5STDA

Scytalone dehydratase plus inhibitor 2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
total genus 53
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5stdA00
1OGXA 3SEDA 3I0YA 2Z7AA 3M8CA 4XBYA 1JN5A 1ZX2A 5AIIA 1OGZA 5AIGA 4L7KA 4KVHA 4HZ9B 6STDA 2GEYA 3UJMA 2XRXB 2HMNB 1U5OA 3FLJA 4WWUC 3A76A 3FH1A 1AR0A 4H3UA 4I4KA 1QJGA 3F7SA 4FCMA 1O7MB 3RGAA 3MHEA 3JUQA 3F40A 4HM6B 2YFJB 1K41A 5CXOA 3ROBA 2I9WA 1GYBA 1ULIB 3GWRA 5AIHA 5JPUA 2RFRA 2RCDA 4K1UA 5AEUB 4R9KA 3B7CA 4MJDA 5IG3A 2BNGA 3OWYA 4PEJA 1OHSA 5IG5A 2HMMB 3H51A 2BMRB 1TUHA 1C7HA 2F99A 1W01A 5KP4A 3MG1A 1OH0A 3OWSA 2JQ5A 4CDLA 5IG0A 3CPOA 2CKFB 1JKGB 3OX9A 5BVBA 3EF8A 2Z77A 4L8PA 2QGUA 4HJLB 2YFLB 5AEWB 3T8UA 4IIAA 3DXOA 1O7WB 3FGYA 1JB5A 5IEPA 5KP1A 1OHOA 1E3VA 1NWWA 5IERA 4X2HA 5STDA 3MKIA 5FW5A 3GZBA 1OHPA 4HKVB 3EBYA 2HMOB 1HKXA 4R1KA 4R9LA 3F14A 2GBXB 3GZRA 3BB9A 3CNXA 3JUNA 1ISKA 3B8LA 2INXA 3NM2A 3FF2A 2HMKB 1W6YA 5IF6A 3DZLA 5IEOA 3MG3A 4HM1B 1QMAA 1IDPA 4WP5A 4L8OA 3CU3A 3FSDA 1OF5B 3BLZA 3F8HA 1NDOB 4OVMA 5KP3A 1E97A 3GZYB 2RGQA 1UUVB 1JN5B 3VGNA 3KE7A 5CF2A 3DUKA 3LZAA 3DMCA 3OV4A 4HM0B 3IPTA 3RGRA 1DMQA 3S5CA 3ECFA 2UX0A 5TGNA 1EA2A 1OCVA 5IG4A 1SJWA 3LYGA 5CF1A 3STDA 1GY5A 4HVNA 3D9RA 3F9SA 3G8ZA 3H3HA 2HMJB 5AIFA 3JUMA 4LMIA 5D82A 3KKGA 5DRVA 1W00A 5DREA 2B1XB 1WQLB 4J9AA 2PZVA 1OUNA 2B24B 2HMLB 1TP6A 2BMOB 3G0KA 3KZTA 1O7PB 2XR8B 4HZBB 5IENA 2OWPA 3EN8A 3GRDA 4XB5A 4XBXA 2QIYA 4HM3B 3B4OA 1A2KA 3FF0A 3B4PA 5D81A 3OWUA 3MG2A 4FCJA 3GZXB 4K1VA 4STDA 2STDA 1Z1SA 4WYKB 2XSHB 1UUWB 3F7XA 3EHCA 3EJVA 4RZMA 4HM4B 4LEHA 1STDA 4XDVA 3CNMA 2YFIB 3HZPA 3OXAA 5CK6A 3NV0B 3NXJA 2A15A 3MSOA 1EG9B 1O7HB 3WMDA 2CHCA 1DMMA 1JB4A 5BXQA 2GBWB 1Q40B 3DM8A 1O7GB 4HM8B 4HM2B 3MYTA 5G2GA 1ASKA 3KSPA 2Z76A 4U13A 1ZO2A 2XSOB 3SOAA 3FKAA 4X2OA 2R4IA 5AI1A 3SOYA 1JKGA 2IMJA 4J8TA 4ORLA 2F98A 2K54A 5HGRA 1DMNA 4HM7B 3EN1B 3HK4A 3EQQB 3EBTA 1O7NB 1W02A 1VZZA 5JPPA 3EC9A 1ULJB 4LGQA 3E99A 3NBRA 1GY7A 3NHXA 3JUPA 3NUVA 3JUOA 5EVHA 3VSYA 4N3VA 4WYKA 4XM4A 1GS3A 1GY6A 1CQSA 4XDWA 7STDA 2F86B 4OUQA 4HM5B 4GB5A 3EX9A 2GEXA 3UNLA 1E3RA 3Q90A 3K0ZA 4Q53A 5CLKA 3K7CA 8CHOA 1Q42A 3G16A 1JB2A 3NV0A 2GXFA 3F8XA 5D83A 3HX8A 2W2CA 3ER7A 3T8NA 3FZWA 1BUQA 1OF5A 1OPYA 2BMQB 1NU3A 1Q40A 1S5AA 4XBTA
chains in the Genus database with same CATH superfamily
2L1SA 1OGXA 3A5EA 3NQYA 4FCZA 3WA3A 3SEDA 3I0YA 5LC6A 1IV9A 2CX1A 2Z7AA 3M8CA 3AGOA 3K9MC 4XBYA 3D4AA 1JN5A 1ZX2A 2WOFA 3D79A 1IVXA 1OGZA 2MF7A 5AIIA 2ZDJA 2D1WA 2Q07A 3KCHA 5AIGA 2XGLA 2P05A 5G1LA 4CPKA 4L7KA 2ZL8A 4KVHA 2IA7A 1BGSA 4HZ9B 1NB3I 6STDA 2F4YA 2GEYA 3UJMA 1OACA 3X40A 2XGNA 2XRXB 2GSPA 4NHFA 2HMNB 3G6E3 3AHWA 1U5OA 2XH9A 7RNTA 3FLJA 1RDSA 2FNQA 3N8BA 4MMZB 4WWUC 4KFDA 3O8YA 2BHMA 2CIUA 3A76A 3FH1A 3ZG0A 4EV5A 1AR0A 1FUSA 1A2VA 1QALA 4H3UA 3CMA3 1D6UA 4N6LA 3U97A 1VQO3 4I4KA 1ZS7A 1RMSA 3QRDA 1GSPA 1QJGA 1JZDA 3F7SA 1W4NA 4EXRA 1YIJ3 1X1YA 3CC43 3URPA 4WHAA 2P09A 1BNSA 4FCMA 3CC73 3SVAA 1O7MB 1DVDA 3RGAA 3MHEA 3AGNA 3JUQA 3F40A 1HU9A 4HM6B 2YFJB 5LC7A 3SX1A 4JF8A 1K41A 5CXOA 1DE3A 4EYCA 4MMYB 3ROBA 1CEWI 2I9WA 1GYBA 3X42A 1ULIB 3GWRA 1LOYA 4AKYA 5AIHA 3DGMA 2SBLA 4BL2A 5JPUA 4O2HA 1MWTA 2RFRA 2RCDA 3RDEA 3DGYA 4J5KA 3N9HA 5M1AA 4K1UA 1RGAA 5AEUB 1RGEA 6GSPA 1EQKA 1SIIA 2KCDA 3NM7A 4R9KA 2C11A 3T0UA 3B7CA 2KXGA 1JBSA 4MJDA 1AY7A 1Q864 5IG3A 1N5HA 3CCE3 1BRSA 2AAEA 2IY2A 1VQ93 1TRPA 2BNGA 2CWUA 3CCL3 3OWYA 2CFWA 2W6JH 4PEJA 1OHSA 3CCU3 5IG5A 1BSAA 1TJDA 1IYYA 2HMMB 1N8R4 1BSDA 2W9PA 3PXMA 1FGMA 1PYLA 2E2TA 1MGWA 4K90B 5EQLA 3MPHA 1Q824 3H51A 2XFTA 2KAAA 4FMAA 1B2UA 2BMRB 1TUHA 2IYJA 1JRQA 4O8SA 2W56A 4J5GA 4N6TA 4RNZA 4FMBA 4GL6A 1C7HA 2O9UX 2F99A 3X3YA 3CCV3 2WO0A 1RNTA 5AYRB 1LXEA 1NJI4 1W01A 1UCJA 5KP4A 1VQ83 3MG1A 1OH0A 1JBRA 1I2GA 1NO3A 3PCSA 9RNTA 1RJOA 1BNEA 1UGIA 3OWSA 2JQ5A 7GSPA 2CFLA 1FUWA 1RGLA 4CDLA 1D6YA 1UDII 1SQWA 3CME3 5IG0A 3CPOA 4RBNA 2CKFB 4BTWA 3UL6A 1KSIA 1JKGB 2CH9A 3OX9A 2RSXA 2MC8A 2E2UA 3FG4A 5BVBA 3CCQ3 1U8CB 2Z77A 3EF8A 2XFSA 4QWTA 1DYUA 3GSPA 4L8PA 1TIJA 2QGUA 4HJLB 1W6CA 3FCSB 2YFLB 1RLSA 1N5PA 5AEWB 1N9EA 5A0OB 1S723 4AKZA 3T8UA 4IIAA 3DXOA 1FUTA 1UCIA 1O7WB 3FGYA 5EEOA 3SYUA 1B2MA 1DETA 3FG1A 2BIRA 2PNCA 4BU4A 3OW22 3CC23 1JB5A 5IEPA 3PS8A 5KP1A 1OHOA 1WTHA 1E3VA 2XF3A 1M1K4 2CWVA 1RRLA 3RNTA 1AVLA 1NWWA 1RN1A 5RNTA 1SARA 3CXC2 2GU1A 2KF3A 5IERA 1I3FA 1TTOA 1UW1A 4X2HA 3S27A 1TRQA 5STDA 1B21A 1VQP3 1BRIA 3MKIA 5FW5A 1LQGC 3GZBA 1VQ43 1I2FA 2M7OA 3ZG5A 1OHPA 1GD4A 2Y74A 1FA3A 1STFI 4O3VA 5AYSC 3ZFZA 1VQK3 3G4S3 1X1UA 1VQ73 4HKVB 3EBYA 4R4KA 2QEX3 2HMOB 1HKXA 4R1KA 1B3SA 2CWTA 1BRHA 2Y73A 1GMQA 1M904 2J8XB 4R9LA 1JBTA 2IUJA 1TU5A 3F14A 2GBXB 3GZRA 1RN7A 2OTL3 3BB9A 1Q814 1BNFA 3CNXA 3JUNA 1M9GA 1V57A 1ISKA 3B8LA 1A90A 2INXA 1GD3A 4BIRA 1SPUA 3KN4A 3NM2A 3WOFB 2CFDA 3WHOA 3FF2A 2HMKB 1W6YA 1QVF2 1PFPA 1MWUA 5IF6A 1AVKA 3DZLA 1RN4A 2O3OA 5IEOA 2KF5A 3MG3A 4MMXB 3CD63 3LT8A 2ZHXB 4HM1B 1YHQ3 3TDGA 1BNIA 1IVWA 3CCR3 2LQVA 1QMAA 1IDPA 3L0RA 4WP5A 4L8OA 3CU3A 3FSDA 1OF5B 3BLZA 3D3LA 3F8HA 1NDOB 5M18A 1T2HA 1FGOA 4OVMA 5KP3A 1E97A 2CW9A 1KQS2 1EKMA 3Q3FA 2UUGC 4KFFA 5G1KA 1C54A 3HIGA 3EE1A 1RTUA 3GZYB 2RGQA 1RGCA 2BT3A 1T2IA 3EB8A 1UUVB 3WOEB 3UB1A 1UCKA 1JN5B 3VGNA 3KE7A 1W7CA 1MWSA 3DGOA 3CCM3 3BNEA 5CF2A 1UI8A 3DUKA 3LZAA 3DMCA 3OV4A 3NX0A 1EEJA 3NBJA 1B2SA 3LTBA 2KF6A 1YI23 4HM0B 2CG0A 1RRHA 1D6ZA 2SARA 3IPTA 3DH2A 3IJEB 3RGRA 1RCKA 3D5IA 1DMQA 3S5CA 1YJ93 3ECFA 2UX0A 3AMOA 5TGNA 1MNLA 5HOHA 1KC84 4BL3A 3VF1A 1EA2A 1F8NA 1MWRA 5IW9A 4GHOA 1IVVA 1R4CA 1OCVA 5IG4A 1YJW3 4CCVA 1VQL3 1SJWA 3X3ZA 3LYGA 1BAOA 5CF1A 1IK3A 1BNGA 1J2BA 3STDA 1GY5A 1V74A 5ELUA 1FZUA 4HVNA 3D9RA 3F9SA 3G8ZA 3KSED 2CFGA 3H3HA 2HMJB 1HZ1A 1BUJA 1G02A 2OTJ3 5AIFA 1WMNA 3BIRA 1JJ22 1WMOA 3JUMA 1K28A 4LMIA 2RNTA 5D82A 3KKGA 3Q2PA 3S29A 3HI7A 5DRVA 1RSNA 2V1LA 1W00A 3WODG 4KT3B 5DREA 1G96A 1WQLB 1BOXA 1CH0A 2B1XB 2PZVA 4J9AA 3S28A 1OUNA 4GSPA 1WNHA 3QK9A 2B24B 3LTAA 4O02B 3CCJ3 3I563 2HMLB 1VQN3 1TP6A 4HBRA 2BMOB 3G0KA 3KZTA 3V98A 1O7PB 2H0GA 3LOYA 3DGNA 1BNRA 2CX0A 2Z6BA 3LT9A 2XR8B 4HZBB 5IENA 2OWPA 1VQM3 3EN8A 3GRDA 3I553 1UCLA 1W2B2 4XB5A 4XBXA 4ILFA 4AEQA 3AHSA 2OCTA 2QIYA 5I97A 4HM3B 1VQQA 4N6MA 3B4OA 5ELJA 1DVCA 1A2KA 1RKYA 2OOVA 2KRTA 3FF0A 1I70A 3LH4A 1B2ZA 4HOHA 1IQXA 3B4PA 4NREA 1BRKA 5D81A 1CYVA 2C4BA 1LVNA 2KF4A 3OWUA 4K61A 1BNJA 2W56B 3MG2A 1W2ZA 4FCJA 3GZXB 4K1VA 4STDA 1JZOA 1QAKA 2STDA 1ROAA 2P0MA 2WOHA 4ZM8A 1V58A 1RNBA 1LOVA 2BO9B 1BIRA 3ALAA 4N6UA 3PCRA 1Z1SA 4WYKB 3V99A 4I5QA 2XSHB 1JNQA 4HYZA 1UUWB 3SLUA 3F7XA 3EHCA 5FGOA 1YNVX 3EJVA 1K9M4 4RZMA 2D42A 1I8VA 4HM4B 1NNVA 3NQZA 4LEHA 1R4YA 3DGLA 1CYUA 1L5GB 4JRFA 1RGHA 1STDA 4IT7A 3LXUX 1B2XA 1KWIA 1Q9EA 1UUGB 3PYJA 4XDVA 3CNMA 4BTYA 1YVSA 2YFIB 4G1MB 3LTCA 1B27A 3HZPA 3OXAA 2OOVC 1T3BA 2H0HA 3NV0B 1GOYA 2F5WA 3HOHA 3NXJA 5CK6A 1LRAA 2A15A 3S67A 8RNTA 3MSOA 1EG9B 1O7HB 3NBBA 1YJN3 1SIHA 3N54B 3X41A 3LTDA 3BNDA 1K734 3WMDA 1B20A 2CHCA 1N9JA 1DMMA 1US1A 1JB4A 3K5TA 5BXQA 2IUKA 1T5YA 2GBWB 4OK0A 1Y4KA 1BRNL 1Q40B 1M1XB 4N6OB 2ZA4A 3DM8A 4RNYA 1O7GB 2W9QA 3DY5A 4HM8B 4IPBA 4HM2B 3MYTA 5G2GA 1KD14 1BU4A 2OQEA 1K8A4 1ASKA 3KSPA 1A67A 2W03A 2CC3A 3PZWA 2Z76A 1FYSA 1UI7A 4U13A 1NB5I 1ZO2A 2C10A 2XSOB 3IMAB 3SOAA 3G713 2F5MA 1BSBA 2YX9A 1I0VA 3FKAA 4X2OA 3X3XA 2R4IA 5M19A 4H61A 1VQ63 5AI1A 3WR2A 4RNTA 2FXTA 2ML6A 2W04A 1X1XA 3SOYA 6RNTA 1JKGA 1ROVA 1I2EA 2IMJA 1GOUA 2LYXA 3FG3A 4LYLB 3CCS3 3Q1CA 5JBSA 2AADA 4J8TA 4NPBA 3WDGB 2QA43 4ORLA 1JV2B 2P0XA 4FMDA 3D5GA 4FR9A 1IQ8A 1UGHI 2F98A 1RHLA 2H0IA 1N8QA 2K54A 2ML5A 5HGRA 3J7Yd 1AQZA 1DMNA 1WMPA 4HM7B 3EN1B 4WFOA 1BSEA 3HK4A 1BSCA 2UGIA 3EQQB 1YIT3 3EBTA 1AV4A 2OQEC 4LSOA 1O7NB 4FMCA 1W02A 1BVIA 4LZIA 1VZZA 2R41A 1FW7A 3BNBA 1BRJA 5JPPA 1BANA 3EC9A 4KZ1A 4N6NB 4DKIA 1ULJB 2JDIH 5GSPA 1RCLA 2XEPA 1TFKA 4LGQA 4TX4A 2E2VA 3E99A 1I3IA 1LNIA 3NBRA 1GY7A 4BTXA 4EV2A 5BIRA 3BU4A 3NHXA 3JUPA 3SXXA 3NUVA 1Q7HA 3JUOA 1RGGA 3KIIA 1I0XA 5EVHA 4N3VA 3VSYA 1Q7Y4 1IVUA 1G0TA 1ZGXA 4EC6A 5BU4A 4HAAA 1PU4A 1EUIC 1YVBI 2K0MA 1QVG2 4EBGA 4WYKA 4XM4A 1IT8A 1GOVA 4EW5A 1GS3A 1GY6A 3BNCA 1CQSA 1MGRA 3GAXA 3K63A 3MWZA 4XDWA 7STDA 1A2PA 2F86B 1FGTA 1FGRA 1YGEA 2GU3A 4HM5B 4OUQA 3LMLA 4CJNA 4GB5A 1LNHA 3EX9A 3CPW2 2CK3H 1IV7A 1LQMB 1LOWA 2GEXA 2WGOA 3UNLA 1E3RA 1GMPA 3AMOB 1W6GA 1IQYA 3JVCA 3PGBA 2WGQA 3KFQC 1PY3A 1W5ZA 3K0ZA 3Q90A 2CG1A 2HOHA 4Q53A 5CLKA 2W0QA 3K7CA 2P38A 8CHOA 2CFKA 1Q42A 1X1WA 2RBIA 3G16A 1JB2A 1BRGA 3NV0A 4KFEA 2L4VA 2GXFA 1MOLA 3F8XA 1HYFA 5D83A 3HX8A 4MEIA 1FGQA 3U1WA 1YGWA 3UL5A 3V92A 2W2CA 4R80A 3ER7A 4N6V0 1VQ53 2FGTA 1GMRA 3T8NA 1TFOA 3HIIA 3FZWA 1BUQA 1OF5A 2F56A 1RGFA 3WA2X 2K3DA 1OPYA 1QAFA 1IU7A 1NU3A 2BMQB 2BU4A 1RGKA 1Q40A 1IT7A 1S5AA 4XBTA 1LOXA
chains in the Genus database with same CATH topology
3NQYA 1OGXA 4FCZA 3WA3A 3SEDA 3I0YA 5LC6A 1IV9A 2Z7AA 3M8CA 3K9MC 4XBYA 1JN5A 1ZX2A 2WOFA 5AIIA 1IVXA 1OGZA 2MF7A 5JBSA 2ZDJA 2D1WA 2Q07A 5AIGA 2XGLA 2P05A 4L7KA 2ZL8A 4KVHA 2IA7A 4HZ9B 1NB3I 6STDA 2GEYA 3X40A 3UJMA 1OACA 2XGNA 2XRXB 4NHFA 2HMNB 3G6E3 1U5OA 2XH9A 3FLJA 2FNQA 3N8BA 4MMZB 4WWUC 4KFDA 3O8YA 2BHMA 2CIUA 3A76A 3FH1A 4EV5A 1AR0A 1A2VA 1QALA 4H3UA 3CMA3 1D6UA 4N6LA 3U97A 1VQO3 4I4KA 3QRDA 1QJGA 3F7SA 1W4NA 4EXRA 1YIJ3 3CC43 4WHAA 2P09A 4FCMA 3CC73 3SVAA 1O7MB 1DVDA 3RGAA 3MHEA 3JUQA 3F40A 1HU9A 4HM6B 2YFJB 5LC7A 3SX1A 4JF8A 1K41A 5CXOA 4EYCA 4MMYB 3ROBA 1CEWI 2I9WA 1GYBA 3X42A 1ULIB 3GWRA 4AKYA 5AIHA 3DGMA 2SBLA 5JPUA 4O2HA 2RFRA 2RCDA 3RDEA 3N9HA 4K1UA 5AEUB 1EQKA 1SIIA 2KCDA 3NM7A 4R9KA 2C11A 3T0UA 3B7CA 2KXGA 4MJDA 1Q864 5IG3A 1N5HA 3CCE3 1VQ93 2BNGA 2CWUA 3CCL3 3OWYA 2CFWA 2W6JH 4PEJA 1OHSA 3CCU3 5IG5A 2HMMB 1N8R4 2W9PA 3PXMA 1FGMA 2E2TA 4K90B 5EQLA 3MPHA 1Q824 3H51A 2XFTA 4FMAA 2BMRB 1TUHA 1JRQA 4O8SA 2W56A 4N6TA 4RNZA 4FMBA 4GL6A 1C7HA 2O9UX 2F99A 3X3YA 3CCV3 2WO0A 5AYRB 1LXEA 1NJI4 1W01A 5KP4A 1VQ83 3MG1A 1OH0A 1NO3A 3PCSA 1RJOA 3OWSA 2JQ5A 2CFLA 1FUWA 4CDLA 1D6YA 1SQWA 3CME3 5IG0A 3CPOA 4RBNA 2CKFB 4BTWA 3UL6A 1KSIA 1JKGB 2CH9A 3OX9A 2RSXA 2MC8A 2E2UA 3FG4A 5BVBA 3CCQ3 1U8CB 2Z77A 3EF8A 2XFSA 4QWTA 1DYUA 4L8PA 1TIJA 2QGUA 4HJLB 1W6CA 3FCSB 2YFLB 1N5PA 5AEWB 1N9EA 5A0OB 1S723 4AKZA 3T8UA 4IIAA 3DXOA 1O7WB 3FGYA 5EEOA 3FG1A 2PNCA 3OW22 3CC23 1JB5A 5IEPA 3PS8A 5KP1A 1OHOA 1WTHA 1E3VA 2XF3A 1M1K4 2CWVA 1RRLA 1AVLA 1NWWA 3CXC2 2GU1A 5IERA 1UW1A 4X2HA 3S27A 5STDA 1VQP3 3MKIA 5FW5A 3GZBA 1VQ43 2M7OA 1OHPA 1GD4A 2Y74A 1FA3A 1STFI 4O3VA 1VQK3 3G4S3 1VQ73 4HKVB 3EBYA 4R4KA 2QEX3 2HMOB 1HKXA 4R1KA 2CWTA 2Y73A 1M904 4R9LA 2IUJA 3F14A 2GBXB 3GZRA 1RN7A 2OTL3 3BB9A 1Q814 3CNXA 3JUNA 1M9GA 1ISKA 3B8LA 1A90A 2INXA 1GD3A 1SPUA 3KN4A 3NM2A 3WOFB 2CFDA 3FF2A 2HMKB 1W6YA 1QVF2 1PFPA 5IF6A 1AVKA 3DZLA 2O3OA 5IEOA 3MG3A 4MMXB 3CD63 3LT8A 4HM1B 1YHQ3 3TDGA 1IVWA 3CCR3 2LQVA 1QMAA 1IDPA 3L0RA 4WP5A 4L8OA 3CU3A 3FSDA 1OF5B 3BLZA 3D3LA 3F8HA 1NDOB 1FGOA 4OVMA 5KP3A 1E97A 2CW9A 1KQS2 1EKMA 4KFFA 3HIGA 3EE1A 3GZYB 2RGQA 2BT3A 3EB8A 1UUVB 3WOEB 3UB1A 1JN5B 3VGNA 3KE7A 1W7CA 3DGOA 3CCM3 3BNEA 5CF2A 1UI8A 3DUKA 3LZAA 3DMCA 3OV4A 3NX0A 3NBJA 1YI23 3LTBA 4HM0B 2CG0A 1RRHA 1D6ZA 3IPTA 3RGRA 3IJEB 1DMQA 3S5CA 1YJ93 3ECFA 2UX0A 3AMOA 5TGNA 1MNLA 1KC84 3VF1A 1EA2A 1F8NA 5IW9A 1IVVA 1R4CA 1OCVA 5IG4A 1YJW3 4CCVA 1VQL3 1SJWA 3X3ZA 3LYGA 5CF1A 1IK3A 1J2BA 3STDA 1GY5A 1V74A 5ELUA 4HVNA 3D9RA 3F9SA 3G8ZA 3KSED 2CFGA 3H3HA 2HMJB 2OTJ3 5AIFA 1WMNA 1JJ22 1WMOA 3JUMA 1K28A 4LMIA 5D82A 3KKGA 3Q2PA 3S29A 3HI7A 5DRVA 2V1LA 1W00A 3WODG 5DREA 1G96A 1WQLB 2B1XB 4J9AA 2PZVA 3S28A 1OUNA 1WNHA 3QK9A 2B24B 3LTAA 4O02B 3CCJ3 3I563 2HMLB 1VQN3 1TP6A 4HBRA 2BMOB 3G0KA 3KZTA 3V98A 1O7PB 3LOYA 3DGNA 2Z6BA 3LT9A 2XR8B 4HZBB 5IENA 2OWPA 1VQM3 3EN8A 3GRDA 3I553 1W2B2 4XB5A 4XBXA 4AEQA 2OCTA 2QIYA 5I97A 4HM3B 4N6MA 3B4OA 5ELJA 1DVCA 1A2KA 1RKYA 2OOVA 2KRTA 3FF0A 3LH4A 1IQXA 3B4PA 4NREA 5D81A 1CYVA 1LVNA 3OWUA 4K61A 2W56B 3MG2A 4FCJA 1W2ZA 3GZXB 4K1VA 4STDA 1QAKA 2STDA 1ROAA 2P0MA 2WOHA 4ZM8A 2BO9B 3ALAA 4N6UA 3PCRA 1Z1SA 4WYKB 3V99A 2XSHB 1JNQA 4HYZA 1UUWB 3SLUA 3F7XA 3EHCA 5FGOA 1K9M4 3EJVA 4RZMA 2D42A 4HM4B 3NQZA 4LEHA 3DGLA 1CYUA 1L5GB 4JRFA 1STDA 4IT7A 3LXUX 1KWIA 3PYJA 4XDVA 3CNMA 4BTYA 2YFIB 4G1MB 3LTCA 3HZPA 3OXAA 2OOVC 5CK6A 3NV0B 3NXJA 3S67A 2A15A 3MSOA 1EG9B 1O7HB 3NBBA 1YJN3 1SIHA 3N54B 3X41A 3LTDA 3BNDA 1K734 3WMDA 2CHCA 1N9JA 1DMMA 1US1A 1JB4A 3K5TA 5BXQA 2IUKA 1T5YA 2GBWB 4OK0A 1Y4KA 1Q40B 1M1XB 4N6OB 3DM8A 4RNYA 1O7GB 2W9QA 3DY5A 4HM8B 4IPBA 4HM2B 3MYTA 5G2GA 1KD14 2OQEA 1K8A4 1ASKA 3KSPA 1A67A 2W03A 2CC3A 3PZWA 2Z76A 1UI7A 4U13A 1NB5I 1ZO2A 2C10A 2XSOB 3IMAB 3SOAA 3G713 2YX9A 3FKAA 4X2OA 3X3XA 2R4IA 4H61A 1VQ63 5AI1A 2FXTA 2ML6A 2W04A 3SOYA 1JKGA 1ROVA 2IMJA 2LYXA 3FG3A 3CCS3 3Q1CA 2QA43 4J8TA 3WDGB 4ORLA 1JV2B 2P0XA 4FMDA 4FR9A 1IQ8A 2F98A 2K54A 1N8QA 2ML5A 5HGRA 3J7Yd 1DMNA 1WMPA 4HM7B 3EN1B 4WFOA 3HK4A 3EQQB 1YIT3 3EBTA 1AV4A 2OQEC 4LSOA 1O7NB 4FMCA 1W02A 4LZIA 1VZZA 3BNBA 5JPPA 3EC9A 4KZ1A 4N6NB 1ULJB 2JDIH 4LGQA 2XEPA 1TFKA 4TX4A 1TU5A 2E2VA 3E99A 3NBRA 4BTXA 1GY7A 4EV2A 3NHXA 3JUPA 3SXXA 3NUVA 3JUOA 5EVHA 3KIIA 3VSYA 1Q7Y4 4N3VA 1IVUA 4EC6A 1PU4A 1YVBI 2K0MA 1QVG2 4EBGA 4WYKA 4XM4A 1IT8A 1GS3A 1GY6A 3BNCA 1CQSA 3GAXA 3K63A 3MWZA 4XDWA 7STDA 2F86B 1FGTA 1FGRA 1YGEA 2GU3A 4HM5B 4OUQA 3LMLA 4GB5A 1LNHA 3EX9A 3CPW2 2CK3H 1IV7A 2GEXA 2WGOA 3UNLA 1E3RA 3AMOB 3JVCA 1W6GA 1IQYA 3PGBA 5AYSC 2WGQA 3KFQC 2CG1A 1W5ZA 3K0ZA 3Q90A 4Q53A 5CLKA 2W0QA 3K7CA 2P38A 8CHOA 2CFKA 1Q42A 3G16A 1JB2A 3NV0A 4KFEA 2L4VA 2GXFA 1MOLA 3F8XA 5D83A 3HX8A 4MEIA 1FGQA 3U1WA 3UL5A 3V92A 2W2CA 4R80A 3ER7A 4N6V0 1VQ53 2FGTA 3T8NA 1TFOA 3HIIA 3FZWA 1BUQA 1OF5A 3WA2X 1OPYA 1QAFA 1IU7A 1NU3A 2BMQB 1Q40A 1IT7A 1S5AA 4XBTA 1LOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGX A;  3SED A;  3I0Y A;  2Z7A A;  3M8C A;  4XBY A;  1JN5 A;  1ZX2 A;  5AII A;  1OGZ A;  5AIG A;  4L7K A;  4KVH A;  4HZ9 B;  6STD A;  2GEY A;  3UJM A;  2XRX B;  2HMN B;  1U5O A;  3FLJ A;  4WWU C;  3A76 A;  3FH1 A;  1AR0 A;  4H3U A;  4I4K A;  1QJG A;  3F7S A;  4FCM A;  1O7M B;  3RGA A;  3MHE A;  3JUQ A;  3F40 A;  4HM6 B;  2YFJ B;  1K41 A;  5CXO A;  3ROB A;  2I9W A;  1GYB A;  1ULI B;  3GWR A;  5AIH A;  5JPU A;  2RFR A;  2RCD A;  4K1U A;  5AEU B;  4R9K A;  3B7C A;  4MJD A;  5IG3 A;  2BNG A;  3OWY A;  4PEJ A;  1OHS A;  5IG5 A;  2HMM B;  3H51 A;  2BMR B;  1TUH A;  1C7H A;  2F99 A;  1W01 A;  5KP4 A;  3MG1 A;  1OH0 A;  3OWS A;  2JQ5 A;  4CDL A;  5IG0 A;  3CPO A;  2CKF B;  1JKG B;  3OX9 A;  5BVB A;  3EF8 A;  2Z77 A;  4L8P A;  2QGU A;  4HJL B;  2YFL B;  5AEW B;  3T8U A;  4IIA A;  3DXO A;  1O7W B;  3FGY A;  1JB5 A;  5IEP A;  5KP1 A;  1OHO A;  1E3V A;  1NWW A;  5IER A;  4X2H A;  5STD A;  3MKI A;  5FW5 A;  3GZB A;  1OHP A;  4HKV B;  3EBY A;  2HMO B;  1HKX A;  4R1K A;  4R9L A;  3F14 A;  2GBX B;  3GZR A;  3BB9 A;  3CNX A;  3JUN A;  1ISK A;  3B8L A;  2INX A;  3NM2 A;  3FF2 A;  2HMK B;  1W6Y A;  5IF6 A;  3DZL A;  5IEO A;  3MG3 A;  4HM1 B;  1QMA A;  1IDP A;  4WP5 A;  4L8O A;  3CU3 A;  3FSD A;  1OF5 B;  3BLZ A;  3F8H A;  1NDO B;  4OVM A;  5KP3 A;  1E97 A;  3GZY B;  2RGQ A;  1UUV B;  1JN5 B;  3VGN A;  3KE7 A;  5CF2 A;  3DUK A;  3LZA A;  3DMC A;  3OV4 A;  4HM0 B;  3IPT A;  3RGR A;  1DMQ A;  3S5C A;  3ECF A;  2UX0 A;  5TGN A;  1EA2 A;  1OCV A;  5IG4 A;  1SJW A;  3LYG A;  5CF1 A;  3STD A;  1GY5 A;  4HVN A;  3D9R A;  3F9S A;  3G8Z A;  3H3H A;  2HMJ B;  5AIF A;  3JUM A;  4LMI A;  5D82 A;  3KKG A;  5DRV A;  1W00 A;  5DRE A;  2B1X B;  1WQL B;  4J9A A;  2PZV A;  1OUN A;  2B24 B;  2HML B;  1TP6 A;  2BMO B;  3G0K A;  3KZT A;  1O7P B;  2XR8 B;  4HZB B;  5IEN A;  2OWP A;  3EN8 A;  3GRD A;  4XB5 A;  4XBX A;  2QIY A;  4HM3 B;  3B4O A;  1A2K A;  3FF0 A;  3B4P A;  5D81 A;  3OWU A;  3MG2 A;  4FCJ A;  3GZX B;  4K1V A;  4STD A;  2STD A;  1Z1S A;  4WYK B;  2XSH B;  1UUW B;  3F7X A;  3EHC A;  3EJV A;  4RZM A;  4HM4 B;  4LEH A;  1STD A;  4XDV A;  3CNM A;  2YFI B;  3HZP A;  3OXA A;  5CK6 A;  3NV0 B;  3NXJ A;  2A15 A;  3MSO A;  1EG9 B;  1O7H B;  3WMD A;  2CHC A;  1DMM A;  1JB4 A;  5BXQ A;  2GBW B;  1Q40 B;  3DM8 A;  1O7G B;  4HM8 B;  4HM2 B;  3MYT A;  5G2G A;  1ASK A;  3KSP A;  2Z76 A;  4U13 A;  1ZO2 A;  2XSO B;  3SOA A;  3FKA A;  4X2O A;  2R4I A;  5AI1 A;  3SOY A;  1JKG A;  2IMJ A;  4J8T A;  4ORL A;  2F98 A;  2K54 A;  5HGR A;  1DMN A;  4HM7 B;  3EN1 B;  3HK4 A;  3EQQ B;  3EBT A;  1O7N B;  1W02 A;  1VZZ A;  5JPP A;  3EC9 A;  1ULJ B;  4LGQ A;  3E99 A;  3NBR A;  1GY7 A;  3NHX A;  3JUP A;  3NUV A;  3JUO A;  5EVH A;  3VSY A;  4N3V A;  4WYK A;  4XM4 A;  1GS3 A;  1GY6 A;  1CQS A;  4XDW A;  7STD A;  2F86 B;  4OUQ A;  4HM5 B;  4GB5 A;  3EX9 A;  2GEX A;  3UNL A;  1E3R A;  3Q90 A;  3K0Z A;  4Q53 A;  5CLK A;  3K7C A;  8CHO A;  1Q42 A;  3G16 A;  1JB2 A;  3NV0 A;  2GXF A;  3F8X A;  5D83 A;  3HX8 A;  2W2C A;  3ER7 A;  3T8N A;  3FZW A;  1BUQ A;  1OF5 A;  1OPY A;  2BMQ B;  1NU3 A;  1Q40 A;  1S5A A;  4XBT A; 
#chains in the Genus database with same CATH topology
 2L1S A;  1OGX A;  3A5E A;  3NQY A;  4FCZ A;  3WA3 A;  3SED A;  3I0Y A;  5LC6 A;  1IV9 A;  2CX1 A;  2Z7A A;  3M8C A;  3AGO A;  3K9M C;  4XBY A;  3D4A A;  1JN5 A;  1ZX2 A;  2WOF A;  3D79 A;  1IVX A;  1OGZ A;  2MF7 A;  5AII A;  2ZDJ A;  2D1W A;  2Q07 A;  3KCH A;  5AIG A;  2XGL A;  2P05 A;  5G1L A;  4CPK A;  4L7K A;  2ZL8 A;  4KVH A;  2IA7 A;  1BGS A;  4HZ9 B;  1NB3 I;  6STD A;  2F4Y A;  2GEY A;  3UJM A;  1OAC A;  3X40 A;  2XGN A;  2XRX B;  2GSP A;  4NHF A;  2HMN B;  3G6E 3;  3AHW A;  1U5O A;  2XH9 A;  7RNT A;  3FLJ A;  1RDS A;  2FNQ A;  3N8B A;  4MMZ B;  4WWU C;  4KFD A;  3O8Y A;  2BHM A;  2CIU A;  3A76 A;  3FH1 A;  3ZG0 A;  4EV5 A;  1AR0 A;  1FUS A;  1A2V A;  1QAL A;  4H3U A;  3CMA 3;  1D6U A;  4N6L A;  3U97 A;  1VQO 3;  4I4K A;  1ZS7 A;  1RMS A;  3QRD A;  1GSP A;  1QJG A;  1JZD A;  3F7S A;  1W4N A;  4EXR A;  1YIJ 3;  1X1Y A;  3CC4 3;  3URP A;  4WHA A;  2P09 A;  1BNS A;  4FCM A;  3CC7 3;  3SVA A;  1O7M B;  1DVD A;  3RGA A;  3MHE A;  3AGN A;  3JUQ A;  3F40 A;  1HU9 A;  4HM6 B;  2YFJ B;  5LC7 A;  3SX1 A;  4JF8 A;  1K41 A;  5CXO A;  1DE3 A;  4EYC A;  4MMY B;  3ROB A;  1CEW I;  2I9W A;  1GYB A;  3X42 A;  1ULI B;  3GWR A;  1LOY A;  4AKY A;  5AIH A;  3DGM A;  2SBL A;  4BL2 A;  5JPU A;  4O2H A;  1MWT A;  2RFR A;  2RCD A;  3RDE A;  3DGY A;  4J5K A;  3N9H A;  5M1A A;  4K1U A;  1RGA A;  5AEU B;  1RGE A;  6GSP A;  1EQK A;  1SII A;  2KCD A;  3NM7 A;  4R9K A;  2C11 A;  3T0U A;  3B7C A;  2KXG A;  1JBS A;  4MJD A;  1AY7 A;  1Q86 4;  5IG3 A;  1N5H A;  3CCE 3;  1BRS A;  2AAE A;  2IY2 A;  1VQ9 3;  1TRP A;  2BNG A;  2CWU A;  3CCL 3;  3OWY A;  2CFW A;  2W6J H;  4PEJ A;  1OHS A;  3CCU 3;  5IG5 A;  1BSA A;  1TJD A;  1IYY A;  2HMM B;  1N8R 4;  1BSD A;  2W9P A;  3PXM A;  1FGM A;  1PYL A;  2E2T A;  1MGW A;  4K90 B;  5EQL A;  3MPH A;  1Q82 4;  3H51 A;  2XFT A;  2KAA A;  4FMA A;  1B2U A;  2BMR B;  1TUH A;  2IYJ A;  1JRQ A;  4O8S A;  2W56 A;  4J5G A;  4N6T A;  4RNZ A;  4FMB A;  4GL6 A;  1C7H A;  2O9U X;  2F99 A;  3X3Y A;  3CCV 3;  2WO0 A;  1RNT A;  5AYR B;  1LXE A;  1NJI 4;  1W01 A;  1UCJ A;  5KP4 A;  1VQ8 3;  3MG1 A;  1OH0 A;  1JBR A;  1I2G A;  1NO3 A;  3PCS A;  9RNT A;  1RJO A;  1BNE A;  1UGI A;  3OWS A;  2JQ5 A;  7GSP A;  2CFL A;  1FUW A;  1RGL A;  4CDL A;  1D6Y A;  1UDI I;  1SQW A;  3CME 3;  5IG0 A;  3CPO A;  4RBN A;  2CKF B;  4BTW A;  3UL6 A;  1KSI A;  1JKG B;  2CH9 A;  3OX9 A;  2RSX A;  2MC8 A;  2E2U A;  3FG4 A;  5BVB A;  3CCQ 3;  1U8C B;  2Z77 A;  3EF8 A;  2XFS A;  4QWT A;  1DYU A;  3GSP A;  4L8P A;  1TIJ A;  2QGU A;  4HJL B;  1W6C A;  3FCS B;  2YFL B;  1RLS A;  1N5P A;  5AEW B;  1N9E A;  5A0O B;  1S72 3;  4AKZ A;  3T8U A;  4IIA A;  3DXO A;  1FUT A;  1UCI A;  1O7W B;  3FGY A;  5EEO A;  3SYU A;  1B2M A;  1DET A;  3FG1 A;  2BIR A;  2PNC A;  4BU4 A;  3OW2 2;  3CC2 3;  1JB5 A;  5IEP A;  3PS8 A;  5KP1 A;  1OHO A;  1WTH A;  1E3V A;  2XF3 A;  1M1K 4;  2CWV A;  1RRL A;  3RNT A;  1AVL A;  1NWW A;  1RN1 A;  5RNT A;  1SAR A;  3CXC 2;  2GU1 A;  2KF3 A;  5IER A;  1I3F A;  1TTO A;  1UW1 A;  4X2H A;  3S27 A;  1TRQ A;  5STD A;  1B21 A;  1VQP 3;  1BRI A;  3MKI A;  5FW5 A;  1LQG C;  3GZB A;  1VQ4 3;  1I2F A;  2M7O A;  3ZG5 A;  1OHP A;  1GD4 A;  2Y74 A;  1FA3 A;  1STF I;  4O3V A;  5AYS C;  3ZFZ A;  1VQK 3;  3G4S 3;  1X1U A;  1VQ7 3;  4HKV B;  3EBY A;  4R4K A;  2QEX 3;  2HMO B;  1HKX A;  4R1K A;  1B3S A;  2CWT A;  1BRH A;  2Y73 A;  1GMQ A;  1M90 4;  2J8X B;  4R9L A;  1JBT A;  2IUJ A;  1TU5 A;  3F14 A;  2GBX B;  3GZR A;  1RN7 A;  2OTL 3;  3BB9 A;  1Q81 4;  1BNF A;  3CNX A;  3JUN A;  1M9G A;  1V57 A;  1ISK A;  3B8L A;  1A90 A;  2INX A;  1GD3 A;  4BIR A;  1SPU A;  3KN4 A;  3NM2 A;  3WOF B;  2CFD A;  3WHO A;  3FF2 A;  2HMK B;  1W6Y A;  1QVF 2;  1PFP A;  1MWU A;  5IF6 A;  1AVK A;  3DZL A;  1RN4 A;  2O3O A;  5IEO A;  2KF5 A;  3MG3 A;  4MMX B;  3CD6 3;  3LT8 A;  2ZHX B;  4HM1 B;  1YHQ 3;  3TDG A;  1BNI A;  1IVW A;  3CCR 3;  2LQV A;  1QMA A;  1IDP A;  3L0R A;  4WP5 A;  4L8O A;  3CU3 A;  3FSD A;  1OF5 B;  3BLZ A;  3D3L A;  3F8H A;  1NDO B;  5M18 A;  1T2H A;  1FGO A;  4OVM A;  5KP3 A;  1E97 A;  2CW9 A;  1KQS 2;  1EKM A;  3Q3F A;  2UUG C;  4KFF A;  5G1K A;  1C54 A;  3HIG A;  3EE1 A;  1RTU A;  3GZY B;  2RGQ A;  1RGC A;  2BT3 A;  1T2I A;  3EB8 A;  1UUV B;  3WOE B;  3UB1 A;  1UCK A;  1JN5 B;  3VGN A;  3KE7 A;  1W7C A;  1MWS A;  3DGO A;  3CCM 3;  3BNE A;  5CF2 A;  1UI8 A;  3DUK A;  3LZA A;  3DMC A;  3OV4 A;  3NX0 A;  1EEJ A;  3NBJ A;  1B2S A;  3LTB A;  2KF6 A;  1YI2 3;  4HM0 B;  2CG0 A;  1RRH A;  1D6Z A;  2SAR A;  3IPT A;  3DH2 A;  3IJE B;  3RGR A;  1RCK A;  3D5I A;  1DMQ A;  3S5C A;  1YJ9 3;  3ECF A;  2UX0 A;  3AMO A;  5TGN A;  1MNL A;  5HOH A;  1KC8 4;  4BL3 A;  3VF1 A;  1EA2 A;  1F8N A;  1MWR A;  5IW9 A;  4GHO A;  1IVV A;  1R4C A;  1OCV A;  5IG4 A;  1YJW 3;  4CCV A;  1VQL 3;  1SJW A;  3X3Z A;  3LYG A;  1BAO A;  5CF1 A;  1IK3 A;  1BNG A;  1J2B A;  3STD A;  1GY5 A;  1V74 A;  5ELU A;  1FZU A;  4HVN A;  3D9R A;  3F9S A;  3G8Z A;  3KSE D;  2CFG A;  3H3H A;  2HMJ B;  1HZ1 A;  1BUJ A;  1G02 A;  2OTJ 3;  5AIF A;  1WMN A;  3BIR A;  1JJ2 2;  1WMO A;  3JUM A;  1K28 A;  4LMI A;  2RNT A;  5D82 A;  3KKG A;  3Q2P A;  3S29 A;  3HI7 A;  5DRV A;  1RSN A;  2V1L A;  1W00 A;  3WOD G;  4KT3 B;  5DRE A;  1G96 A;  1WQL B;  1BOX A;  1CH0 A;  2B1X B;  2PZV A;  4J9A A;  3S28 A;  1OUN A;  4GSP A;  1WNH A;  3QK9 A;  2B24 B;  3LTA A;  4O02 B;  3CCJ 3;  3I56 3;  2HML B;  1VQN 3;  1TP6 A;  4HBR A;  2BMO B;  3G0K A;  3KZT A;  3V98 A;  1O7P B;  2H0G A;  3LOY A;  3DGN A;  1BNR A;  2CX0 A;  2Z6B A;  3LT9 A;  2XR8 B;  4HZB B;  5IEN A;  2OWP A;  1VQM 3;  3EN8 A;  3GRD A;  3I55 3;  1UCL A;  1W2B 2;  4XB5 A;  4XBX A;  4ILF A;  4AEQ A;  3AHS A;  2OCT A;  2QIY A;  5I97 A;  4HM3 B;  1VQQ A;  4N6M A;  3B4O A;  5ELJ A;  1DVC A;  1A2K A;  1RKY A;  2OOV A;  2KRT A;  3FF0 A;  1I70 A;  3LH4 A;  1B2Z A;  4HOH A;  1IQX A;  3B4P A;  4NRE A;  1BRK A;  5D81 A;  1CYV A;  2C4B A;  1LVN A;  2KF4 A;  3OWU A;  4K61 A;  1BNJ A;  2W56 B;  3MG2 A;  1W2Z A;  4FCJ A;  3GZX B;  4K1V A;  4STD A;  1JZO A;  1QAK A;  2STD A;  1ROA A;  2P0M A;  2WOH A;  4ZM8 A;  1V58 A;  1RNB A;  1LOV A;  2BO9 B;  1BIR A;  3ALA A;  4N6U A;  3PCR A;  1Z1S A;  4WYK B;  3V99 A;  4I5Q A;  2XSH B;  1JNQ A;  4HYZ A;  1UUW B;  3SLU A;  3F7X A;  3EHC A;  5FGO A;  1YNV X;  3EJV A;  1K9M 4;  4RZM A;  2D42 A;  1I8V A;  4HM4 B;  1NNV A;  3NQZ A;  4LEH A;  1R4Y A;  3DGL A;  1CYU A;  1L5G B;  4JRF A;  1RGH A;  1STD A;  4IT7 A;  3LXU X;  1B2X A;  1KWI A;  1Q9E A;  1UUG B;  3PYJ A;  4XDV A;  3CNM A;  4BTY A;  1YVS A;  2YFI B;  4G1M B;  3LTC A;  1B27 A;  3HZP A;  3OXA A;  2OOV C;  1T3B A;  2H0H A;  3NV0 B;  1GOY A;  2F5W A;  3HOH A;  3NXJ A;  5CK6 A;  1LRA A;  2A15 A;  3S67 A;  8RNT A;  3MSO A;  1EG9 B;  1O7H B;  3NBB A;  1YJN 3;  1SIH A;  3N54 B;  3X41 A;  3LTD A;  3BND A;  1K73 4;  3WMD A;  1B20 A;  2CHC A;  1N9J A;  1DMM A;  1US1 A;  1JB4 A;  3K5T A;  5BXQ A;  2IUK A;  1T5Y A;  2GBW B;  4OK0 A;  1Y4K A;  1BRN L;  1Q40 B;  1M1X B;  4N6O B;  2ZA4 A;  3DM8 A;  4RNY A;  1O7G B;  2W9Q A;  3DY5 A;  4HM8 B;  4IPB A;  4HM2 B;  3MYT A;  5G2G A;  1KD1 4;  1BU4 A;  2OQE A;  1K8A 4;  1ASK A;  3KSP A;  1A67 A;  2W03 A;  2CC3 A;  3PZW A;  2Z76 A;  1FYS A;  1UI7 A;  4U13 A;  1NB5 I;  1ZO2 A;  2C10 A;  2XSO B;  3IMA B;  3SOA A;  3G71 3;  2F5M A;  1BSB A;  2YX9 A;  1I0V A;  3FKA A;  4X2O A;  3X3X A;  2R4I A;  5M19 A;  4H61 A;  1VQ6 3;  5AI1 A;  3WR2 A;  4RNT A;  2FXT A;  2ML6 A;  2W04 A;  1X1X A;  3SOY A;  6RNT A;  1JKG A;  1ROV A;  1I2E A;  2IMJ A;  1GOU A;  2LYX A;  3FG3 A;  4LYL B;  3CCS 3;  3Q1C A;  5JBS A;  2AAD A;  4J8T A;  4NPB A;  3WDG B;  2QA4 3;  4ORL A;  1JV2 B;  2P0X A;  4FMD A;  3D5G A;  4FR9 A;  1IQ8 A;  1UGH I;  2F98 A;  1RHL A;  2H0I A;  1N8Q A;  2K54 A;  2ML5 A;  5HGR A;  3J7Y d;  1AQZ A;  1DMN A;  1WMP A;  4HM7 B;  3EN1 B;  4WFO A;  1BSE A;  3HK4 A;  1BSC A;  2UGI A;  3EQQ B;  1YIT 3;  3EBT A;  1AV4 A;  2OQE C;  4LSO A;  1O7N B;  4FMC A;  1W02 A;  1BVI A;  4LZI A;  1VZZ A;  2R41 A;  1FW7 A;  3BNB A;  1BRJ A;  5JPP A;  1BAN A;  3EC9 A;  4KZ1 A;  4N6N B;  4DKI A;  1ULJ B;  2JDI H;  5GSP A;  1RCL A;  2XEP A;  1TFK A;  4LGQ A;  4TX4 A;  2E2V A;  3E99 A;  1I3I A;  1LNI A;  3NBR A;  1GY7 A;  4BTX A;  4EV2 A;  5BIR A;  3BU4 A;  3NHX A;  3JUP A;  3SXX A;  3NUV A;  1Q7H A;  3JUO A;  1RGG A;  3KII A;  1I0X A;  5EVH A;  4N3V A;  3VSY A;  1Q7Y 4;  1IVU A;  1G0T A;  1ZGX A;  4EC6 A;  5BU4 A;  4HAA A;  1PU4 A;  1EUI C;  1YVB I;  2K0M A;  1QVG 2;  4EBG A;  4WYK A;  4XM4 A;  1IT8 A;  1GOV A;  4EW5 A;  1GS3 A;  1GY6 A;  3BNC A;  1CQS A;  1MGR A;  3GAX A;  3K63 A;  3MWZ A;  4XDW A;  7STD A;  1A2P A;  2F86 B;  1FGT A;  1FGR A;  1YGE A;  2GU3 A;  4HM5 B;  4OUQ A;  3LML A;  4CJN A;  4GB5 A;  1LNH A;  3EX9 A;  3CPW 2;  2CK3 H;  1IV7 A;  1LQM B;  1LOW A;  2GEX A;  2WGO A;  3UNL A;  1E3R A;  1GMP A;  3AMO B;  1W6G A;  1IQY A;  3JVC A;  3PGB A;  2WGQ A;  3KFQ C;  1PY3 A;  1W5Z A;  3K0Z A;  3Q90 A;  2CG1 A;  2HOH A;  4Q53 A;  5CLK A;  2W0Q A;  3K7C A;  2P38 A;  8CHO A;  2CFK A;  1Q42 A;  1X1W A;  2RBI A;  3G16 A;  1JB2 A;  1BRG A;  3NV0 A;  4KFE A;  2L4V A;  2GXF A;  1MOL A;  3F8X A;  1HYF A;  5D83 A;  3HX8 A;  4MEI A;  1FGQ A;  3U1W A;  1YGW A;  3UL5 A;  3V92 A;  2W2C A;  4R80 A;  3ER7 A;  4N6V 0;  1VQ5 3;  2FGT A;  1GMR A;  3T8N A;  1TFO A;  3HII A;  3FZW A;  1BUQ A;  1OF5 A;  2F56 A;  1RGF A;  3WA2 X;  2K3D A;  1OPY A;  1QAF A;  1IU7 A;  1NU3 A;  2BMQ B;  2BU4 A;  1RGK A;  1Q40 A;  1IT7 A;  1S5A A;  4XBT A;  1LOX A; 
#chains in the Genus database with same CATH homology
 3NQY A;  1OGX A;  4FCZ A;  3WA3 A;  3SED A;  3I0Y A;  5LC6 A;  1IV9 A;  2Z7A A;  3M8C A;  3K9M C;  4XBY A;  1JN5 A;  1ZX2 A;  2WOF A;  5AII A;  1IVX A;  1OGZ A;  2MF7 A;  5JBS A;  2ZDJ A;  2D1W A;  2Q07 A;  5AIG A;  2XGL A;  2P05 A;  4L7K A;  2ZL8 A;  4KVH A;  2IA7 A;  4HZ9 B;  1NB3 I;  6STD A;  2GEY A;  3X40 A;  3UJM A;  1OAC A;  2XGN A;  2XRX B;  4NHF A;  2HMN B;  3G6E 3;  1U5O A;  2XH9 A;  3FLJ A;  2FNQ A;  3N8B A;  4MMZ B;  4WWU C;  4KFD A;  3O8Y A;  2BHM A;  2CIU A;  3A76 A;  3FH1 A;  4EV5 A;  1AR0 A;  1A2V A;  1QAL A;  4H3U A;  3CMA 3;  1D6U A;  4N6L A;  3U97 A;  1VQO 3;  4I4K A;  3QRD A;  1QJG A;  3F7S A;  1W4N A;  4EXR A;  1YIJ 3;  3CC4 3;  4WHA A;  2P09 A;  4FCM A;  3CC7 3;  3SVA A;  1O7M B;  1DVD A;  3RGA A;  3MHE A;  3JUQ A;  3F40 A;  1HU9 A;  4HM6 B;  2YFJ B;  5LC7 A;  3SX1 A;  4JF8 A;  1K41 A;  5CXO A;  4EYC A;  4MMY B;  3ROB A;  1CEW I;  2I9W A;  1GYB A;  3X42 A;  1ULI B;  3GWR A;  4AKY A;  5AIH A;  3DGM A;  2SBL A;  5JPU A;  4O2H A;  2RFR A;  2RCD A;  3RDE A;  3N9H A;  4K1U A;  5AEU B;  1EQK A;  1SII A;  2KCD A;  3NM7 A;  4R9K A;  2C11 A;  3T0U A;  3B7C A;  2KXG A;  4MJD A;  1Q86 4;  5IG3 A;  1N5H A;  3CCE 3;  1VQ9 3;  2BNG A;  2CWU A;  3CCL 3;  3OWY A;  2CFW A;  2W6J H;  4PEJ A;  1OHS A;  3CCU 3;  5IG5 A;  2HMM B;  1N8R 4;  2W9P A;  3PXM A;  1FGM A;  2E2T A;  4K90 B;  5EQL A;  3MPH A;  1Q82 4;  3H51 A;  2XFT A;  4FMA A;  2BMR B;  1TUH A;  1JRQ A;  4O8S A;  2W56 A;  4N6T A;  4RNZ A;  4FMB A;  4GL6 A;  1C7H A;  2O9U X;  2F99 A;  3X3Y A;  3CCV 3;  2WO0 A;  5AYR B;  1LXE A;  1NJI 4;  1W01 A;  5KP4 A;  1VQ8 3;  3MG1 A;  1OH0 A;  1NO3 A;  3PCS A;  1RJO A;  3OWS A;  2JQ5 A;  2CFL A;  1FUW A;  4CDL A;  1D6Y A;  1SQW A;  3CME 3;  5IG0 A;  3CPO A;  4RBN A;  2CKF B;  4BTW A;  3UL6 A;  1KSI A;  1JKG B;  2CH9 A;  3OX9 A;  2RSX A;  2MC8 A;  2E2U A;  3FG4 A;  5BVB A;  3CCQ 3;  1U8C B;  2Z77 A;  3EF8 A;  2XFS A;  4QWT A;  1DYU A;  4L8P A;  1TIJ A;  2QGU A;  4HJL B;  1W6C A;  3FCS B;  2YFL B;  1N5P A;  5AEW B;  1N9E A;  5A0O B;  1S72 3;  4AKZ A;  3T8U A;  4IIA A;  3DXO A;  1O7W B;  3FGY A;  5EEO A;  3FG1 A;  2PNC A;  3OW2 2;  3CC2 3;  1JB5 A;  5IEP A;  3PS8 A;  5KP1 A;  1OHO A;  1WTH A;  1E3V A;  2XF3 A;  1M1K 4;  2CWV A;  1RRL A;  1AVL A;  1NWW A;  3CXC 2;  2GU1 A;  5IER A;  1UW1 A;  4X2H A;  3S27 A;  5STD A;  1VQP 3;  3MKI A;  5FW5 A;  3GZB A;  1VQ4 3;  2M7O A;  1OHP A;  1GD4 A;  2Y74 A;  1FA3 A;  1STF I;  4O3V A;  1VQK 3;  3G4S 3;  1VQ7 3;  4HKV B;  3EBY A;  4R4K A;  2QEX 3;  2HMO B;  1HKX A;  4R1K A;  2CWT A;  2Y73 A;  1M90 4;  4R9L A;  2IUJ A;  3F14 A;  2GBX B;  3GZR A;  1RN7 A;  2OTL 3;  3BB9 A;  1Q81 4;  3CNX A;  3JUN A;  1M9G A;  1ISK A;  3B8L A;  1A90 A;  2INX A;  1GD3 A;  1SPU A;  3KN4 A;  3NM2 A;  3WOF B;  2CFD A;  3FF2 A;  2HMK B;  1W6Y A;  1QVF 2;  1PFP A;  5IF6 A;  1AVK A;  3DZL A;  2O3O A;  5IEO A;  3MG3 A;  4MMX B;  3CD6 3;  3LT8 A;  4HM1 B;  1YHQ 3;  3TDG A;  1IVW A;  3CCR 3;  2LQV A;  1QMA A;  1IDP A;  3L0R A;  4WP5 A;  4L8O A;  3CU3 A;  3FSD A;  1OF5 B;  3BLZ A;  3D3L A;  3F8H A;  1NDO B;  1FGO A;  4OVM A;  5KP3 A;  1E97 A;  2CW9 A;  1KQS 2;  1EKM A;  4KFF A;  3HIG A;  3EE1 A;  3GZY B;  2RGQ A;  2BT3 A;  3EB8 A;  1UUV B;  3WOE B;  3UB1 A;  1JN5 B;  3VGN A;  3KE7 A;  1W7C A;  3DGO A;  3CCM 3;  3BNE A;  5CF2 A;  1UI8 A;  3DUK A;  3LZA A;  3DMC A;  3OV4 A;  3NX0 A;  3NBJ A;  1YI2 3;  3LTB A;  4HM0 B;  2CG0 A;  1RRH A;  1D6Z A;  3IPT A;  3RGR A;  3IJE B;  1DMQ A;  3S5C A;  1YJ9 3;  3ECF A;  2UX0 A;  3AMO A;  5TGN A;  1MNL A;  1KC8 4;  3VF1 A;  1EA2 A;  1F8N A;  5IW9 A;  1IVV A;  1R4C A;  1OCV A;  5IG4 A;  1YJW 3;  4CCV A;  1VQL 3;  1SJW A;  3X3Z A;  3LYG A;  5CF1 A;  1IK3 A;  1J2B A;  3STD A;  1GY5 A;  1V74 A;  5ELU A;  4HVN A;  3D9R A;  3F9S A;  3G8Z A;  3KSE D;  2CFG A;  3H3H A;  2HMJ B;  2OTJ 3;  5AIF A;  1WMN A;  1JJ2 2;  1WMO A;  3JUM A;  1K28 A;  4LMI A;  5D82 A;  3KKG A;  3Q2P A;  3S29 A;  3HI7 A;  5DRV A;  2V1L A;  1W00 A;  3WOD G;  5DRE A;  1G96 A;  1WQL B;  2B1X B;  4J9A A;  2PZV A;  3S28 A;  1OUN A;  1WNH A;  3QK9 A;  2B24 B;  3LTA A;  4O02 B;  3CCJ 3;  3I56 3;  2HML B;  1VQN 3;  1TP6 A;  4HBR A;  2BMO B;  3G0K A;  3KZT A;  3V98 A;  1O7P B;  3LOY A;  3DGN A;  2Z6B A;  3LT9 A;  2XR8 B;  4HZB B;  5IEN A;  2OWP A;  1VQM 3;  3EN8 A;  3GRD A;  3I55 3;  1W2B 2;  4XB5 A;  4XBX A;  4AEQ A;  2OCT A;  2QIY A;  5I97 A;  4HM3 B;  4N6M A;  3B4O A;  5ELJ A;  1DVC A;  1A2K A;  1RKY A;  2OOV A;  2KRT A;  3FF0 A;  3LH4 A;  1IQX A;  3B4P A;  4NRE A;  5D81 A;  1CYV A;  1LVN A;  3OWU A;  4K61 A;  2W56 B;  3MG2 A;  4FCJ A;  1W2Z A;  3GZX B;  4K1V A;  4STD A;  1QAK A;  2STD A;  1ROA A;  2P0M A;  2WOH A;  4ZM8 A;  2BO9 B;  3ALA A;  4N6U A;  3PCR A;  1Z1S A;  4WYK B;  3V99 A;  2XSH B;  1JNQ A;  4HYZ A;  1UUW B;  3SLU A;  3F7X A;  3EHC A;  5FGO A;  1K9M 4;  3EJV A;  4RZM A;  2D42 A;  4HM4 B;  3NQZ A;  4LEH A;  3DGL A;  1CYU A;  1L5G B;  4JRF A;  1STD A;  4IT7 A;  3LXU X;  1KWI A;  3PYJ A;  4XDV A;  3CNM A;  4BTY A;  2YFI B;  4G1M B;  3LTC A;  3HZP A;  3OXA A;  2OOV C;  5CK6 A;  3NV0 B;  3NXJ A;  3S67 A;  2A15 A;  3MSO A;  1EG9 B;  1O7H B;  3NBB A;  1YJN 3;  1SIH A;  3N54 B;  3X41 A;  3LTD A;  3BND A;  1K73 4;  3WMD A;  2CHC A;  1N9J A;  1DMM A;  1US1 A;  1JB4 A;  3K5T A;  5BXQ A;  2IUK A;  1T5Y A;  2GBW B;  4OK0 A;  1Y4K A;  1Q40 B;  1M1X B;  4N6O B;  3DM8 A;  4RNY A;  1O7G B;  2W9Q A;  3DY5 A;  4HM8 B;  4IPB A;  4HM2 B;  3MYT A;  5G2G A;  1KD1 4;  2OQE A;  1K8A 4;  1ASK A;  3KSP A;  1A67 A;  2W03 A;  2CC3 A;  3PZW A;  2Z76 A;  1UI7 A;  4U13 A;  1NB5 I;  1ZO2 A;  2C10 A;  2XSO B;  3IMA B;  3SOA A;  3G71 3;  2YX9 A;  3FKA A;  4X2O A;  3X3X A;  2R4I A;  4H61 A;  1VQ6 3;  5AI1 A;  2FXT A;  2ML6 A;  2W04 A;  3SOY A;  1JKG A;  1ROV A;  2IMJ A;  2LYX A;  3FG3 A;  3CCS 3;  3Q1C A;  2QA4 3;  4J8T A;  3WDG B;  4ORL A;  1JV2 B;  2P0X A;  4FMD A;  4FR9 A;  1IQ8 A;  2F98 A;  2K54 A;  1N8Q A;  2ML5 A;  5HGR A;  3J7Y d;  1DMN A;  1WMP A;  4HM7 B;  3EN1 B;  4WFO A;  3HK4 A;  3EQQ B;  1YIT 3;  3EBT A;  1AV4 A;  2OQE C;  4LSO A;  1O7N B;  4FMC A;  1W02 A;  4LZI A;  1VZZ A;  3BNB A;  5JPP A;  3EC9 A;  4KZ1 A;  4N6N B;  1ULJ B;  2JDI H;  4LGQ A;  2XEP A;  1TFK A;  4TX4 A;  1TU5 A;  2E2V A;  3E99 A;  3NBR A;  4BTX A;  1GY7 A;  4EV2 A;  3NHX A;  3JUP A;  3SXX A;  3NUV A;  3JUO A;  5EVH A;  3KII A;  3VSY A;  1Q7Y 4;  4N3V A;  1IVU A;  4EC6 A;  1PU4 A;  1YVB I;  2K0M A;  1QVG 2;  4EBG A;  4WYK A;  4XM4 A;  1IT8 A;  1GS3 A;  1GY6 A;  3BNC A;  1CQS A;  3GAX A;  3K63 A;  3MWZ A;  4XDW A;  7STD A;  2F86 B;  1FGT A;  1FGR A;  1YGE A;  2GU3 A;  4HM5 B;  4OUQ A;  3LML A;  4GB5 A;  1LNH A;  3EX9 A;  3CPW 2;  2CK3 H;  1IV7 A;  2GEX A;  2WGO A;  3UNL A;  1E3R A;  3AMO B;  3JVC A;  1W6G A;  1IQY A;  3PGB A;  5AYS C;  2WGQ A;  3KFQ C;  2CG1 A;  1W5Z A;  3K0Z A;  3Q90 A;  4Q53 A;  5CLK A;  2W0Q A;  3K7C A;  2P38 A;  8CHO A;  2CFK A;  1Q42 A;  3G16 A;  1JB2 A;  3NV0 A;  4KFE A;  2L4V A;  2GXF A;  1MOL A;  3F8X A;  5D83 A;  3HX8 A;  4MEI A;  1FGQ A;  3U1W A;  3UL5 A;  3V92 A;  2W2C A;  4R80 A;  3ER7 A;  4N6V 0;  1VQ5 3;  2FGT A;  3T8N A;  1TFO A;  3HII A;  3FZW A;  1BUQ A;  1OF5 A;  3WA2 X;  1OPY A;  1QAF A;  1IU7 A;  1NU3 A;  2BMQ B;  1Q40 A;  1IT7 A;  1S5A A;  4XBT A;  1LOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...