3CCL3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccl300
1YIT3 3CCL3 1Q864 1VQ53 1K734 3G6E3 1VQO3 3CCQ3 3CC73 1YIJ3 1W2B2 2OTL3 1YJW3 1JJ22 1KQS2 1YJ93 1YI23 3CME3 3I553 3CCS3 3G713 1YJN3 1Q814 1VQ73 1VQ43 3CC43 1VQN3 1S723 1K8A4 1VQM3 1VQ93 1KD14 3I563 2OTJ3 1YHQ3 1Q7Y4 2QEX3 3CCJ3 3CXC2 1VQL3 3CPW2 3CC23 3CCR3 1Q824 3CD63 3CCM3 3G4S3 3CMA3 1M904 1VQP3 1VQ83 1KC84 1QVF2 3OW22 3CCU3 2QA43 1NJI4 1M1K4 3CCE3 1VQK3 1K9M4 1QVG2 1VQ63 1N8R4 3CCV3
chains in the Genus database with same CATH superfamily
1BANA 1RN7A 2IA7A 1W6CA 1IQYA 1GY6A 1SIHA 1RNBA 2K3DA 1BOXA 1ROVA 4FCZA 3A5EA 1UCJA 1UI7A 1IV9A 3HOHA 1VQ43 2K54A 1DE3A 3U97A 1LRAA 3DGMA 1IT7A 3FH1A 1BRKA 1GYBA 2OTJ3 1A2KA 3HIIA 2L1SA 3NV0B 4FMCA 4FR9A 2AADA 3B8LA 3NXJA 1FUWA 3SVAA 5BU4A 2ZL8A 3K0ZA 2ML6A 4IT7A 3JVCA 2IY2A 1K41A 3M8CA 1QVF2 2XRXB 3KZTA 1C7HA 3AHWA 2H0HA 1FW7A 2HMMB 4TX4A 1K9M4 3NM7A 3EHCA 3KIIA 1DYUA 2XFSA 4J5GA 5LC7A 1DVDA 2OTL3 1PU4A 2HMLB 5EEOA 1JB4A 1YJ93 1G96A 1V57A 4WP5A 3CCS3 1M9GA 3NBJA 3KFQC 1HYFA 4HM7B 3EBYA 3G713 1FGTA 7RNTA 1RGKA 2R4IA 1U5OA 3K7CA 4HBRA 2ZDJA 1K28A 5IG3A 1MWSA 7GSPA 1TP6A 2CG1A 2HOHA 3UL6A 8CHOA 1IVWA 3PS8A 1LNHA 3GWRA 2BHMA 2OOVC 3QRDA 1OPYA 2W9QA 4FMAA 4XBXA 3VGNA 1LNIA 4RNZA 1RN1A 1FGRA 3X42A 4LZIA 4EC6A 1Z1SA 1BRNL 3PXMA 2F98A 4EW5A 1NO3A 1RDSA 2OCTA 4HZBB 3UJMA 1I0VA 2HMNB 5CLKA 1I2EA 2XF3A 2D1WA 3DY5A 1G0TA 1B3SA 1BSAA 3D5IA 5IENA 5IG5A 1VQL3 5IERA 1NWWA 4GHOA 3ALAA 3T0UA 3EN8A 2KF3A 3BU4A 1E97A 2XGLA 3HK4A 4HJLB 4HM3B 4HM8B 3OWSA 5CXOA 3S5CA 3T8UA 3FGYA 4GB5A 3RNTA 3GAXA 1IVVA 1T5YA 2KAAA 1FGOA 1OHOA 4GL6A 3V99A 4KFFA 3IJEB 2ZHXB 5AIGA 1SQWA 3GZXB 5IEOA 2RFRA 1K734 1IVXA 1AV4A 4MEIA 2F4YA 2CWVA 1AQZA 3A76A 4EV2A 3LTDA 1UGHI 3WMDA 1EUIC 2W56B 4LGQA 1FZUA 5KP3A 4HAAA 1CYUA 2STDA 2FNQA 3PZWA 1KWIA 3SXXA 3UNLA 5D82A 7STDA 5D83A 1UUWB 3MKIA 4L8PA 3HZPA 1PFPA 1FA3A 1OF5A 2GEYA 3X3ZA 1RKYA 2Y73A 2IYJA 3LOYA 5M1AA 1N5HA 1BSEA 1O7MB 2CH9A 2M7OA 2CFKA 1JV2B 2AAEA 3I0YA 3LZAA 2UX0A 1I2FA 2O3OA 3MWZA 4ILFA 1SARA 2UGIA 2IUKA 1YI23 3CME3 3BNBA 4FMDA 5EVHA 1N8QA 1OUNA 3F8XA 4N6MA 4AKZA 4EXRA 1BNJA 3CPOA 4XDWA 1VQ93 4N6V0 4WYKA 1V74A 4X2HA 2L4VA 1IT8A 1ULJB 2CWTA 3CNMA 4KZ1A 2F99A 2HMJB 4MJDA 5HGRA 3S27A 1ZX2A 5KP4A 2JDIH 3BLZA 3LH4A 2QIYA 2GXFA 4CDLA 1R4YA 2MC8A 3X3XA 1BSBA 1RN4A 3T8NA 3MYTA 1M1K4 2CC3A 1TFKA 3LMLA 3CCE3 2IMJA 1FGMA 2FGTA 4LYLB 2INXA 8RNTA 5HOHA 1YIT3 3PCRA 1BUQA 1UCIA 4OUQA 3SX1A 1A2PA 1VQO3 1Q9EA 3CC73 2YFLB 2OOVA 3K63A 1KQS2 1UI8A 1CH0A 1AVLA 5M19A 4WWUC 1UUVB 2V1LA 3H3HA 5G1LA 5LC6A 2GBXB 1BNSA 1IDPA 3AGNA 3EE1A 5I97A 1IV7A 1T3BA 1VQQA 2XGNA 3WHOA 3WOEB 5CF1A 3DGNA 2RNTA 4DKIA 1AVKA 2C11A 1W7CA 2WGOA 3G0KA 2K0MA 1OCVA 5CF2A 1C54A 1TU5A 2JQ5A 1B2UA 4CPKA 1BU4A 5IG0A 1X1XA 3NM2A 2CFDA 4NPBA 3RGAA 3B4OA 1SJWA 4HM5B 1B20A 1GD4A 3DZLA 3EN1B 1LOYA 3MSOA 1D6YA 1TJDA 2CX0A 2XEPA 1RGLA 1UGIA 3WA3A 1ROAA 2OQEC 5STDA 3EX9A 1LQGC 2RSXA 5AEWB 1B21A 1QJGA 1WTHA 2LYXA 5A0OB 1W2B2 1O7WB 1UUGB 2WOHA 3OX9A 2LQVA 1YJW3 2CKFB 3K5TA 1WMNA 3FF2A 3HX8A 3S28A 2SBLA 3HI7A 1JB2A 1X1WA 3AHSA 1VQM3 1PYLA 1WQLB 3H51A 4L8OA 2RCDA 2QEX3 1MWTA 1RGHA 2BMQB 2RBIA 3ECFA 3F7SA 3GZRA 4KFDA 3CPW2 1RNTA 4HM4B 1MGWA 1NNVA 1HKXA 2W03A 1RTUA 1L5GB 4ZM8A 2BMOB 3EB8A 5M18A 2Y74A 3CCM3 1UW1A 4N3VA 3URPA 1KC84 4KVHA 2F86B 1UCKA 3OXAA 1YNVX 1NJI4 1Q7Y4 1STDA 1W5ZA 4IPBA 1WMPA 3Q1CA 1E3VA 2KCDA 3B4PA 3F14A 2B1XB 1HU9A 3D5GA 1JKGA 3ROBA 6STDA 3VF1A 1OHPA 2P05A 1VZZA 4K1UA 1MWRA 3FLJA 4LEHA 3Q2PA 4N6OB 2ZA4A 1IYYA 1DMNA 5GSPA 1BRIA 1ZGXA 3K9MC 3D79A 1GMPA 4KT3B 1OGZA 4LSOA 4XBYA 3S29A 3CCR3 4BL3A 3BNCA 1MOLA 2YFIB 1RSNA 3SYUA 4AKYA 4HM1B 2CIUA 4XDVA 4N6UA 1VQP3 1N5PA 1O7NB 4QWTA 2QA43 1EA2A 3MG2A 3MG3A 6GSPA 4EV5A 1I0XA 4HM6B 3WOFB 2OWPA 2W2CA 1BRGA 1RRHA 1RHLA 2W04A 2Q07A 5DREA 1VQ53 1BSDA 2F5WA 4BL2A 1YIJ3 3X41A 3X3YA 4FCMA 3F8HA 1WMOA 2YX9A 2RGQA 1RLSA 1K8A4 2J8XB 1I8VA 1JBTA 5IW9A 4KFEA 3HIGA 1TFOA 1OF5B 3NBBA 1IK3A 3DMCA 2F5MA 3BNDA 4R80A 1G02A 3Q90A 4EBGA 2Z76A 1F8NA 1ASKA 2H0GA 4HM2B 2BT3A 3SLUA 3DUKA 4RNTA 4XB5A 2ML5A 1BNEA 4J9AA 2BNGA 1RCLA 1X1UA 2D42A 4WYKB 3SOAA 1D6UA 1IU7A 1OH0A 2GEXA 3UB1A 3L0RA 1VQN3 1QMAA 3BB9A 1GSPA 1W02A 1Q40A 1B2MA 3MG1A 2CFLA 3N8BA 4X2OA 5BVBA 2KRTA 1GOYA 5IEPA 2H0IA 3CD63 1DMQA 1FYSA 4HM0B 2KF6A 1LOVA 3NHXA 1W00A 1QALA 1RCKA 5ELJA 3BIRA 1W6YA 3OW22 4FMBA 3NX0A 2KXGA 2CX1A 3WDGB 1BNRA 2CFWA 3DGOA 3DXOA 3AMOA 3F7XA 3DGLA 3CCV3 4PEJA 3BNEA 3QK9A 2BIRA 3ZG0A 5G1KA 3ZFZA 1RJOA 1US1A 1TUHA 1PY3A 3D9RA 3CU3A 1AY7A 4N6TA 3TDGA 3U1WA 1O7GB 1R4CA 1SIIA 2PNCA 1YJN3 3FKAA 1MGRA 1AR0A 2E2TA 3B7CA 3DH2A 4RNYA 1JBSA 2GBWB 3LTBA 5DRVA 3LT8A 1CEWI 2F56A 5AYRB 1EQKA 2WO0A 1B2XA 1Q42A 4H61A 3EC9A 1VQ83 1GMRA 1N9JA 3J7Yd 3CCU3 1LOXA 1M1XB 3LYGA 1RGCA 1RMSA 2SARA 1D6ZA 2Z77A 4GSPA 4O8SA 5JBSA 2W6JH 1GS3A 1GOUA 3CNXA 4H3UA 4XBTA 1BAOA 5CK6A 3STDA 4O02B 1N8R4 1NB5I 1Q864 4EYCA 3CCQ3 1JNQA 3EF8A 1JJ22 1JRQA 4RZMA 3WA2X 1W2ZA 3I553 3V98A 4WFOA 3IPTA 5JPUA 3GZYB 1SPUA 1S723 3X40A 1A67A 1FGQA 2B24B 1EEJA 1CQSA 1LOWA 4IIAA 3CC23 1HZ1A 3FG3A 1B27A 1JB5A 1IQ8A 3KN4A 1BNGA 1YVSA 2CK3H 4MMXB 3RGRA 4K61A 5AIHA 3NV0A 1GY5A 1S5AA 2HMOB 2UUGC 4BTYA 1MNLA 3LTAA 3N9HA 1JKGB 2YFJB 2A15A 1JZOA 5AI1A 3RDEA 1W6GA 5TGNA 1VQ63 1YGWA 2GU1A 5FW5A 4CCVA 1CYVA 2BO9B 2XR8B 1UDII 2QGUA 4K90B 3PCSA 4L7KA 3FG1A 1BSCA 1LXEA 1I2GA 5BIRA 2C10A 3ER7A 1V58A 1UCLA 1ZS7A 4NHFA 4O3VA 4JRFA 1KD14 3IMAB 1OHSA 3OWUA 1T2HA 3OV4A 4ORLA 4FCJA 1BNIA 3FZWA 4HYZA 1BIRA 1BVIA 3AGOA 3FCSB 5G2GA 2P0XA 1BRHA 4N6NB 4BU4A 1M904 1GOVA 2P38A 4CJNA 3WODG 3GZBA 3PYJA 3SOYA 2CWUA 4JF8A 1OACA 2XSOB 4AEQA 1QVG2 3FG4A 3KCHA 1GY7A 3D4AA 1BGSA 5JPPA 1FUTA 2CFGA 1FUSA 1IQXA 3KSED 4OK0A 4NREA 2W9PA 4I4KA 1T2IA 1VQ73 1Q814 3G8ZA 1LVNA 1WNHA 3GSPA 1A2VA 2O9UX 4J8TA 2I9WA 4STDA 9RNTA 3CCJ3 3CXC2 3Q3FA 3F40A 3UL5A 5IG4A 3MHEA 4Q53A 1Q824 3NQYA 3NUVA 3G4S3 3VSYA 4O2HA 1RRLA 1GD3A 4MMYB 3CMA3 2P09A 1BRSA 3E99A 2PZVA 3FSDA 2BMRB 1I3IA 1NU3A 1A90A 1DVCA 1Q7HA 1W4NA 3O8YA 4HKVB 1O7HB 4K1VA 2E2UA 1BNFA 5AYSC 4BIRA 3OWYA 4R4KA 1RGEA 4I5QA 4XM4A 2WGQA 1OGXA 1EG9B 3EQQB 3CCL3 1LQMB 5FGOA 3EBTA 1Q40B 1X1YA 3V92A 1TTOA 1IVUA 5BXQA 3PGBA 1ISKA 4WHAA 4BTWA 5AIFA 2IUJA 1I70A 4U13A 3JUQA 5KP1A 1YGEA 1U8CB 3D3LA 1RGGA 2OQEA 1N9EA 1QAFA 2CHCA 2XH9A 3LT9A 1RGAA 1O7PB 1YVBI 2W56A 3LTCA 5D81A 1J2BA 4MMZB 3AMOB 3NBRA 2XSHB 4N6LA 1JZDA 2R41A 3KSPA 4J5KA 4HOHA 4HZ9B 1MWUA 2KF4A 2C4BA 2Z6BA 3NQZA 3SEDA 3ZG5A 3DGYA 1QAKA 3KE7A 3KKGA 3S67A 1BUJA 5EQLA 1I3FA 1ZO2A 2KF5A 1RGFA 3G16A 3G6E3 3MPHA 3GRDA 1E3RA 1NB3I 2WOFA 2XFTA 2BU4A 3FF0A 3JUOA 4G1MB 3EJVA 3JUPA 2FXTA 1EKMA 3CC43 2CG0A 2GSPA 5IF6A 2GU3A 5RNTA 4R9LA 2E2VA 2Z7AA 3I563 1JN5B 4HVNA 2MF7A 1GMQA 1NDOB 1W01A 1YHQ3 3JUMA 1DETA 1ULIB 4R9KA 1KSIA 1TRPA 1TRQA 3WR2A 4BTXA 1B2SA 3DM8A 4OVMA 5AEUB 1JBRA 4R1KA 1JN5A 1TIJA 2CW9A 3JUNA 3LXUX 4RBNA 5AIIA 2HMKB 2P0MA 5ELUA 2W0QA 3N54B 1DMMA 1Y4KA 3F9SA 6RNTA 1VQK3 1BRJA 4LMIA 1B2ZA 1STFI
chains in the Genus database with same CATH topology
1RN7A 2IA7A 1W6CA 1IQYA 1GY6A 1SIHA 1ROVA 4FCZA 1UI7A 1IV9A 1VQ43 2K54A 3U97A 3DGMA 1IT7A 3FH1A 1GYBA 2OTJ3 1A2KA 3HIIA 3NV0B 4FMCA 4FR9A 3B8LA 3NXJA 1FUWA 3SVAA 2ZL8A 3K0ZA 2ML6A 4IT7A 3JVCA 1K41A 3M8CA 1QVF2 2XRXB 3KZTA 1C7HA 2HMMB 4TX4A 1K9M4 3NM7A 3EHCA 3KIIA 1DYUA 2XFSA 5LC7A 1DVDA 2OTL3 1PU4A 2HMLB 5EEOA 1JB4A 1YJ93 1G96A 4WP5A 3CCS3 1M9GA 3NBJA 3KFQC 3G713 4HM7B 3EBYA 1FGTA 2R4IA 1U5OA 3K7CA 4HBRA 2ZDJA 1K28A 5IG3A 1TP6A 2CG1A 3UL6A 8CHOA 1IVWA 3PS8A 1LNHA 3GWRA 2BHMA 2OOVC 3QRDA 1OPYA 2W9QA 4FMAA 4XBXA 3VGNA 4RNZA 1FGRA 3X42A 4LZIA 4EC6A 1Z1SA 3PXMA 2F98A 1NO3A 2OCTA 4HZBB 3UJMA 2HMNB 5CLKA 2XF3A 2D1WA 3DY5A 5IG5A 5IENA 1VQL3 5IERA 1NWWA 3ALAA 3T0UA 3EN8A 1E97A 2XGLA 3HK4A 4HJLB 4HM3B 4HM8B 3OWSA 5CXOA 3S5CA 3T8UA 3FGYA 4GB5A 3GAXA 1IVVA 1T5YA 1FGOA 1OHOA 4GL6A 3V99A 4KFFA 3IJEB 5AIGA 1SQWA 3GZXB 5IEOA 2RFRA 1K734 1IVXA 1AV4A 4MEIA 2CWVA 3A76A 4EV2A 3LTDA 3WMDA 2W56B 4LGQA 5KP3A 1CYUA 2STDA 2FNQA 3PZWA 1KWIA 3SXXA 3UNLA 5D82A 7STDA 5D83A 1UUWB 3MKIA 4L8PA 3HZPA 1PFPA 1FA3A 1OF5A 2GEYA 3X3ZA 1RKYA 2Y73A 3LOYA 1N5HA 1O7MB 2CH9A 2M7OA 2CFKA 1JV2B 3I0YA 3LZAA 2UX0A 2O3OA 3MWZA 2IUKA 1YI23 3CME3 3BNBA 4FMDA 5EVHA 1N8QA 1OUNA 3F8XA 4N6MA 4AKZA 4EXRA 3CPOA 4XDWA 1VQ93 4N6V0 4WYKA 1V74A 4X2HA 2L4VA 1IT8A 1ULJB 2CWTA 3CNMA 4KZ1A 2F99A 2HMJB 4MJDA 5HGRA 3S27A 1ZX2A 5KP4A 2JDIH 3BLZA 3LH4A 2QIYA 2GXFA 4CDLA 2MC8A 3X3XA 3T8NA 3MYTA 1M1K4 2CC3A 1TFKA 3LMLA 3CCE3 2IMJA 1FGMA 2FGTA 2INXA 1BUQA 1YIT3 3PCRA 4OUQA 3SX1A 1VQO3 3CC73 2YFLB 2OOVA 3K63A 1KQS2 1UI8A 1AVLA 4WWUC 1UUVB 2V1LA 3H3HA 5LC6A 2GBXB 1IDPA 3EE1A 5I97A 1IV7A 2XGNA 5CF1A 3WOEB 1Q7Y4 3DGNA 1AVKA 2C11A 1W7CA 2WGOA 3G0KA 2K0MA 1OCVA 5CF2A 1TU5A 2JQ5A 5IG0A 3NM2A 2CFDA 3RGAA 3B4OA 1SJWA 4HM5B 1GD4A 3EN1B 3MSOA 1D6YA 2XEPA 3WA3A 1ROAA 2OQEC 5STDA 3EX9A 2RSXA 5AEWB 1WTHA 1QJGA 5A0OB 2LYXA 1W2B2 1O7WB 2WOHA 3OX9A 2LQVA 1YJW3 2CKFB 3K5TA 1WMNA 3FF2A 3HX8A 3S28A 2SBLA 3HI7A 1JB2A 1VQM3 4L8OA 1WQLB 3H51A 2RCDA 2QEX3 2BMQB 3GZRA 3F7SA 3ECFA 4KFDA 3CPW2 4HM4B 2W03A 1HKXA 4ZM8A 3CCM3 1L5GB 2BMOB 3EB8A 2Y74A 1UW1A 4N3VA 1KC84 4KVHA 2F86B 3OXAA 1NJI4 1STDA 1W5ZA 4IPBA 1WMPA 3Q1CA 1E3VA 2KCDA 3B4PA 3F14A 2B1XB 1HU9A 1JKGA 3ROBA 6STDA 3VF1A 1OHPA 2P05A 1VZZA 4K1UA 3FLJA 4LEHA 3Q2PA 4N6OB 1DMNA 3K9MC 4LSOA 3CCR3 1OGZA 4XBYA 3S29A 3BNCA 1MOLA 2YFIB 4AKYA 4HM1B 2CIUA 4XDVA 4N6UA 1VQP3 1N5PA 1O7NB 4QWTA 2QA43 1EA2A 3MG2A 3MG3A 4EV5A 4HM6B 3WOFB 2OWPA 2W2CA 1RRHA 2W04A 2Q07A 5DREA 1VQ53 1YIJ3 3X41A 3X3YA 4FCMA 3F8HA 1WMOA 2YX9A 2RGQA 1K8A4 5IW9A 4KFEA 3HIGA 1TFOA 1OF5B 3NBBA 1IK3A 3DMCA 3BNDA 4R80A 3Q90A 4EBGA 2Z76A 1F8NA 1ASKA 4HM2B 3SLUA 2BT3A 3DUKA 4XB5A 2ML5A 4J9AA 2BNGA 2D42A 4WYKB 3SOAA 1D6UA 1IU7A 1OH0A 2GEXA 3UB1A 3L0RA 1VQN3 1QMAA 3BB9A 1W02A 1Q40A 3MG1A 2CFLA 3N8BA 4X2OA 5BVBA 2KRTA 3CD63 5IEPA 1DMQA 4HM0B 3NHXA 1W00A 1QALA 5ELJA 1W6YA 3OW22 4FMBA 3NX0A 2KXGA 3WDGB 2CFWA 3DGOA 3DXOA 3AMOA 3F7XA 3DGLA 3CCV3 4PEJA 3BNEA 3QK9A 1RJOA 1US1A 1TUHA 3D9RA 3CU3A 3TDGA 4N6TA 3U1WA 1O7GB 1R4CA 1SIIA 2PNCA 1YJN3 3FKAA 3B7CA 1AR0A 2E2TA 4RNYA 2GBWB 3LTBA 5DRVA 3LT8A 1CEWI 5AYRB 1EQKA 2WO0A 1Q42A 4H61A 3EC9A 1VQ83 1N9JA 3J7Yd 3CCU3 1LOXA 1M1XB 3LYGA 4O8SA 2Z77A 1D6ZA 5JBSA 2W6JH 1GS3A 3CNXA 1N8R4 4H3UA 4XBTA 5CK6A 1NB5I 3STDA 4O02B 1Q864 4EYCA 3CCQ3 1JNQA 3EF8A 1JJ22 1JRQA 4RZMA 3WA2X 1W2ZA 3I553 3V98A 4WFOA 3IPTA 5JPUA 3GZYB 1SPUA 1S723 3X40A 1A67A 1FGQA 2B24B 1CQSA 4IIAA 3CC23 3FG3A 1JB5A 1IQ8A 3KN4A 2CK3H 4MMXB 3RGRA 4K61A 5AIHA 3NV0A 2HMOB 1GY5A 1S5AA 4BTYA 1MNLA 3LTAA 3N9HA 1JKGB 2YFJB 2A15A 5AI1A 3RDEA 1W6GA 5TGNA 1VQ63 2GU1A 5FW5A 4CCVA 1CYVA 2BO9B 2XR8B 2QGUA 4K90B 3PCSA 4L7KA 3FG1A 1LXEA 2C10A 3ER7A 1KD14 4NHFA 4O3VA 4JRFA 3IMAB 1OHSA 3OWUA 3OV4A 4ORLA 4FCJA 3FZWA 4HYZA 3FCSB 5G2GA 2P0XA 4N6NB 1M904 2P38A 3WODG 3GZBA 3PYJA 3SOYA 2CWUA 4JF8A 1OACA 2XSOB 4AEQA 1QVG2 3FG4A 1GY7A 5JPPA 2CFGA 1IQXA 3KSED 4OK0A 4NREA 2W9PA 4I4KA 1Q814 1VQ73 3G8ZA 1LVNA 1WNHA 1A2VA 2O9UX 4J8TA 2I9WA 4STDA 3CCJ3 3CXC2 3F40A 3UL5A 5IG4A 3MHEA 4Q53A 1Q824 3NQYA 3NUVA 3G4S3 3VSYA 4O2HA 1RRLA 1GD3A 4MMYB 3CMA3 2P09A 3E99A 2PZVA 3FSDA 2BMRB 1A90A 1NU3A 1DVCA 4HKVB 1W4NA 3O8YA 4K1VA 1O7HB 5AYSC 2E2UA 3OWYA 4R4KA 4XM4A 2WGQA 1OGXA 1EG9B 3EQQB 3CCL3 5FGOA 3EBTA 1Q40B 3V92A 1IVUA 5BXQA 3PGBA 1ISKA 4WHAA 4BTWA 5AIFA 2IUJA 4U13A 3JUQA 5KP1A 1YGEA 1U8CB 3D3LA 2OQEA 1N9EA 1QAFA 2CHCA 2XH9A 3LT9A 1O7PB 1YVBI 2W56A 3LTCA 5D81A 1J2BA 4MMZB 3AMOB 3NBRA 2XSHB 4N6LA 3KSPA 4HZ9B 2Z6BA 3NQZA 3SEDA 3S67A 1QAKA 3KE7A 3KKGA 5EQLA 1ZO2A 3G16A 3G6E3 3MPHA 3GRDA 1E3RA 1NB3I 2WOFA 2XFTA 3FF0A 3JUOA 4G1MB 3EJVA 3JUPA 2FXTA 1EKMA 3CC43 2CG0A 5IF6A 2GU3A 4R9LA 2E2VA 2Z7AA 3I563 1JN5B 4HVNA 2MF7A 1YHQ3 1NDOB 1W01A 3JUMA 1ULIB 4R9KA 1KSIA 4BTXA 3DM8A 4OVMA 5AEUB 4R1KA 1JN5A 1TIJA 2CW9A 3JUNA 3LXUX 4RBNA 5AIIA 2HMKB 2P0MA 5ELUA 2W0QA 3N54B 1DMMA 1Y4KA 3F9SA 1VQK3 3DZLA 4LMIA 1STFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT 3;  3CCL 3;  1Q86 4;  1VQ5 3;  1K73 4;  3G6E 3;  1VQO 3;  3CCQ 3;  3CC7 3;  1YIJ 3;  1W2B 2;  2OTL 3;  1YJW 3;  1JJ2 2;  1KQS 2;  1YJ9 3;  1YI2 3;  3CME 3;  3I55 3;  3CCS 3;  3G71 3;  1YJN 3;  1Q81 4;  1VQ7 3;  1VQ4 3;  3CC4 3;  1VQN 3;  1S72 3;  1K8A 4;  1VQM 3;  1VQ9 3;  1KD1 4;  3I56 3;  2OTJ 3;  1YHQ 3;  1Q7Y 4;  2QEX 3;  3CCJ 3;  3CXC 2;  1VQL 3;  3CPW 2;  3CC2 3;  3CCR 3;  1Q82 4;  3CD6 3;  3CCM 3;  3G4S 3;  3CMA 3;  1M90 4;  1VQP 3;  1VQ8 3;  1KC8 4;  1QVF 2;  3OW2 2;  3CCU 3;  2QA4 3;  1NJI 4;  1M1K 4;  3CCE 3;  1VQK 3;  1K9M 4;  1QVG 2;  1VQ6 3;  1N8R 4;  3CCV 3; 
#chains in the Genus database with same CATH topology
 1BAN A;  1RN7 A;  2IA7 A;  1W6C A;  1IQY A;  1GY6 A;  1SIH A;  1RNB A;  2K3D A;  1BOX A;  1ROV A;  4FCZ A;  3A5E A;  1UCJ A;  1UI7 A;  1IV9 A;  3HOH A;  1VQ4 3;  2K54 A;  1DE3 A;  3U97 A;  1LRA A;  3DGM A;  1IT7 A;  3FH1 A;  1BRK A;  1GYB A;  2OTJ 3;  1A2K A;  3HII A;  2L1S A;  3NV0 B;  4FMC A;  4FR9 A;  2AAD A;  3B8L A;  3NXJ A;  1FUW A;  3SVA A;  5BU4 A;  2ZL8 A;  3K0Z A;  2ML6 A;  4IT7 A;  3JVC A;  2IY2 A;  1K41 A;  3M8C A;  1QVF 2;  2XRX B;  3KZT A;  1C7H A;  3AHW A;  2H0H A;  1FW7 A;  2HMM B;  4TX4 A;  1K9M 4;  3NM7 A;  3EHC A;  3KII A;  1DYU A;  2XFS A;  4J5G A;  5LC7 A;  1DVD A;  2OTL 3;  1PU4 A;  2HML B;  5EEO A;  1JB4 A;  1YJ9 3;  1G96 A;  1V57 A;  4WP5 A;  3CCS 3;  1M9G A;  3NBJ A;  3KFQ C;  1HYF A;  4HM7 B;  3EBY A;  3G71 3;  1FGT A;  7RNT A;  1RGK A;  2R4I A;  1U5O A;  3K7C A;  4HBR A;  2ZDJ A;  1K28 A;  5IG3 A;  1MWS A;  7GSP A;  1TP6 A;  2CG1 A;  2HOH A;  3UL6 A;  8CHO A;  1IVW A;  3PS8 A;  1LNH A;  3GWR A;  2BHM A;  2OOV C;  3QRD A;  1OPY A;  2W9Q A;  4FMA A;  4XBX A;  3VGN A;  1LNI A;  4RNZ A;  1RN1 A;  1FGR A;  3X42 A;  4LZI A;  4EC6 A;  1Z1S A;  1BRN L;  3PXM A;  2F98 A;  4EW5 A;  1NO3 A;  1RDS A;  2OCT A;  4HZB B;  3UJM A;  1I0V A;  2HMN B;  5CLK A;  1I2E A;  2XF3 A;  2D1W A;  3DY5 A;  1G0T A;  1B3S A;  1BSA A;  3D5I A;  5IEN A;  5IG5 A;  1VQL 3;  5IER A;  1NWW A;  4GHO A;  3ALA A;  3T0U A;  3EN8 A;  2KF3 A;  3BU4 A;  1E97 A;  2XGL A;  3HK4 A;  4HJL B;  4HM3 B;  4HM8 B;  3OWS A;  5CXO A;  3S5C A;  3T8U A;  3FGY A;  4GB5 A;  3RNT A;  3GAX A;  1IVV A;  1T5Y A;  2KAA A;  1FGO A;  1OHO A;  4GL6 A;  3V99 A;  4KFF A;  3IJE B;  2ZHX B;  5AIG A;  1SQW A;  3GZX B;  5IEO A;  2RFR A;  1K73 4;  1IVX A;  1AV4 A;  4MEI A;  2F4Y A;  2CWV A;  1AQZ A;  3A76 A;  4EV2 A;  3LTD A;  1UGH I;  3WMD A;  1EUI C;  2W56 B;  4LGQ A;  1FZU A;  5KP3 A;  4HAA A;  1CYU A;  2STD A;  2FNQ A;  3PZW A;  1KWI A;  3SXX A;  3UNL A;  5D82 A;  7STD A;  5D83 A;  1UUW B;  3MKI A;  4L8P A;  3HZP A;  1PFP A;  1FA3 A;  1OF5 A;  2GEY A;  3X3Z A;  1RKY A;  2Y73 A;  2IYJ A;  3LOY A;  5M1A A;  1N5H A;  1BSE A;  1O7M B;  2CH9 A;  2M7O A;  2CFK A;  1JV2 B;  2AAE A;  3I0Y A;  3LZA A;  2UX0 A;  1I2F A;  2O3O A;  3MWZ A;  4ILF A;  1SAR A;  2UGI A;  2IUK A;  1YI2 3;  3CME 3;  3BNB A;  4FMD A;  5EVH A;  1N8Q A;  1OUN A;  3F8X A;  4N6M A;  4AKZ A;  4EXR A;  1BNJ A;  3CPO A;  4XDW A;  1VQ9 3;  4N6V 0;  4WYK A;  1V74 A;  4X2H A;  2L4V A;  1IT8 A;  1ULJ B;  2CWT A;  3CNM A;  4KZ1 A;  2F99 A;  2HMJ B;  4MJD A;  5HGR A;  3S27 A;  1ZX2 A;  5KP4 A;  2JDI H;  3BLZ A;  3LH4 A;  2QIY A;  2GXF A;  4CDL A;  1R4Y A;  2MC8 A;  3X3X A;  1BSB A;  1RN4 A;  3T8N A;  3MYT A;  1M1K 4;  2CC3 A;  1TFK A;  3LML A;  3CCE 3;  2IMJ A;  1FGM A;  2FGT A;  4LYL B;  2INX A;  8RNT A;  5HOH A;  1YIT 3;  3PCR A;  1BUQ A;  1UCI A;  4OUQ A;  3SX1 A;  1A2P A;  1VQO 3;  1Q9E A;  3CC7 3;  2YFL B;  2OOV A;  3K63 A;  1KQS 2;  1UI8 A;  1CH0 A;  1AVL A;  5M19 A;  4WWU C;  1UUV B;  2V1L A;  3H3H A;  5G1L A;  5LC6 A;  2GBX B;  1BNS A;  1IDP A;  3AGN A;  3EE1 A;  5I97 A;  1IV7 A;  1T3B A;  1VQQ A;  2XGN A;  3WHO A;  3WOE B;  5CF1 A;  3DGN A;  2RNT A;  4DKI A;  1AVK A;  2C11 A;  1W7C A;  2WGO A;  3G0K A;  2K0M A;  1OCV A;  5CF2 A;  1C54 A;  1TU5 A;  2JQ5 A;  1B2U A;  4CPK A;  1BU4 A;  5IG0 A;  1X1X A;  3NM2 A;  2CFD A;  4NPB A;  3RGA A;  3B4O A;  1SJW A;  4HM5 B;  1B20 A;  1GD4 A;  3DZL A;  3EN1 B;  1LOY A;  3MSO A;  1D6Y A;  1TJD A;  2CX0 A;  2XEP A;  1RGL A;  1UGI A;  3WA3 A;  1ROA A;  2OQE C;  5STD A;  3EX9 A;  1LQG C;  2RSX A;  5AEW B;  1B21 A;  1QJG A;  1WTH A;  2LYX A;  5A0O B;  1W2B 2;  1O7W B;  1UUG B;  2WOH A;  3OX9 A;  2LQV A;  1YJW 3;  2CKF B;  3K5T A;  1WMN A;  3FF2 A;  3HX8 A;  3S28 A;  2SBL A;  3HI7 A;  1JB2 A;  1X1W A;  3AHS A;  1VQM 3;  1PYL A;  1WQL B;  3H51 A;  4L8O A;  2RCD A;  2QEX 3;  1MWT A;  1RGH A;  2BMQ B;  2RBI A;  3ECF A;  3F7S A;  3GZR A;  4KFD A;  3CPW 2;  1RNT A;  4HM4 B;  1MGW A;  1NNV A;  1HKX A;  2W03 A;  1RTU A;  1L5G B;  4ZM8 A;  2BMO B;  3EB8 A;  5M18 A;  2Y74 A;  3CCM 3;  1UW1 A;  4N3V A;  3URP A;  1KC8 4;  4KVH A;  2F86 B;  1UCK A;  3OXA A;  1YNV X;  1NJI 4;  1Q7Y 4;  1STD A;  1W5Z A;  4IPB A;  1WMP A;  3Q1C A;  1E3V A;  2KCD A;  3B4P A;  3F14 A;  2B1X B;  1HU9 A;  3D5G A;  1JKG A;  3ROB A;  6STD A;  3VF1 A;  1OHP A;  2P05 A;  1VZZ A;  4K1U A;  1MWR A;  3FLJ A;  4LEH A;  3Q2P A;  4N6O B;  2ZA4 A;  1IYY A;  1DMN A;  5GSP A;  1BRI A;  1ZGX A;  3K9M C;  3D79 A;  1GMP A;  4KT3 B;  1OGZ A;  4LSO A;  4XBY A;  3S29 A;  3CCR 3;  4BL3 A;  3BNC A;  1MOL A;  2YFI B;  1RSN A;  3SYU A;  4AKY A;  4HM1 B;  2CIU A;  4XDV A;  4N6U A;  1VQP 3;  1N5P A;  1O7N B;  4QWT A;  2QA4 3;  1EA2 A;  3MG2 A;  3MG3 A;  6GSP A;  4EV5 A;  1I0X A;  4HM6 B;  3WOF B;  2OWP A;  2W2C A;  1BRG A;  1RRH A;  1RHL A;  2W04 A;  2Q07 A;  5DRE A;  1VQ5 3;  1BSD A;  2F5W A;  4BL2 A;  1YIJ 3;  3X41 A;  3X3Y A;  4FCM A;  3F8H A;  1WMO A;  2YX9 A;  2RGQ A;  1RLS A;  1K8A 4;  2J8X B;  1I8V A;  1JBT A;  5IW9 A;  4KFE A;  3HIG A;  1TFO A;  1OF5 B;  3NBB A;  1IK3 A;  3DMC A;  2F5M A;  3BND A;  4R80 A;  1G02 A;  3Q90 A;  4EBG A;  2Z76 A;  1F8N A;  1ASK A;  2H0G A;  4HM2 B;  2BT3 A;  3SLU A;  3DUK A;  4RNT A;  4XB5 A;  2ML5 A;  1BNE A;  4J9A A;  2BNG A;  1RCL A;  1X1U A;  2D42 A;  4WYK B;  3SOA A;  1D6U A;  1IU7 A;  1OH0 A;  2GEX A;  3UB1 A;  3L0R A;  1VQN 3;  1QMA A;  3BB9 A;  1GSP A;  1W02 A;  1Q40 A;  1B2M A;  3MG1 A;  2CFL A;  3N8B A;  4X2O A;  5BVB A;  2KRT A;  1GOY A;  5IEP A;  2H0I A;  3CD6 3;  1DMQ A;  1FYS A;  4HM0 B;  2KF6 A;  1LOV A;  3NHX A;  1W00 A;  1QAL A;  1RCK A;  5ELJ A;  3BIR A;  1W6Y A;  3OW2 2;  4FMB A;  3NX0 A;  2KXG A;  2CX1 A;  3WDG B;  1BNR A;  2CFW A;  3DGO A;  3DXO A;  3AMO A;  3F7X A;  3DGL A;  3CCV 3;  4PEJ A;  3BNE A;  3QK9 A;  2BIR A;  3ZG0 A;  5G1K A;  3ZFZ A;  1RJO A;  1US1 A;  1TUH A;  1PY3 A;  3D9R A;  3CU3 A;  1AY7 A;  4N6T A;  3TDG A;  3U1W A;  1O7G B;  1R4C A;  1SII A;  2PNC A;  1YJN 3;  3FKA A;  1MGR A;  1AR0 A;  2E2T A;  3B7C A;  3DH2 A;  4RNY A;  1JBS A;  2GBW B;  3LTB A;  5DRV A;  3LT8 A;  1CEW I;  2F56 A;  5AYR B;  1EQK A;  2WO0 A;  1B2X A;  1Q42 A;  4H61 A;  3EC9 A;  1VQ8 3;  1GMR A;  1N9J A;  3J7Y d;  3CCU 3;  1LOX A;  1M1X B;  3LYG A;  1RGC A;  1RMS A;  2SAR A;  1D6Z A;  2Z77 A;  4GSP A;  4O8S A;  5JBS A;  2W6J H;  1GS3 A;  1GOU A;  3CNX A;  4H3U A;  4XBT A;  1BAO A;  5CK6 A;  3STD A;  4O02 B;  1N8R 4;  1NB5 I;  1Q86 4;  4EYC A;  3CCQ 3;  1JNQ A;  3EF8 A;  1JJ2 2;  1JRQ A;  4RZM A;  3WA2 X;  1W2Z A;  3I55 3;  3V98 A;  4WFO A;  3IPT A;  5JPU A;  3GZY B;  1SPU A;  1S72 3;  3X40 A;  1A67 A;  1FGQ A;  2B24 B;  1EEJ A;  1CQS A;  1LOW A;  4IIA A;  3CC2 3;  1HZ1 A;  3FG3 A;  1B27 A;  1JB5 A;  1IQ8 A;  3KN4 A;  1BNG A;  1YVS A;  2CK3 H;  4MMX B;  3RGR A;  4K61 A;  5AIH A;  3NV0 A;  1GY5 A;  1S5A A;  2HMO B;  2UUG C;  4BTY A;  1MNL A;  3LTA A;  3N9H A;  1JKG B;  2YFJ B;  2A15 A;  1JZO A;  5AI1 A;  3RDE A;  1W6G A;  5TGN A;  1VQ6 3;  1YGW A;  2GU1 A;  5FW5 A;  4CCV A;  1CYV A;  2BO9 B;  2XR8 B;  1UDI I;  2QGU A;  4K90 B;  3PCS A;  4L7K A;  3FG1 A;  1BSC A;  1LXE A;  1I2G A;  5BIR A;  2C10 A;  3ER7 A;  1V58 A;  1UCL A;  1ZS7 A;  4NHF A;  4O3V A;  4JRF A;  1KD1 4;  3IMA B;  1OHS A;  3OWU A;  1T2H A;  3OV4 A;  4ORL A;  4FCJ A;  1BNI A;  3FZW A;  4HYZ A;  1BIR A;  1BVI A;  3AGO A;  3FCS B;  5G2G A;  2P0X A;  1BRH A;  4N6N B;  4BU4 A;  1M90 4;  1GOV A;  2P38 A;  4CJN A;  3WOD G;  3GZB A;  3PYJ A;  3SOY A;  2CWU A;  4JF8 A;  1OAC A;  2XSO B;  4AEQ A;  1QVG 2;  3FG4 A;  3KCH A;  1GY7 A;  3D4A A;  1BGS A;  5JPP A;  1FUT A;  2CFG A;  1FUS A;  1IQX A;  3KSE D;  4OK0 A;  4NRE A;  2W9P A;  4I4K A;  1T2I A;  1VQ7 3;  1Q81 4;  3G8Z A;  1LVN A;  1WNH A;  3GSP A;  1A2V A;  2O9U X;  4J8T A;  2I9W A;  4STD A;  9RNT A;  3CCJ 3;  3CXC 2;  3Q3F A;  3F40 A;  3UL5 A;  5IG4 A;  3MHE A;  4Q53 A;  1Q82 4;  3NQY A;  3NUV A;  3G4S 3;  3VSY A;  4O2H A;  1RRL A;  1GD3 A;  4MMY B;  3CMA 3;  2P09 A;  1BRS A;  3E99 A;  2PZV A;  3FSD A;  2BMR B;  1I3I A;  1NU3 A;  1A90 A;  1DVC A;  1Q7H A;  1W4N A;  3O8Y A;  4HKV B;  1O7H B;  4K1V A;  2E2U A;  1BNF A;  5AYS C;  4BIR A;  3OWY A;  4R4K A;  1RGE A;  4I5Q A;  4XM4 A;  2WGQ A;  1OGX A;  1EG9 B;  3EQQ B;  3CCL 3;  1LQM B;  5FGO A;  3EBT A;  1Q40 B;  1X1Y A;  3V92 A;  1TTO A;  1IVU A;  5BXQ A;  3PGB A;  1ISK A;  4WHA A;  4BTW A;  5AIF A;  2IUJ A;  1I70 A;  4U13 A;  3JUQ A;  5KP1 A;  1YGE A;  1U8C B;  3D3L A;  1RGG A;  2OQE A;  1N9E A;  1QAF A;  2CHC A;  2XH9 A;  3LT9 A;  1RGA A;  1O7P B;  1YVB I;  2W56 A;  3LTC A;  5D81 A;  1J2B A;  4MMZ B;  3AMO B;  3NBR A;  2XSH B;  4N6L A;  1JZD A;  2R41 A;  3KSP A;  4J5K A;  4HOH A;  4HZ9 B;  1MWU A;  2KF4 A;  2C4B A;  2Z6B A;  3NQZ A;  3SED A;  3ZG5 A;  3DGY A;  1QAK A;  3KE7 A;  3KKG A;  3S67 A;  1BUJ A;  5EQL A;  1I3F A;  1ZO2 A;  2KF5 A;  1RGF A;  3G16 A;  3G6E 3;  3MPH A;  3GRD A;  1E3R A;  1NB3 I;  2WOF A;  2XFT A;  2BU4 A;  3FF0 A;  3JUO A;  4G1M B;  3EJV A;  3JUP A;  2FXT A;  1EKM A;  3CC4 3;  2CG0 A;  2GSP A;  5IF6 A;  2GU3 A;  5RNT A;  4R9L A;  2E2V A;  2Z7A A;  3I56 3;  1JN5 B;  4HVN A;  2MF7 A;  1GMQ A;  1NDO B;  1W01 A;  1YHQ 3;  3JUM A;  1DET A;  1ULI B;  4R9K A;  1KSI A;  1TRP A;  1TRQ A;  3WR2 A;  4BTX A;  1B2S A;  3DM8 A;  4OVM A;  5AEU B;  1JBR A;  4R1K A;  1JN5 A;  1TIJ A;  2CW9 A;  3JUN A;  3LXU X;  4RBN A;  5AII A;  2HMK B;  2P0M A;  5ELU A;  2W0Q A;  3N54 B;  1DMM A;  1Y4K A;  3F9S A;  6RNT A;  1VQK 3;  1BRJ A;  4LMI A;  1B2Z A;  1STF I; 
#chains in the Genus database with same CATH homology
 1RN7 A;  2IA7 A;  1W6C A;  1IQY A;  1GY6 A;  1SIH A;  1ROV A;  4FCZ A;  1UI7 A;  1IV9 A;  1VQ4 3;  2K54 A;  3U97 A;  3DGM A;  1IT7 A;  3FH1 A;  1GYB A;  2OTJ 3;  1A2K A;  3HII A;  3NV0 B;  4FMC A;  4FR9 A;  3B8L A;  3NXJ A;  1FUW A;  3SVA A;  2ZL8 A;  3K0Z A;  2ML6 A;  4IT7 A;  3JVC A;  1K41 A;  3M8C A;  1QVF 2;  2XRX B;  3KZT A;  1C7H A;  2HMM B;  4TX4 A;  1K9M 4;  3NM7 A;  3EHC A;  3KII A;  1DYU A;  2XFS A;  5LC7 A;  1DVD A;  2OTL 3;  1PU4 A;  2HML B;  5EEO A;  1JB4 A;  1YJ9 3;  1G96 A;  4WP5 A;  3CCS 3;  1M9G A;  3NBJ A;  3KFQ C;  3G71 3;  4HM7 B;  3EBY A;  1FGT A;  2R4I A;  1U5O A;  3K7C A;  4HBR A;  2ZDJ A;  1K28 A;  5IG3 A;  1TP6 A;  2CG1 A;  3UL6 A;  8CHO A;  1IVW A;  3PS8 A;  1LNH A;  3GWR A;  2BHM A;  2OOV C;  3QRD A;  1OPY A;  2W9Q A;  4FMA A;  4XBX A;  3VGN A;  4RNZ A;  1FGR A;  3X42 A;  4LZI A;  4EC6 A;  1Z1S A;  3PXM A;  2F98 A;  1NO3 A;  2OCT A;  4HZB B;  3UJM A;  2HMN B;  5CLK A;  2XF3 A;  2D1W A;  3DY5 A;  5IG5 A;  5IEN A;  1VQL 3;  5IER A;  1NWW A;  3ALA A;  3T0U A;  3EN8 A;  1E97 A;  2XGL A;  3HK4 A;  4HJL B;  4HM3 B;  4HM8 B;  3OWS A;  5CXO A;  3S5C A;  3T8U A;  3FGY A;  4GB5 A;  3GAX A;  1IVV A;  1T5Y A;  1FGO A;  1OHO A;  4GL6 A;  3V99 A;  4KFF A;  3IJE B;  5AIG A;  1SQW A;  3GZX B;  5IEO A;  2RFR A;  1K73 4;  1IVX A;  1AV4 A;  4MEI A;  2CWV A;  3A76 A;  4EV2 A;  3LTD A;  3WMD A;  2W56 B;  4LGQ A;  5KP3 A;  1CYU A;  2STD A;  2FNQ A;  3PZW A;  1KWI A;  3SXX A;  3UNL A;  5D82 A;  7STD A;  5D83 A;  1UUW B;  3MKI A;  4L8P A;  3HZP A;  1PFP A;  1FA3 A;  1OF5 A;  2GEY A;  3X3Z A;  1RKY A;  2Y73 A;  3LOY A;  1N5H A;  1O7M B;  2CH9 A;  2M7O A;  2CFK A;  1JV2 B;  3I0Y A;  3LZA A;  2UX0 A;  2O3O A;  3MWZ A;  2IUK A;  1YI2 3;  3CME 3;  3BNB A;  4FMD A;  5EVH A;  1N8Q A;  1OUN A;  3F8X A;  4N6M A;  4AKZ A;  4EXR A;  3CPO A;  4XDW A;  1VQ9 3;  4N6V 0;  4WYK A;  1V74 A;  4X2H A;  2L4V A;  1IT8 A;  1ULJ B;  2CWT A;  3CNM A;  4KZ1 A;  2F99 A;  2HMJ B;  4MJD A;  5HGR A;  3S27 A;  1ZX2 A;  5KP4 A;  2JDI H;  3BLZ A;  3LH4 A;  2QIY A;  2GXF A;  4CDL A;  2MC8 A;  3X3X A;  3T8N A;  3MYT A;  1M1K 4;  2CC3 A;  1TFK A;  3LML A;  3CCE 3;  2IMJ A;  1FGM A;  2FGT A;  2INX A;  1BUQ A;  1YIT 3;  3PCR A;  4OUQ A;  3SX1 A;  1VQO 3;  3CC7 3;  2YFL B;  2OOV A;  3K63 A;  1KQS 2;  1UI8 A;  1AVL A;  4WWU C;  1UUV B;  2V1L A;  3H3H A;  5LC6 A;  2GBX B;  1IDP A;  3EE1 A;  5I97 A;  1IV7 A;  2XGN A;  5CF1 A;  3WOE B;  1Q7Y 4;  3DGN A;  1AVK A;  2C11 A;  1W7C A;  2WGO A;  3G0K A;  2K0M A;  1OCV A;  5CF2 A;  1TU5 A;  2JQ5 A;  5IG0 A;  3NM2 A;  2CFD A;  3RGA A;  3B4O A;  1SJW A;  4HM5 B;  1GD4 A;  3EN1 B;  3MSO A;  1D6Y A;  2XEP A;  3WA3 A;  1ROA A;  2OQE C;  5STD A;  3EX9 A;  2RSX A;  5AEW B;  1WTH A;  1QJG A;  5A0O B;  2LYX A;  1W2B 2;  1O7W B;  2WOH A;  3OX9 A;  2LQV A;  1YJW 3;  2CKF B;  3K5T A;  1WMN A;  3FF2 A;  3HX8 A;  3S28 A;  2SBL A;  3HI7 A;  1JB2 A;  1VQM 3;  4L8O A;  1WQL B;  3H51 A;  2RCD A;  2QEX 3;  2BMQ B;  3GZR A;  3F7S A;  3ECF A;  4KFD A;  3CPW 2;  4HM4 B;  2W03 A;  1HKX A;  4ZM8 A;  3CCM 3;  1L5G B;  2BMO B;  3EB8 A;  2Y74 A;  1UW1 A;  4N3V A;  1KC8 4;  4KVH A;  2F86 B;  3OXA A;  1NJI 4;  1STD A;  1W5Z A;  4IPB A;  1WMP A;  3Q1C A;  1E3V A;  2KCD A;  3B4P A;  3F14 A;  2B1X B;  1HU9 A;  1JKG A;  3ROB A;  6STD A;  3VF1 A;  1OHP A;  2P05 A;  1VZZ A;  4K1U A;  3FLJ A;  4LEH A;  3Q2P A;  4N6O B;  1DMN A;  3K9M C;  4LSO A;  3CCR 3;  1OGZ A;  4XBY A;  3S29 A;  3BNC A;  1MOL A;  2YFI B;  4AKY A;  4HM1 B;  2CIU A;  4XDV A;  4N6U A;  1VQP 3;  1N5P A;  1O7N B;  4QWT A;  2QA4 3;  1EA2 A;  3MG2 A;  3MG3 A;  4EV5 A;  4HM6 B;  3WOF B;  2OWP A;  2W2C A;  1RRH A;  2W04 A;  2Q07 A;  5DRE A;  1VQ5 3;  1YIJ 3;  3X41 A;  3X3Y A;  4FCM A;  3F8H A;  1WMO A;  2YX9 A;  2RGQ A;  1K8A 4;  5IW9 A;  4KFE A;  3HIG A;  1TFO A;  1OF5 B;  3NBB A;  1IK3 A;  3DMC A;  3BND A;  4R80 A;  3Q90 A;  4EBG A;  2Z76 A;  1F8N A;  1ASK A;  4HM2 B;  3SLU A;  2BT3 A;  3DUK A;  4XB5 A;  2ML5 A;  4J9A A;  2BNG A;  2D42 A;  4WYK B;  3SOA A;  1D6U A;  1IU7 A;  1OH0 A;  2GEX A;  3UB1 A;  3L0R A;  1VQN 3;  1QMA A;  3BB9 A;  1W02 A;  1Q40 A;  3MG1 A;  2CFL A;  3N8B A;  4X2O A;  5BVB A;  2KRT A;  3CD6 3;  5IEP A;  1DMQ A;  4HM0 B;  3NHX A;  1W00 A;  1QAL A;  5ELJ A;  1W6Y A;  3OW2 2;  4FMB A;  3NX0 A;  2KXG A;  3WDG B;  2CFW A;  3DGO A;  3DXO A;  3AMO A;  3F7X A;  3DGL A;  3CCV 3;  4PEJ A;  3BNE A;  3QK9 A;  1RJO A;  1US1 A;  1TUH A;  3D9R A;  3CU3 A;  3TDG A;  4N6T A;  3U1W A;  1O7G B;  1R4C A;  1SII A;  2PNC A;  1YJN 3;  3FKA A;  3B7C A;  1AR0 A;  2E2T A;  4RNY A;  2GBW B;  3LTB A;  5DRV A;  3LT8 A;  1CEW I;  5AYR B;  1EQK A;  2WO0 A;  1Q42 A;  4H61 A;  3EC9 A;  1VQ8 3;  1N9J A;  3J7Y d;  3CCU 3;  1LOX A;  1M1X B;  3LYG A;  4O8S A;  2Z77 A;  1D6Z A;  5JBS A;  2W6J H;  1GS3 A;  3CNX A;  1N8R 4;  4H3U A;  4XBT A;  5CK6 A;  1NB5 I;  3STD A;  4O02 B;  1Q86 4;  4EYC A;  3CCQ 3;  1JNQ A;  3EF8 A;  1JJ2 2;  1JRQ A;  4RZM A;  3WA2 X;  1W2Z A;  3I55 3;  3V98 A;  4WFO A;  3IPT A;  5JPU A;  3GZY B;  1SPU A;  1S72 3;  3X40 A;  1A67 A;  1FGQ A;  2B24 B;  1CQS A;  4IIA A;  3CC2 3;  3FG3 A;  1JB5 A;  1IQ8 A;  3KN4 A;  2CK3 H;  4MMX B;  3RGR A;  4K61 A;  5AIH A;  3NV0 A;  2HMO B;  1GY5 A;  1S5A A;  4BTY A;  1MNL A;  3LTA A;  3N9H A;  1JKG B;  2YFJ B;  2A15 A;  5AI1 A;  3RDE A;  1W6G A;  5TGN A;  1VQ6 3;  2GU1 A;  5FW5 A;  4CCV A;  1CYV A;  2BO9 B;  2XR8 B;  2QGU A;  4K90 B;  3PCS A;  4L7K A;  3FG1 A;  1LXE A;  2C10 A;  3ER7 A;  1KD1 4;  4NHF A;  4O3V A;  4JRF A;  3IMA B;  1OHS A;  3OWU A;  3OV4 A;  4ORL A;  4FCJ A;  3FZW A;  4HYZ A;  3FCS B;  5G2G A;  2P0X A;  4N6N B;  1M90 4;  2P38 A;  3WOD G;  3GZB A;  3PYJ A;  3SOY A;  2CWU A;  4JF8 A;  1OAC A;  2XSO B;  4AEQ A;  1QVG 2;  3FG4 A;  1GY7 A;  5JPP A;  2CFG A;  1IQX A;  3KSE D;  4OK0 A;  4NRE A;  2W9P A;  4I4K A;  1Q81 4;  1VQ7 3;  3G8Z A;  1LVN A;  1WNH A;  1A2V A;  2O9U X;  4J8T A;  2I9W A;  4STD A;  3CCJ 3;  3CXC 2;  3F40 A;  3UL5 A;  5IG4 A;  3MHE A;  4Q53 A;  1Q82 4;  3NQY A;  3NUV A;  3G4S 3;  3VSY A;  4O2H A;  1RRL A;  1GD3 A;  4MMY B;  3CMA 3;  2P09 A;  3E99 A;  2PZV A;  3FSD A;  2BMR B;  1A90 A;  1NU3 A;  1DVC A;  4HKV B;  1W4N A;  3O8Y A;  4K1V A;  1O7H B;  5AYS C;  2E2U A;  3OWY A;  4R4K A;  4XM4 A;  2WGQ A;  1OGX A;  1EG9 B;  3EQQ B;  3CCL 3;  5FGO A;  3EBT A;  1Q40 B;  3V92 A;  1IVU A;  5BXQ A;  3PGB A;  1ISK A;  4WHA A;  4BTW A;  5AIF A;  2IUJ A;  4U13 A;  3JUQ A;  5KP1 A;  1YGE A;  1U8C B;  3D3L A;  2OQE A;  1N9E A;  1QAF A;  2CHC A;  2XH9 A;  3LT9 A;  1O7P B;  1YVB I;  2W56 A;  3LTC A;  5D81 A;  1J2B A;  4MMZ B;  3AMO B;  3NBR A;  2XSH B;  4N6L A;  3KSP A;  4HZ9 B;  2Z6B A;  3NQZ A;  3SED A;  3S67 A;  1QAK A;  3KE7 A;  3KKG A;  5EQL A;  1ZO2 A;  3G16 A;  3G6E 3;  3MPH A;  3GRD A;  1E3R A;  1NB3 I;  2WOF A;  2XFT A;  3FF0 A;  3JUO A;  4G1M B;  3EJV A;  3JUP A;  2FXT A;  1EKM A;  3CC4 3;  2CG0 A;  5IF6 A;  2GU3 A;  4R9L A;  2E2V A;  2Z7A A;  3I56 3;  1JN5 B;  4HVN A;  2MF7 A;  1YHQ 3;  1NDO B;  1W01 A;  3JUM A;  1ULI B;  4R9K A;  1KSI A;  4BTX A;  3DM8 A;  4OVM A;  5AEU B;  4R1K A;  1JN5 A;  1TIJ A;  2CW9 A;  3JUN A;  3LXU X;  4RBN A;  5AII A;  2HMK B;  2P0M A;  5ELU A;  2W0Q A;  3N54 B;  1DMM A;  1Y4K A;  3F9S A;  1VQK 3;  3DZL A;  4LMI A;  1STF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...