBJ A;  3N54 B;  3KFQ C;  1KC8 4;  2Y74 A;  1W00 A;  3G71 3;  1BUQ A;  2V1L A;  5DRE A;  2JQ5 A;  1TIJ A;  4FCJ A;  3FF2 A;  4I4K A;  4HM7 B;  4LMI A;  2C11 A;  4KFF A;  3Q2P A;  4HM6 B;  5IG4 A;  1JB4 A;  1W6C A;  1RRH A;  1KSI A;  1YJ9 3;  1IQX A;  1SQW A;  2CHC A;  2B1X B;  5JPP A;  2FGT A;  3CU3 A;  1G96 A;  4FR9 A;  2HMK B;  4KVH A;  3NXJ A;  3DM8 A;  1OAC A;  3CCL 3;  4ORL A;  1JJ2 2;  1WMN A;  2A15 A;  1K41 A;  6STD A;  4EC6 A;  5IG0 A;  1OF5 B;  1IT8 A;  1S72 3;  3F9S A;  1YJN 3;  3OXA A;  2OOV C;  3FLJ A;  2GU3 A;  3DGM A;  3KN4 A;  3FGY A;  3KSP A;  3VGN A;  3T8N A;  3DZL A;  1ASK A;  4K1U A;  1UI8 A;  1CQS A;  1OGZ A;  3D9R A;  3HK4 A;  4QWT A;  5LC6 A;  3ALA A;  3B7C A;  1E3V A;  4OUQ A;  5IG3 A;  3CCJ 3;  4BTX A;  2QIY A;  5ELU A;  1CEW I;  3F7X A;  2CFW A;  1TFO A;  4FCZ A;  4R80 A;  4WP5 A;  5EVH A;  1YIT 3;  1FGT A;  2YFI B;  5AII A;  1W01 A;  3WOD G;  2XSH B;  2XF3 A;  3CNM A;  1SPU A;  1WNH A;  3S29 A;  1S5A A;  4IT7 A;  3DGN A;  3QK9 A;  4EYC A;  1AVL A;  4PEJ A;  4R1K A;  3GRD A;  2XRX B;  1VQL 3;  2E2T A;  3EE1 A;  3E99 A;  4J8T A;  5AIF A;  1A67 A;  1GY6 A;  3GZX B;  3TDG A;  3CCM 3;  1UI7 A;  2CFK A;  1STD A;  4OK0 A;  1VQ5 3;  4HVN A;  4N6U A;  2W9Q A;  2HMJ B;  4KFE A;  4U13 A;  4EV5 A;  3PZW A;  4CDL A;  1OGX A;  2Z76 A;  3UJM A;  4HM2 B;  1RJO A;  3T8U A;  4O02 B;  1TU5 A;  3G16 A;  4HBR A;  2Y73 A;  2Z77 A;  3CCS 3;  1GYB A;  3IMA B;  1UUV B;  4MMZ B;  4JF8 A;  1J2B A;  3ER7 A;  4HZ9 B;  5CF1 A;  4K90 B;  2OCT A;  4ZM8 A;  3OV4 A;  3H51 A;  2IUK A;  3DMC A;  1W6Y A;  1GY7 A;  1DMM A;  3D3L A;  4L8P A;  2OTL 3;  3DXO A;  4WHA A;  3EB8 A;  4LEH A;  1VQN 3;  1OUN A;  3CNX A;  3G6E 3;  3S27 A;  1EQK A;  2B24 B;  1OHO A;  4XBY A;  3F7S A;  3T0U A;  2ZL8 A;  2HMO B;  3UL5 A;  1SII A;  3B4O A;  1LNH A;  3I0Y A;  3Q1C A;  2CWV A;  2QGU A;  3V99 A;  1Y4K A;  2P0X A;  2GBW B;  5LC7 A;  3WA2 X;  4N6M A;  2QA4 3;  2MF7 A;  3SX1 A;  1KD1 4;  4FMD A;  4WYK B;  3KZT A;  2GEX A;  3MKI A;  4K1V A;  2QEX 3;  2INX A;  1KQS 2;  3WOE B;  3VF1 A;  3PCR A;  1O7G B;  1CYU A;  2W56 B;  4Q53 A;  1RKY A;  3CCV 3;  1UW1 A;  1C7H A;  3K7C A;  3PXM A;  3O8Y A;  1IT7 A;  1SIH A;  1A2V A;  1GS3 A;  2F98 A;  5BVB A;  4G1M B;  1E3R A;  1V74 A;  1WMO A;  4OVM A;  1OHS A;  4HM0 B;  1U8C B;  1W02 A;  1M1X B;  1R4C A;  3MWZ A;  5A0O B;  1LVN A;  2XH9 A;  4NHF A;  2OWP A;  1ZO2 A;  5IF6 A;  3LYG A;  3EQQ B;  1Q82 4;  1KWI A;  3EBT A;  4R9K A;  3LTC A;  1WQL B;  4XBT A;  2W0Q A;  3KE7 A;  3NV0 A;  1A2K A;  5AYR B;  2P0M A;  4EXR A;  1N9J A;  2OOV A;  2CFL A;  3LT9 A;  4JRF A;  3WA3 A;  4LGQ A;  2IUJ A;  1JN5 A;  3EN1 B;  2KRT A;  3LH4 A;  4KFD A;  3PYJ A;  1SJW A;  5ELJ A;  1O7H B;  3CPW 2;  1Q40 B;  3FG3 A;  3SOY A;  3SOA A;  4BTY A;  1VQO 3;  4O8S A;  4WWU C;  1W6G A;  4XDW A;  1DYU A;  2PNC A;  3LOY A;  2RSX A;  3GWR A;  3K9M C;  1NB5 I;  3DY5 A;  4FMA A;  1WMP A;  2OQE C;  4WFO A;  3GAX A;  2BMR B;  1W5Z A;  4FMB A;  3X42 A;  3EJV A;  3I55 3;  3LML A;  4LZI A;  3B8L A;  4L8O A;  5D81 A;  2SBL A;  3BNE A;  3IPT A;  4FCM A;  2I9W A;  4XDV A;  1TP6 A;  5AI1 A;  1OCV A;  2PZV A;  3H3H A;  3F8X A;  1NDO B;  1JNQ A;  1N8R 4;  4N6L A;  2RCD A;  3KSE D;  4R9L A;  3A76 A;  1O7M B;  3F40 A;  1QAF A;  4STD A;  3RGA A;  1QVF 2;  1MOL A;  2D42 A;  1FA3 A;  3MSO A;  5AEW B;  3N8B A;  5EEO A;  2XFT A;  1TFK A;  3GZB A;  5KP4 A;  2HML B;  3WOF B;  2FNQ A;  2XEP A;  2XFS A;  5D83 A;  3ROB A;  5I97 A;  2WGQ A;  1IVW A;  2MC8 A;  1K73 4;  1VQK 3;  1O7W B;  4NRE A;  4LSO A;  4H61 A;  2BHM A;  1JRQ A;  4X2O A;  2CH9 A;  5IG5 A;  3NM7 A;  2K0M A;  2BO9 B;  5HGR A;  3CD6 3;  3X3Z A;  3AMO A;  3JVC A;  3BND A;  2WOH A;  1EKM A;  2JDI H;  3RGR A;  2WGO A;  3HX8 A;  1DMQ A;  2LQV A;  1NO3 A;  3VSY A;  1STF I;  3X40 A;  3B4P A;  1WTH A;  2IMJ A;  4WYK A;  1VQ6 3;  3WMD A;  3EC9 A;  3CC4 3;  1IV7 A;  2YFL B;  8CHO A;  2O9U X;  1N8Q A;  1RN7 A;  5FW5 A;  3CPO A;  1NB3 I;  3DGO A;  1MNL A;  2R4I A;  3X3Y A;  1W2B 2;  1JKG A;  4BTW A;  4HM4 B;  3LTD A;  2CC3 A;  1PFP A;  2WOF A;  3G0K A;  4HM5 B;  3KII A;  4H3U A;  2M7O A;  2E2V A;  3ECF A;  3FZW A;  1U5O A;  2Z7A A;  4XB5 A;  1N9E A;  1JB2 A;  2BNG A;  2K54 A;  2CWU A;  5D82 A;  2P38 A;  3JUM A;  1VQ9 3;  2O3O A;  3GZR A;  1QVG 2;  2GEY A;  4AEQ A;  4TX4 A;  4XBX A;  3MPH A;  2W03 A;  4N6T A;  1YI2 3;  3BLZ A;  4MEI A;  2GU1 A;  3X3X A;  3M8C A;  4AKY A;  1N5H A;  3JUO A;  2W2C A;  3QRD A;  2CK3 H;  3V92 A;  1YGE A;  3NM2 A;  1GD4 A;  2CG0 A;  2Q07 A;  1ULI B;  4N3V A;  1E97 A;  3FF0 A;  1EG9 B;  5KP1 A;  2W9P A;  3S28 A;  4KZ1 A;  2C10 A;  2FXT A;  1QMA A;  1D6U A;  2BT3 A;  2YX9 A;  3FG1 A;  3GZY B;  3OX9 A;  1OF5 A;  3BNB A;  3DUK A;  3N9H A;  4GB5 A;  5G2G A;  1NJI 4;  1ROA A;  2RGQ A;  4RNZ A;  2OQE A;  2Z6B A;  1FUW A;  2HMM B;  1IK3 A;  1FGO A;  2F99 A;  2KCD A;  4HM8 B;  1AV4 A;  3MHE A;  1OH0 A;  3KKG A;  3EF8 A;  2IA7 A;  1NWW A;  2BMO B;  1TUH A;  4RNY A;  3LT8 A;  1AR0 A;  1RRL A;  3CCQ 3;  3SLU A;  3SED A;  1DVD A;  7STD A;  1W4N A;  3I56 3;  5CLK A;  3OW2 2;  3HI7 A;  1PU4 A;  3JUP A;  3CCR 3;  3UB1 A;  5JPU A;  1QAL A;  2W04 A;  1UUW B;  5IW9 A;  2OTJ 3;  2D1W A;  3NBB A;  4HKV B;  1Q7Y 4;  1W2Z A;  4J9A A;  1Q81 4;  1IVV A;  1HU9 A;  2GXF A;  1IDP A;  4L7K A;  2XR8 B;  4N6O B;  2CFD A;  3LZA A;  1Z1S A;  3CCU 3;  4HZB B;  5CXO A;  1L5G B;  3JUQ A;  1IVU A;  2CWT A;  4HM3 B;  3F14 A;  1F8N A;  1ZX2 A;  1T5Y A;  2E2U A;  1VQ4 3;  3K0Z A;  3MG1 A;  3NV0 B;  1LXE A;  2BMQ B;  3OWU A;  3S67 A;  3FCS B;  1O7P B;  4MJD A;  4IIA A;  2CFG A;  1YHQ 3;  5IER A;  1VQM 3;  3EHC A;  4EBG A;  1AVK A;  1JN5 B;  3V98 A;  1CYV A;  1O7N B;  3BNC A;  1VQ7 3;  1YJW 3;  1JV2 B;  3G8Z A;  5IEP A;  3MG2 A;  3CC2 3;  1FGQ A;  3FG4 A;  5CK6 A;  3G4S 3;  3UL6 A;  5JBS A;  3PCS A;  3LTB A;  3NQZ A;  2WO0 A;  3FH1 A;  4HYZ A;  3OWY A;  1K8A 4;  1FGR A;  5IEN A;  5BXQ A;  1LOX A;  2GBX B;  3JUN A;  3CME 3;  1W7C A;  5TGN A;  5AIG A;  2STD A;  3RDE A;  2YFJ B;  3IJE B;  5STD A;  2ML6 A;  4HJL B;  5AYS C;  4O3V A;  3U97 A;  4K61 A;  2HMN B;  2P05 A;  1IV9 A;  3HII A;  1VZZ A;  1QAK A;  3NUV A;  1K9M 4;  5DRV A;  2L4V A;  3K63 A;  1M1K 4;  1HKX A;  1OPY A;  3U1W A;  1M90 4;  2XSO B;  1OHP A;  2CIU A;  3STD A;  3MYT A;  3PS8 A;  1EA2 A;  1NU3 A;  3NHX A;  1DMN A;  1QJG A;  2W56 A;  1A90 A;  3PGB A;  2ZDJ A;  3EX9 A;  4XM4 A;  4O2H A;  4RBN A;  3EBY A;  1YIJ 3;  4FMC A;  4X2H A;  1JB5 A;  5CF2 A;  4R4K A;  1Q86 4;  2CKF B;  3SVA A;  1DVC A;  3HIG A;  4RZM A;  3FSD A;  3K5T A;  3Q90 A;  3J7Y d;  5EQL A;  3EN8 A;  3S5C A;  3FKA A;  3AMO B;  5IEO A;  4CCV A;  1US1 A;  1Q42 A;  3SXX A;  3F8H A;  2CW9 A;  1D6Z A;  3L0R A;  2F86 B;  2KXG A;  3NBR A;  1ISK A;  5AEU B;  5KP3 A;  3LXU X;  3UNL A;  1Q40 A;  1D6Y A;  2P09 A;  4AKZ A;  2CG1 A;  1GY5 A;  2ML5 A;  4HM1 B;  1IQY A;  2XGN A;  3CCE 3;  1ULJ B;  1GD3 A;  3X41 A;  2RFR A;  3BB9 A;  4MMY B;  2LYX A;  3LTA A;  3NQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...