5IEPA

Structure of cdl2.3b, a computationally designed vitamin-d3 binder
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
121
Chain Sequence
QSAKEAIEAALADFVKVYNSKDAAGVASKYMDDAAIFPLDMAPVDGRQNIQKLWQGLMDMGVSEPKFTTLNVQKSGDFAFESGSFSLKGPLVDIAGIYVEVWRKGQDGGWKLYRTIANLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords CDL2.3b
publication title Structure of CDL2.3b, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
total genus 37
structure length 121
sequence length 126
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iepA00
3RGAA 3BLZA 1OGXA 4XDVA 1U5OA 5BXQA 4HKVB 3JUMA 2IMJA 5AIFA 2HMKB 1O7GB 3DMCA 5G2GA 2XSOB 4PEJA 2Z76A 2YFLB 2F86B 2XR8B 1S5AA 2OWPA 7STDA 3JUPA 3G8ZA 4HM7B 1OF5A 5IEPA 1AR0A 3SOAA 3GZYB 3ER7A 2I9WA 2HMOB 3OWYA 4GB5A 3A76A 2XSHB 3GZRA 2B1XB 4X2OA 4L7KA 1OHPA 1ULJB 3T8UA 1GY7A 1E97A 1O7MB 4XDWA 3T8NA 5AEUB 3MSOA 1W6YA 4IIAA 2BMRB 5JPUA 3F8HA 3GWRA 4HZ9B 2YFJB 2XRXB 2GBWB 3IPTA 1JB2A 3LZAA 3VGNA 5D81A 1A2KA 1DMNA 1UUVB 2K54A 4HM6B 3H3HA 3EQQB 4XBYA 3OV4A 2RFRA 1NWWA 3M8CA 3EJVA 4K1UA 1DMQA 1GYBA 1STDA 2A15A 5CXOA 3HX8A 5JPPA 1Q40B 1UUWB 5HGRA 5AEWB 4H3UA 1BUQA 3JUQA 3NV0B 8CHOA 4Q53A 1O7NB 3KE7A 4HM2B 3G0KA 3FF0A 4R9LA 3VSYA 3GZBA 1EA2A 5IG5A 3SEDA 1OUNA 2QGUA 2GBXB 4WP5A 3CNXA 3F40A 1Q40A 1Q42A 1O7PB 3B4OA 4HM5B 1W00A 1TUHA 2JQ5A 2RGQA 3NBRA 2Z77A 4OUQA 4MJDA 1W01A 3FZWA 3S5CA 1EG9B 2HMJB 3FLJA 5KP3A 4R9KA 3NXJA 3EN8A 1ZX2A 3MKIA 4XBTA 4XBXA 3OWUA 3K7CA 3JUNA 1HKXA 3CNMA 4L8PA 3MHEA 5IF6A 3MG2A 4HM1B 1ASKA 1GY5A 3CPOA 4WWUC 1CQSA 2GXFA 4STDA 4L8OA 4X2HA 1Z1SA 3UNLA 3FH1A 4I4KA 5IG4A 3NHXA 1E3VA 1JN5B 1W02A 3DXOA 4XB5A 4HM3B 2R4IA 3GRDA 2B24B 2BNGA 3DM8A 4HJLB 5AIGA 1ZO2A 3WMDA 5EVHA 5IENA 3EBTA 3B7CA 4WYKB 3F7XA 4HM4B 4HZBB 5CF2A 3EHCA 4KVHA 3ROBA 3SOYA 1OH0A 1QJGA 3STDA 5IG0A 5KP1A 4RZMA 2RCDA 2YFIB 3E99A 2W2CA 3OWSA 1JB4A 4HVNA 1OF5B 4J9AA 5AI1A 3D9RA 5IG3A 2PZVA 4HM8B 1SJWA 5IEOA 3NV0A 5CLKA 3EN1B 4WYKA 1OHOA 4XM4A 3EF8A 5FW5A 2STDA 1NDOB 1OCVA 6STDA 1GS3A 1TP6A 3F7SA 2CHCA 4J8TA 4N3VA 1O7WB 4R1KA 4K1VA 3UJMA 5TGNA 3K0ZA 2QIYA 1VZZA 3RGRA 3KSPA 3HK4A 5D82A 1JB5A 2F98A 1JKGB 3DZLA 2UX0A 4LEHA 3MG3A 4FCJA 3FGYA 2Z7AA 1OGZA 4U13A 2HMMB 3KZTA 3F14A 4CDLA 3ECFA 3F9SA 3FSDA 3LYGA 5AIHA 1IDPA 5IERA 3B4PA 3F8XA 2GEYA 3H51A 2BMQB 1DMMA 2F99A 3OXAA 3DUKA 3G16A 5D83A 3EC9A 3HZPA 1K41A 2HMNB 1JKGA 3B8LA 5CF1A 3I0YA 1GY6A 3Q90A 5BVBA 5CK6A 4FCMA 3KKGA 1O7HB 1E3RA 4ORLA 1OHSA 2INXA 5KP4A 3EBYA 2GEXA 5STDA 3CU3A 3OX9A 3JUOA 4HM0B 3MG1A 4LMIA 2CKFB 4LGQA 3GZXB 3MYTA 3FF2A 1JN5A 1NU3A 5AIIA 1WQLB 5DREA 2HMLB 3NUVA 3NM2A 1ULIB 1OPYA 5DRVA 1C7HA 1QMAA 2BMOB 3FKAA 3EX9A 4OVMA 1ISKA 3BB9A
chains in the Genus database with same CATH superfamily
1VQ73 3RGAA 6RNTA 1IT7A 1RRHA 3LTCA 4FMAA 3BLZA 1JV2B 2CG0A 1IVUA 1OGXA 4XDVA 1U5OA 2XFTA 3SX1A 1UW1A 1BGSA 5BXQA 1QALA 2OOVA 4HKVB 3JUMA 1R4CA 1M904 2OQEA 2IMJA 3WHOA 2CWTA 3MWZA 5AIFA 2HMKB 1DETA 1GD3A 1O7GB 2W04A 2WO0A 3DMCA 2ZA4A 5G2GA 2OTL3 2CW9A 2XSOB 1SARA 4PEJA 2Z76A 2YFLB 4HAAA 2F86B 2XR8B 1S5AA 2OWPA 3UB1A 7STDA 2OCTA 3KFQC 5BIRA 1G96A 3DGOA 1W2B2 2GU3A 4O3VA 3JUPA 3G8ZA 1JBSA 4HM7B 1OF5A 1RGGA 1IU7A 5IEPA 1B2UA 3RDEA 1LRAA 4G1MB 1L5GB 1DE3A 1AR0A 1T2HA 3AHWA 1LOVA 3SOAA 2QA43 1Y4KA 3GZYB 5ELJA 1BSEA 2Q07A 3ER7A 3TDGA 1HU9A 3DY5A 1KD14 1B3SA 1I0VA 2I9WA 2HMOB 3OWYA 1IQ8A 2CWUA 4GB5A 2BIRA 2WOFA 1FUTA 3A76A 3FG4A 2XSHB 3GZRA 2B1XB 2L4VA 3ZG5A 1NB5I 4I5QA 2CFKA 4X2OA 5IW9A 2CG1A 1A67A 3AGOA 4L7KA 1OHPA 3L0RA 3A5EA 1RN4A 1ULJB 3AMOB 4HBRA 1JZOA 1GY7A 3T8UA 1E97A 1O7MB 4XDWA 3T8NA 5AEUB 4J5GA 3SVAA 2H0HA 1SIIA 2IUKA 3BNEA 1X1YA 3MSOA 1W6YA 3J7Yd 1Q9EA 3BNCA 4IIAA 2BMRB 2KXGA 3CC73 4EV5A 5LC7A 1GSPA 2KRTA 2O9UX 3KIIA 5JPUA 7GSPA 1GMPA 3IMAB 1IV7A 3F8HA 3GWRA 1JJ22 4HZ9B 3LXUX 1RDSA 2XRXB 2YFJB 2GBWB 5ELUA 1YIT3 3ALAA 1W4NA 2ML6A 3IPTA 4KFEA 3NX0A 2XF3A 4DKIA 1JB2A 3LZAA 2FGTA 5AYRB 3VGNA 5G1LA 3ZFZA 1GMRA 5D81A 1A2KA 1DMNA 1UUVB 2K54A 4HM6B 1I0XA 1UI7A 1I70A 3H3HA 2KF3A 1D6YA 2C11A 3EQQB 4BL2A 4XBYA 1YHQ3 1WMOA 1RKYA 3OV4A 2O3OA 1PY3A 4MMYB 2RFRA 1NWWA 1TJDA 1YGWA 4MMZB 1K28A 3M8CA 3EJVA 4K61A 4K1UA 3CCV3 1DMQA 1GYBA 1STDA 2A15A 1RGFA 5CXOA 3LTDA 1A2PA 2F56A 1SQWA 1RGCA 1RHLA 3NBJA 3HX8A 5JPPA 1Q40B 3CCS3 2W0QA 1UUWB 2CFLA 3N9HA 5HGRA 5AEWB 1FZUA 4N6NB 1G02A 5AYSC 4H3UA 1B20A 1WNHA 3T0UA 4BU4A 1IVWA 3CCR3 1BUQA 2W56A 3JUQA 3NV0B 3BNDA 4WHAA 1YI23 1BUJA 2KAAA 8CHOA 4NREA 1O7NB 4Q53A 2J8XB 1N5HA 2FXTA 2R41A 3KE7A 3X3YA 4HM2B 3I563 3G0KA 3CMA3 4LSOA 4OK0A 3CCJ3 2QEX3 1RTUA 3CCU3 2UUGC 3FF0A 2YX9A 4ZM8A 1QVF2 2CIUA 1JZDA 2P0MA 4R9LA 1VQL3 3VSYA 4BTXA 3LOYA 3GZBA 4AEQA 1EA2A 5IG5A 5M19A 1LNIA 3SEDA 1KC84 4EV2A 1JBTA 2M7OA 5FGOA 1OUNA 4O02B 1VQK3 1TU5A 1GOYA 1BNFA 2QGUA 2ZL8A 2GU1A 4N6MA 2GBXB 4WP5A 3PCRA 3Q1CA 2C10A 2RNTA 3LT9A 2MF7A 1C54A 3CNXA 2V1LA 3SLUA 3F40A 3DH2A 1BU4A 1Q40A 4FMCA 1Q42A 1O7PB 1BAOA 1ROVA 3B4OA 1S723 2CH9A 1GOVA 4HM5B 4IPBA 1Q814 1JBRA 1WTHA 1WMPA 2KF4A 2MC8A 3NQYA 1W00A 1TUHA 1CEWI 1TFOA 1FGRA 1AVKA 2JQ5A 4JRFA 1QAKA 1DVCA 2LYXA 1EEJA 3X42A 1YJ93 1IYYA 2RGQA 3G713 4H61A 3CC43 5GSPA 3NBRA 1R4YA 3X40A 5I97A 2C4BA 2Z77A 1V58A 1T2IA 1B27A 4OUQA 5HOHA 1BNSA 1BNGA 1BSAA 1K734 4MJDA 4LYLB 1UDII 1W01A 4HOHA 4NHFA 1X1XA 3FZWA 4FMDA 4O2HA 3S5CA 1A90A 3KN4A 1AVLA 1EG9B 1LXEA 3D5IA 3AHSA 1ZS7A 2FNQA 2BT3A 1BNJA 2HMJB 1UUGB 4AKYA 4JF8A 3FLJA 1W2ZA 2Y74A 1RCKA 4KFDA 3U97A 3CCM3 1BRJA 1BANA 1G0TA 5KP3A 4R9KA 5M18A 2L1SA 1BOXA 3X41A 1T3BA 2W9PA 1FUWA 1JNQA 2E2VA 1J2BA 3NXJA 1YJW3 2P0XA 2OTJ3 1UCKA 1VQ63 2CC3A 1BRKA 2H0GA 3EN8A 1ZX2A 3MKIA 4XBTA 3WOEB 1RGKA 5BU4A 1BNRA 1FGTA 1RJOA 4XBXA 3OWUA 5LC6A 3K7CA 3PXMA 1U8CB 1IQYA 1HKXA 3JUNA 3O8YA 3N54B 1X1UA 3VF1A 3CNMA 4L8PA 2HOHA 4O8SA 2W6JH 3MHEA 5IF6A 3MG2A 4HM1B 1ASKA 1B2XA 1GY5A 4IT7A 9RNTA 1M1XB 1I8VA 4EXRA 3CPOA 4WWUC 1RGHA 2PNCA 1NO3A 3D5GA 2XGLA 2Z6BA 2LQVA 1CQSA 4CPKA 1TRPA 1UCLA 3D79A 3URPA 2CX1A 2GXFA 1VQ83 1VQ93 4STDA 1FYSA 3FG3A 4L8OA 1EUIC 3PS8A 4X2HA 1SIHA 2P38A 1Z1SA 3UNLA 3HIIA 1BRSA 2GSPA 3G6E3 3FH1A 3EE1A 2XGNA 4I4KA 2K0MA 1IT8A 5IG4A 2RBIA 3NHXA 1CYVA 1E3VA 1UGIA 1JN5B 3PZWA 1W02A 1TTOA 3DXOA 3WDGB 1BNEA 1FW7A 4BIRA 4XB5A 1LNHA 2K3DA 4RBNA 2CX0A 4FCZA 1V57A 4BTWA 1MWRA 1M1K4 4HM3B 3AMOA 2R4IA 3GRDA 2CFGA 2B24B 4RNYA 2BNGA 3DM8A 4HJLB 5AIGA 2P09A 3D3LA 1ZO2A 3WMDA 4BL3A 1MOLA 5EVHA 1RGEA 5JBSA 4R4KA 2CWVA 5IENA 4GL6A 1N9EA 3HOHA 3WR2A 3EBTA 2CK3H 4RNZA 5A0OB 3B7CA 3KCHA 4WYKB 3S27A 3F7XA 4HM4B 2F5MA 1BNIA 2IY2A 2OOVC 4HZBB 1DYUA 5CF2A 3EHCA 4KVHA 2OQEC 2CFDA 3ROBA 1GMQA 3SOYA 3NM7A 1OH0A 3S67A 1ROAA 3EB8A 4AKZA 2WGQA 1TIJA 1QJGA 3DGNA 3STDA 2IA7A 2IUJA 3OW22 1PFPA 5IG0A 3SXXA 3CCL3 3PCSA 1RGLA 4N6TA 5KP1A 1QAFA 4RZMA 4MMXB 1X1WA 1BIRA 1VQP3 3HI7A 2RCDA 2BHMA 4KZ1A 1K8A4 2XFSA 1BSDA 1I2GA 2YFIB 3E99A 1TRQA 2W2CA 3CME3 1Q864 3OWSA 1JB4A 1I2EA 4HVNA 1OF5B 1RNBA 1RNTA 1YVBI 4J9AA 2BU4A 4EW5A 1Q824 1UGHI 5AI1A 1M9GA 3D9RA 1BSBA 1YGEA 3UL6A 3K9MC 3FCSB 5IG3A 2PZVA 4HM8B 1RCLA 1SJWA 1Q7Y4 4HYZA 3NV0A 4N6V0 4LZIA 5IEOA 1PU4A 2XH9A 1YVSA 1LQMB 1TFKA 1AQZA 5CLKA 2ZDJA 1IV9A 3EN1B 1I2FA 4WYKA 1OHOA 4XM4A 3SYUA 3EF8A 1FUSA 1MNLA 5FW5A 2STDA 5RNTA 2KF6A 3LTAA 2RSXA 1AY7A 1UI8A 3QRDA 1VQM3 3BU4A 4KFFA 4EYCA 1NDOB 1GOUA 2E2UA 4BTYA 1OCVA 6STDA 2ML5A 1NB3I 1GS3A 1TP6A 3F7SA 3CCE3 1N5PA 3NBBA 6GSPA 3GAXA 2CHCA 4J8TA 3CC23 4N3VA 1FGQA 1O7WB 4R1KA 3S29A 1LOXA 4K1VA 5M1AA 1VQO3 3PGBA 1UCJA 3UJMA 1RLSA 3CXC2 5EQLA 1VQ53 4N6OB 3RNTA 5TGNA 3K0ZA 2F4YA 3ZG0A 2QIYA 1BSCA 1VZZA 3RGRA 3X3XA 3MPHA 2WOHA 3KSED 2H0IA 3KSPA 3HK4A 4ILFA 1KQS2 1CH0A 5D82A 1JB5A 1W7CA 2P05A 2F98A 1B21A 3V99A 1MWSA 1RGAA 1JKGB 3DZLA 2D42A 1D6UA 2UX0A 1T5YA 4LEHA 1EKMA 3MG3A 3LMLA 1YJN3 1BRNL 4EBGA 4FCJA 3FGYA 1N8QA 3DGLA 4GSPA 7RNTA 1SPUA 2Z7AA 1BVIA 1OGZA 4K90B 4U13A 3CCQ3 2HMMB 3CD63 3KZTA 1RN7A 3Q2PA 8RNTA 1UCIA 3UL5A 3F14A 4CDLA 2AAEA 4FR9A 1STFI 3WOFB 3ECFA 3F9SA 3QK9A 1OACA 5EEOA 3FSDA 3HIGA 2BO9B 1KSIA 1BRHA 3X3ZA 3K5TA 3G4S3 1N8R4 3LYGA 1DVDA 2CFWA 5AIHA 1IDPA 4N6LA 2W56B 5IERA 3B4PA 1KWIA 1B2SA 3F8XA 2GEYA 3CPW2 3H51A 3V92A 2BMQB 1DMMA 3LTBA 1LOYA 1RRLA 4EC6A 3WA3A 3NQZA 1I3IA 1RN1A 1US1A 2F99A 1MWUA 2D1WA 3OXAA 1GD4A 1V74A 3S28A 1LVNA 3JVCA 3DUKA 3G16A 5D83A 2UGIA 3EC9A 3HZPA 1B2ZA 1K41A 1VQ43 2HMNB 4CCVA 1BRGA 2SBLA 3DGYA 1JKGA 3B8LA 1MWTA 5CF1A 3I0YA 1K9M4 1GY6A 4MEIA 2ZHXB 3Q90A 3D4AA 1HYFA 3LH4A 4WFOA 3DGMA 1FA3A 5BVBA 5CK6A 1VQN3 1ZGXA 4QWTA 3I553 1Q7HA 1VQQA 4FCMA 4N6UA 3KKGA 1O7HB 1QVG2 2IYJA 3PYJA 3U1WA 1HZ1A 3FG1A 4KT3B 2F5WA 1AV4A 1W5ZA 1E3RA 1OHSA 4ORLA 2E2TA 2INXA 5KP4A 1BRIA 3EBYA 2GEXA 5STDA 3CU3A 3OX9A 3BNBA 2XEPA 1NNVA 3JUOA 4HM0B 1I3FA 1NJI4 1LQGC 3MG1A 4LMIA 2CKFB 4LGQA 2KCDA 1IVXA 5G1KA 1MGWA 1W6CA 2KF5A 3GZXB 3IJEB 3MYTA 3FF2A 3WODG 1JN5A 1F8NA 1NU3A 3BIRA 3K63A 4CJNA 1WMNA 2W9QA 1RSNA 1B2MA 5AIIA 1IVVA 1WQLB 3AGNA 5DREA 2HMLB 2SARA 1MGRA 1CYUA 1LOWA 4TX4A 3LT8A 3NUVA 1YIJ3 1IQXA 1EQKA 1RMSA 1FGOA 3NM2A 1ULIB 2AADA 1PYLA 1IK3A 4RNTA 1OPYA 2WGOA 1JRQA 5DRVA 1C7HA 1QMAA 2W03A 1A2VA 4R80A 1YNVX 1FGMA 2BMOB 3Q3FA 4GHOA 1N9JA 1D6ZA 1W6GA 3V98A 2Y73A 4J5KA 2JDIH 3FKAA 3WA2X 3EX9A 4OVMA 1ISKA 3GSPA 3BB9A 4FMBA 4NPBA 3N8BA
chains in the Genus database with same CATH topology
1VQ73 3RGAA 1IT7A 1RRHA 3LTCA 4FMAA 3BLZA 1JV2B 2CG0A 1IVUA 1OGXA 4XDVA 1U5OA 2XFTA 3SX1A 1UW1A 5BXQA 1QALA 2OOVA 4HKVB 3JUMA 1R4CA 1M904 2OQEA 2IMJA 2CWTA 3MWZA 5AIFA 2HMKB 1GD3A 1O7GB 2W04A 2WO0A 3DMCA 5G2GA 2OTL3 2CW9A 2XSOB 4PEJA 2Z76A 2YFLB 2F86B 2XR8B 1S5AA 2OWPA 3UB1A 7STDA 2OCTA 3KFQC 1W2B2 1G96A 3DGOA 2GU3A 4O3VA 3JUPA 3G8ZA 4HM7B 1OF5A 1IU7A 5IEPA 3RDEA 4G1MB 1L5GB 1AR0A 3SOAA 2QA43 1Y4KA 3GZYB 5ELJA 3TDGA 2Q07A 3ER7A 1HU9A 3DY5A 1KD14 2I9WA 2HMOB 3OWYA 1IQ8A 2CWUA 4GB5A 2WOFA 3A76A 3FG4A 2XSHB 3GZRA 2B1XB 2L4VA 1NB5I 4X2OA 2CFKA 5IW9A 2CG1A 1A67A 4L7KA 1OHPA 3L0RA 1ULJB 3AMOB 4HBRA 3T8UA 1GY7A 1E97A 1O7MB 4XDWA 3T8NA 5AEUB 3SVAA 1SIIA 2IUKA 3BNEA 3MSOA 1W6YA 3J7Yd 3BNCA 4IIAA 2BMRB 2KXGA 3CC73 4EV5A 5LC7A 2KRTA 2O9UX 3KIIA 5JPUA 3IMAB 1IV7A 3F8HA 3GWRA 4HZ9B 3LXUX 2YFJB 2XRXB 5ELUA 2GBWB 1YIT3 3ALAA 1W4NA 2ML6A 3IPTA 4KFEA 3NX0A 2XF3A 1JB2A 3LZAA 2FGTA 5AYRB 3VGNA 5D81A 1A2KA 1DMNA 1UUVB 2K54A 4HM6B 1UI7A 3H3HA 1YHQ3 1D6YA 2C11A 3EQQB 4XBYA 1WMOA 1RKYA 3OV4A 2O3OA 4MMYB 2RFRA 1NWWA 4MMZB 1K28A 3M8CA 3EJVA 4K61A 4K1UA 3CCV3 1DMQA 1GYBA 1STDA 2A15A 5CXOA 3LTDA 1SQWA 3NBJA 3HX8A 5JPPA 1Q40B 3CCS3 2W0QA 1UUWB 2CFLA 3N9HA 5HGRA 5AEWB 4N6NB 5AYSC 4H3UA 1WNHA 3T0UA 3CCR3 1IVWA 1BUQA 2W56A 3JUQA 3NV0B 3BNDA 4WHAA 1YI23 8CHOA 4NREA 1O7NB 4Q53A 1N5HA 2FXTA 3KE7A 3X3YA 3I563 4HM2B 3G0KA 3CMA3 4LSOA 4OK0A 3CCJ3 2QEX3 3CCU3 3FF0A 2YX9A 4ZM8A 1QVF2 2CIUA 2P0MA 4R9LA 1VQL3 3VSYA 4BTXA 3LOYA 3GZBA 4AEQA 1EA2A 5IG5A 3SEDA 1KC84 4EV2A 2M7OA 5FGOA 1OUNA 4O02B 1VQK3 1TU5A 2QGUA 2ZL8A 2GU1A 4N6MA 2GBXB 4WP5A 3PCRA 3Q1CA 2C10A 3LT9A 2MF7A 3CNXA 2V1LA 3SLUA 3F40A 1Q40A 4FMCA 1Q42A 1O7PB 3B4OA 1ROVA 1S723 2CH9A 4HM5B 1Q814 4IPBA 1WTHA 1WMPA 2MC8A 3NQYA 1W00A 1TUHA 1CEWI 1TFOA 1FGRA 1AVKA 2JQ5A 4JRFA 1QAKA 1DVCA 2LYXA 3X42A 1YJ93 2RGQA 3G713 4H61A 3CC43 3NBRA 3X40A 5I97A 2Z77A 4OUQA 1K734 4MJDA 1W01A 4O2HA 4NHFA 4FMDA 3FZWA 3S5CA 1A90A 3KN4A 1AVLA 1EG9B 1LXEA 2FNQA 2BT3A 2HMJB 4AKYA 4JF8A 3FLJA 1W2ZA 2Y74A 3U97A 4KFDA 3CCM3 5KP3A 4R9KA 3X41A 2W9PA 1FUWA 1JNQA 2E2VA 1J2BA 3NXJA 1YJW3 2P0XA 2OTJ3 1VQ63 2CC3A 3EN8A 1ZX2A 3MKIA 4XBTA 3WOEB 1FGTA 1RJOA 4XBXA 3OWUA 5LC6A 3K7CA 3PXMA 1U8CB 1IQYA 1HKXA 3JUNA 3O8YA 3N54B 3VF1A 3CNMA 4L8PA 4O8SA 2W6JH 3MHEA 5IF6A 3MG2A 4HM1B 1ASKA 1GY5A 4IT7A 1M1XB 4EXRA 3CPOA 4WWUC 2PNCA 1NO3A 2XGLA 2Z6BA 2LQVA 1CQSA 1VQ83 2GXFA 1VQ93 4STDA 3FG3A 4L8OA 3PS8A 4X2HA 1SIHA 2P38A 1Z1SA 3UNLA 3HIIA 3G6E3 3FH1A 3EE1A 2XGNA 4I4KA 2K0MA 1IT8A 5IG4A 3NHXA 1CYVA 1E3VA 1JN5B 3PZWA 1W02A 3DXOA 3WDGB 4XB5A 1LNHA 4RBNA 4FCZA 1M1K4 4BTWA 4HM3B 3AMOA 2R4IA 3GRDA 2CFGA 2B24B 4RNYA 2BNGA 3DM8A 4HJLB 5AIGA 2P09A 3D3LA 1ZO2A 3WMDA 1MOLA 5EVHA 5JBSA 4R4KA 2CWVA 5IENA 4GL6A 1N9EA 3EBTA 2CK3H 4RNZA 5A0OB 3B7CA 4WYKB 3S27A 3F7XA 4HM4B 2OOVC 4HZBB 1DYUA 5CF2A 3EHCA 4KVHA 2OQEC 2CFDA 3ROBA 3SOYA 3NM7A 1OH0A 3S67A 1ROAA 3EB8A 4AKZA 2WGQA 1TIJA 1QJGA 3DGNA 3STDA 2IA7A 2IUJA 3OW22 1PFPA 5IG0A 3SXXA 3CCL3 3PCSA 4N6TA 5KP1A 1QAFA 4RZMA 4MMXB 1VQP3 3HI7A 2RCDA 2BHMA 4KZ1A 1K8A4 2XFSA 2YFIB 3E99A 2W2CA 3CME3 1Q864 3OWSA 1JB4A 4HVNA 1OF5B 1YVBI 4J9AA 1Q824 5AI1A 1M9GA 3D9RA 1YGEA 3UL6A 5IG3A 3K9MC 3FCSB 2PZVA 4HM8B 1SJWA 1Q7Y4 1JJ22 4HYZA 3NV0A 4N6V0 4LZIA 5IEOA 1PU4A 2XH9A 1TFKA 5CLKA 2ZDJA 1IV9A 3EN1B 4WYKA 1OHOA 4XM4A 3EF8A 1MNLA 5FW5A 2STDA 3LTAA 2RSXA 1UI8A 3QRDA 1VQM3 4KFFA 4EYCA 1NDOB 4BTYA 2E2UA 1OCVA 6STDA 2ML5A 1NB3I 1GS3A 1TP6A 3F7SA 3CCE3 1N5PA 3NBBA 3GAXA 2CHCA 4J8TA 3CC23 4N3VA 1FGQA 1O7WB 4R1KA 3S29A 1LOXA 4K1VA 1VQO3 3PGBA 3UJMA 3CXC2 5EQLA 1VQ53 4N6OB 5TGNA 3K0ZA 2QIYA 1VZZA 3RGRA 3X3XA 3MPHA 2WOHA 3KSED 3KSPA 3HK4A 1KQS2 5D82A 1JB5A 1W7CA 2P05A 2F98A 3V99A 1JKGB 3DZLA 2D42A 1D6UA 2UX0A 1T5YA 4LEHA 1EKMA 3MG3A 3LMLA 1YJN3 4EBGA 4FCJA 3FGYA 1N8QA 3DGLA 1SPUA 2Z7AA 1OGZA 4K90B 4U13A 3CCQ3 3CD63 2HMMB 3KZTA 1RN7A 3Q2PA 3UL5A 3F14A 4CDLA 4FR9A 1STFI 3WOFB 3ECFA 3F9SA 3QK9A 1OACA 5EEOA 3FSDA 3HIGA 2BO9B 1KSIA 3X3ZA 3K5TA 3G4S3 1N8R4 3LYGA 1DVDA 2CFWA 5AIHA 1IDPA 4N6LA 2W56B 5IERA 3B4PA 1KWIA 3F8XA 2GEYA 3CPW2 3H51A 3V92A 2BMQB 1DMMA 3LTBA 1RRLA 4EC6A 3WA3A 3NQZA 1US1A 2F99A 2D1WA 3OXAA 1GD4A 1V74A 3S28A 1LVNA 3JVCA 3DUKA 3G16A 5D83A 3EC9A 3HZPA 1K41A 1VQ43 2HMNB 4CCVA 2SBLA 1JKGA 3B8LA 5CF1A 3I0YA 1K9M4 1GY6A 4MEIA 3Q90A 3LH4A 4WFOA 3DGMA 1FA3A 5BVBA 5CK6A 1VQN3 4QWTA 3I553 4FCMA 4N6UA 3KKGA 1O7HB 1QVG2 3PYJA 3U1WA 3FG1A 1AV4A 1E3RA 1OHSA 1W5ZA 4ORLA 2E2TA 2INXA 5KP4A 3EBYA 2GEXA 5STDA 3CU3A 3OX9A 3BNBA 2XEPA 3JUOA 4HM0B 1NJI4 3MG1A 4LMIA 2CKFB 4LGQA 2KCDA 1IVXA 1W6CA 3GZXB 3MYTA 3IJEB 3FF2A 3WODG 1JN5A 1F8NA 1NU3A 3K63A 1WMNA 2W9QA 5AIIA 1IVVA 1WQLB 5DREA 2HMLB 1CYUA 4TX4A 3LT8A 3NUVA 1YIJ3 1IQXA 1EQKA 1FGOA 3NM2A 1ULIB 1IK3A 1OPYA 2WGOA 1JRQA 5DRVA 1C7HA 1QMAA 2W03A 1A2VA 4R80A 1FGMA 2BMOB 1N9JA 1D6ZA 1W6GA 3V98A 2Y73A 2JDIH 3FKAA 3WA2X 3EX9A 4OVMA 1ISKA 3BB9A 4FMBA 3N8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGA A;  3BLZ A;  1OGX A;  4XDV A;  1U5O A;  5BXQ A;  4HKV B;  3JUM A;  2IMJ A;  5AIF A;  2HMK B;  1O7G B;  3DMC A;  5G2G A;  2XSO B;  4PEJ A;  2Z76 A;  2YFL B;  2F86 B;  2XR8 B;  1S5A A;  2OWP A;  7STD A;  3JUP A;  3G8Z A;  4HM7 B;  1OF5 A;  5IEP A;  1AR0 A;  3SOA A;  3GZY B;  3ER7 A;  2I9W A;  2HMO B;  3OWY A;  4GB5 A;  3A76 A;  2XSH B;  3GZR A;  2B1X B;  4X2O A;  4L7K A;  1OHP A;  1ULJ B;  3T8U A;  1GY7 A;  1E97 A;  1O7M B;  4XDW A;  3T8N A;  5AEU B;  3MSO A;  1W6Y A;  4IIA A;  2BMR B;  5JPU A;  3F8H A;  3GWR A;  4HZ9 B;  2YFJ B;  2XRX B;  2GBW B;  3IPT A;  1JB2 A;  3LZA A;  3VGN A;  5D81 A;  1A2K A;  1DMN A;  1UUV B;  2K54 A;  4HM6 B;  3H3H A;  3EQQ B;  4XBY A;  3OV4 A;  2RFR A;  1NWW A;  3M8C A;  3EJV A;  4K1U A;  1DMQ A;  1GYB A;  1STD A;  2A15 A;  5CXO A;  3HX8 A;  5JPP A;  1Q40 B;  1UUW B;  5HGR A;  5AEW B;  4H3U A;  1BUQ A;  3JUQ A;  3NV0 B;  8CHO A;  4Q53 A;  1O7N B;  3KE7 A;  4HM2 B;  3G0K A;  3FF0 A;  4R9L A;  3VSY A;  3GZB A;  1EA2 A;  5IG5 A;  3SED A;  1OUN A;  2QGU A;  2GBX B;  4WP5 A;  3CNX A;  3F40 A;  1Q40 A;  1Q42 A;  1O7P B;  3B4O A;  4HM5 B;  1W00 A;  1TUH A;  2JQ5 A;  2RGQ A;  3NBR A;  2Z77 A;  4OUQ A;  4MJD A;  1W01 A;  3FZW A;  3S5C A;  1EG9 B;  2HMJ B;  3FLJ A;  5KP3 A;  4R9K A;  3NXJ A;  3EN8 A;  1ZX2 A;  3MKI A;  4XBT A;  4XBX A;  3OWU A;  3K7C A;  3JUN A;  1HKX A;  3CNM A;  4L8P A;  3MHE A;  5IF6 A;  3MG2 A;  4HM1 B;  1ASK A;  1GY5 A;  3CPO A;  4WWU C;  1CQS A;  2GXF A;  4STD A;  4L8O A;  4X2H A;  1Z1S A;  3UNL A;  3FH1 A;  4I4K A;  5IG4 A;  3NHX A;  1E3V A;  1JN5 B;  1W02 A;  3DXO A;  4XB5 A;  4HM3 B;  2R4I A;  3GRD A;  2B24 B;  2BNG A;  3DM8 A;  4HJL B;  5AIG A;  1ZO2 A;  3WMD A;  5EVH A;  5IEN A;  3EBT A;  3B7C A;  4WYK B;  3F7X A;  4HM4 B;  4HZB B;  5CF2 A;  3EHC A;  4KVH A;  3ROB A;  3SOY A;  1OH0 A;  1QJG A;  3STD A;  5IG0 A;  5KP1 A;  4RZM A;  2RCD A;  2YFI B;  3E99 A;  2W2C A;  3OWS A;  1JB4 A;  4HVN A;  1OF5 B;  4J9A A;  5AI1 A;  3D9R A;  5IG3 A;  2PZV A;  4HM8 B;  1SJW A;  5IEO A;  3NV0 A;  5CLK A;  3EN1 B;  4WYK A;  1OHO A;  4XM4 A;  3EF8 A;  5FW5 A;  2STD A;  1NDO B;  1OCV A;  6STD A;  1GS3 A;  1TP6 A;  3F7S A;  2CHC A;  4J8T A;  4N3V A;  1O7W B;  4R1K A;  4K1V A;  3UJM A;  5TGN A;  3K0Z A;  2QIY A;  1VZZ A;  3RGR A;  3KSP A;  3HK4 A;  5D82 A;  1JB5 A;  2F98 A;  1JKG B;  3DZL A;  2UX0 A;  4LEH A;  3MG3 A;  4FCJ A;  3FGY A;  2Z7A A;  1OGZ A;  4U13 A;  2HMM B;  3KZT A;  3F14 A;  4CDL A;  3ECF A;  3F9S A;  3FSD A;  3LYG A;  5AIH A;  1IDP A;  5IER A;  3B4P A;  3F8X A;  2GEY A;  3H51 A;  2BMQ B;  1DMM A;  2F99 A;  3OXA A;  3DUK A;  3G16 A;  5D83 A;  3EC9 A;  3HZP A;  1K41 A;  2HMN B;  1JKG A;  3B8L A;  5CF1 A;  3I0Y A;  1GY6 A;  3Q90 A;  5BVB A;  5CK6 A;  4FCM A;  3KKG A;  1O7H B;  1E3R A;  4ORL A;  1OHS A;  2INX A;  5KP4 A;  3EBY A;  2GEX A;  5STD A;  3CU3 A;  3OX9 A;  3JUO A;  4HM0 B;  3MG1 A;  4LMI A;  2CKF B;  4LGQ A;  3GZX B;  3MYT A;  3FF2 A;  1JN5 A;  1NU3 A;  5AII A;  1WQL B;  5DRE A;  2HML B;  3NUV A;  3NM2 A;  1ULI B;  1OPY A;  5DRV A;  1C7H A;  1QMA A;  2BMO B;  3FKA A;  3EX9 A;  4OVM A;  1ISK A;  3BB9 A; 
#chains in the Genus database with same CATH topology
 1VQ7 3;  3RGA A;  6RNT A;  1IT7 A;  1RRH A;  3LTC A;  4FMA A;  3BLZ A;  1JV2 B;  2CG0 A;  1IVU A;  1OGX A;  4XDV A;  1U5O A;  2XFT A;  3SX1 A;  1UW1 A;  1BGS A;  5BXQ A;  1QAL A;  2OOV A;  4HKV B;  3JUM A;  1R4C A;  1M90 4;  2OQE A;  2IMJ A;  3WHO A;  2CWT A;  3MWZ A;  5AIF A;  2HMK B;  1DET A;  1GD3 A;  1O7G B;  2W04 A;  2WO0 A;  3DMC A;  2ZA4 A;  5G2G A;  2OTL 3;  2CW9 A;  2XSO B;  1SAR A;  4PEJ A;  2Z76 A;  2YFL B;  4HAA A;  2F86 B;  2XR8 B;  1S5A A;  2OWP A;  3UB1 A;  7STD A;  2OCT A;  3KFQ C;  5BIR A;  1G96 A;  3DGO A;  1W2B 2;  2GU3 A;  4O3V A;  3JUP A;  3G8Z A;  1JBS A;  4HM7 B;  1OF5 A;  1RGG A;  1IU7 A;  5IEP A;  1B2U A;  3RDE A;  1LRA A;  4G1M B;  1L5G B;  1DE3 A;  1AR0 A;  1T2H A;  3AHW A;  1LOV A;  3SOA A;  2QA4 3;  1Y4K A;  3GZY B;  5ELJ A;  1BSE A;  2Q07 A;  3ER7 A;  3TDG A;  1HU9 A;  3DY5 A;  1KD1 4;  1B3S A;  1I0V A;  2I9W A;  2HMO B;  3OWY A;  1IQ8 A;  2CWU A;  4GB5 A;  2BIR A;  2WOF A;  1FUT A;  3A76 A;  3FG4 A;  2XSH B;  3GZR A;  2B1X B;  2L4V A;  3ZG5 A;  1NB5 I;  4I5Q A;  2CFK A;  4X2O A;  5IW9 A;  2CG1 A;  1A67 A;  3AGO A;  4L7K A;  1OHP A;  3L0R A;  3A5E A;  1RN4 A;  1ULJ B;  3AMO B;  4HBR A;  1JZO A;  1GY7 A;  3T8U A;  1E97 A;  1O7M B;  4XDW A;  3T8N A;  5AEU B;  4J5G A;  3SVA A;  2H0H A;  1SII A;  2IUK A;  3BNE A;  1X1Y A;  3MSO A;  1W6Y A;  3J7Y d;  1Q9E A;  3BNC A;  4IIA A;  2BMR B;  2KXG A;  3CC7 3;  4EV5 A;  5LC7 A;  1GSP A;  2KRT A;  2O9U X;  3KII A;  5JPU A;  7GSP A;  1GMP A;  3IMA B;  1IV7 A;  3F8H A;  3GWR A;  1JJ2 2;  4HZ9 B;  3LXU X;  1RDS A;  2XRX B;  2YFJ B;  2GBW B;  5ELU A;  1YIT 3;  3ALA A;  1W4N A;  2ML6 A;  3IPT A;  4KFE A;  3NX0 A;  2XF3 A;  4DKI A;  1JB2 A;  3LZA A;  2FGT A;  5AYR B;  3VGN A;  5G1L A;  3ZFZ A;  1GMR A;  5D81 A;  1A2K A;  1DMN A;  1UUV B;  2K54 A;  4HM6 B;  1I0X A;  1UI7 A;  1I70 A;  3H3H A;  2KF3 A;  1D6Y A;  2C11 A;  3EQQ B;  4BL2 A;  4XBY A;  1YHQ 3;  1WMO A;  1RKY A;  3OV4 A;  2O3O A;  1PY3 A;  4MMY B;  2RFR A;  1NWW A;  1TJD A;  1YGW A;  4MMZ B;  1K28 A;  3M8C A;  3EJV A;  4K61 A;  4K1U A;  3CCV 3;  1DMQ A;  1GYB A;  1STD A;  2A15 A;  1RGF A;  5CXO A;  3LTD A;  1A2P A;  2F56 A;  1SQW A;  1RGC A;  1RHL A;  3NBJ A;  3HX8 A;  5JPP A;  1Q40 B;  3CCS 3;  2W0Q A;  1UUW B;  2CFL A;  3N9H A;  5HGR A;  5AEW B;  1FZU A;  4N6N B;  1G02 A;  5AYS C;  4H3U A;  1B20 A;  1WNH A;  3T0U A;  4BU4 A;  1IVW A;  3CCR 3;  1BUQ A;  2W56 A;  3JUQ A;  3NV0 B;  3BND A;  4WHA A;  1YI2 3;  1BUJ A;  2KAA A;  8CHO A;  4NRE A;  1O7N B;  4Q53 A;  2J8X B;  1N5H A;  2FXT A;  2R41 A;  3KE7 A;  3X3Y A;  4HM2 B;  3I56 3;  3G0K A;  3CMA 3;  4LSO A;  4OK0 A;  3CCJ 3;  2QEX 3;  1RTU A;  3CCU 3;  2UUG C;  3FF0 A;  2YX9 A;  4ZM8 A;  1QVF 2;  2CIU A;  1JZD A;  2P0M A;  4R9L A;  1VQL 3;  3VSY A;  4BTX A;  3LOY A;  3GZB A;  4AEQ A;  1EA2 A;  5IG5 A;  5M19 A;  1LNI A;  3SED A;  1KC8 4;  4EV2 A;  1JBT A;  2M7O A;  5FGO A;  1OUN A;  4O02 B;  1VQK 3;  1TU5 A;  1GOY A;  1BNF A;  2QGU A;  2ZL8 A;  2GU1 A;  4N6M A;  2GBX B;  4WP5 A;  3PCR A;  3Q1C A;  2C10 A;  2RNT A;  3LT9 A;  2MF7 A;  1C54 A;  3CNX A;  2V1L A;  3SLU A;  3F40 A;  3DH2 A;  1BU4 A;  1Q40 A;  4FMC A;  1Q42 A;  1O7P B;  1BAO A;  1ROV A;  3B4O A;  1S72 3;  2CH9 A;  1GOV A;  4HM5 B;  4IPB A;  1Q81 4;  1JBR A;  1WTH A;  1WMP A;  2KF4 A;  2MC8 A;  3NQY A;  1W00 A;  1TUH A;  1CEW I;  1TFO A;  1FGR A;  1AVK A;  2JQ5 A;  4JRF A;  1QAK A;  1DVC A;  2LYX A;  1EEJ A;  3X42 A;  1YJ9 3;  1IYY A;  2RGQ A;  3G71 3;  4H61 A;  3CC4 3;  5GSP A;  3NBR A;  1R4Y A;  3X40 A;  5I97 A;  2C4B A;  2Z77 A;  1V58 A;  1T2I A;  1B27 A;  4OUQ A;  5HOH A;  1BNS A;  1BNG A;  1BSA A;  1K73 4;  4MJD A;  4LYL B;  1UDI I;  1W01 A;  4HOH A;  4NHF A;  1X1X A;  3FZW A;  4FMD A;  4O2H A;  3S5C A;  1A90 A;  3KN4 A;  1AVL A;  1EG9 B;  1LXE A;  3D5I A;  3AHS A;  1ZS7 A;  2FNQ A;  2BT3 A;  1BNJ A;  2HMJ B;  1UUG B;  4AKY A;  4JF8 A;  3FLJ A;  1W2Z A;  2Y74 A;  1RCK A;  4KFD A;  3U97 A;  3CCM 3;  1BRJ A;  1BAN A;  1G0T A;  5KP3 A;  4R9K A;  5M18 A;  2L1S A;  1BOX A;  3X41 A;  1T3B A;  2W9P A;  1FUW A;  1JNQ A;  2E2V A;  1J2B A;  3NXJ A;  1YJW 3;  2P0X A;  2OTJ 3;  1UCK A;  1VQ6 3;  2CC3 A;  1BRK A;  2H0G A;  3EN8 A;  1ZX2 A;  3MKI A;  4XBT A;  3WOE B;  1RGK A;  5BU4 A;  1BNR A;  1FGT A;  1RJO A;  4XBX A;  3OWU A;  5LC6 A;  3K7C A;  3PXM A;  1U8C B;  1IQY A;  1HKX A;  3JUN A;  3O8Y A;  3N54 B;  1X1U A;  3VF1 A;  3CNM A;  4L8P A;  2HOH A;  4O8S A;  2W6J H;  3MHE A;  5IF6 A;  3MG2 A;  4HM1 B;  1ASK A;  1B2X A;  1GY5 A;  4IT7 A;  9RNT A;  1M1X B;  1I8V A;  4EXR A;  3CPO A;  4WWU C;  1RGH A;  2PNC A;  1NO3 A;  3D5G A;  2XGL A;  2Z6B A;  2LQV A;  1CQS A;  4CPK A;  1TRP A;  1UCL A;  3D79 A;  3URP A;  2CX1 A;  2GXF A;  1VQ8 3;  1VQ9 3;  4STD A;  1FYS A;  3FG3 A;  4L8O A;  1EUI C;  3PS8 A;  4X2H A;  1SIH A;  2P38 A;  1Z1S A;  3UNL A;  3HII A;  1BRS A;  2GSP A;  3G6E 3;  3FH1 A;  3EE1 A;  2XGN A;  4I4K A;  2K0M A;  1IT8 A;  5IG4 A;  2RBI A;  3NHX A;  1CYV A;  1E3V A;  1UGI A;  1JN5 B;  3PZW A;  1W02 A;  1TTO A;  3DXO A;  3WDG B;  1BNE A;  1FW7 A;  4BIR A;  4XB5 A;  1LNH A;  2K3D A;  4RBN A;  2CX0 A;  4FCZ A;  1V57 A;  4BTW A;  1MWR A;  1M1K 4;  4HM3 B;  3AMO A;  2R4I A;  3GRD A;  2CFG A;  2B24 B;  4RNY A;  2BNG A;  3DM8 A;  4HJL B;  5AIG A;  2P09 A;  3D3L A;  1ZO2 A;  3WMD A;  4BL3 A;  1MOL A;  5EVH A;  1RGE A;  5JBS A;  4R4K A;  2CWV A;  5IEN A;  4GL6 A;  1N9E A;  3HOH A;  3WR2 A;  3EBT A;  2CK3 H;  4RNZ A;  5A0O B;  3B7C A;  3KCH A;  4WYK B;  3S27 A;  3F7X A;  4HM4 B;  2F5M A;  1BNI A;  2IY2 A;  2OOV C;  4HZB B;  1DYU A;  5CF2 A;  3EHC A;  4KVH A;  2OQE C;  2CFD A;  3ROB A;  1GMQ A;  3SOY A;  3NM7 A;  1OH0 A;  3S67 A;  1ROA A;  3EB8 A;  4AKZ A;  2WGQ A;  1TIJ A;  1QJG A;  3DGN A;  3STD A;  2IA7 A;  2IUJ A;  3OW2 2;  1PFP A;  5IG0 A;  3SXX A;  3CCL 3;  3PCS A;  1RGL A;  4N6T A;  5KP1 A;  1QAF A;  4RZM A;  4MMX B;  1X1W A;  1BIR A;  1VQP 3;  3HI7 A;  2RCD A;  2BHM A;  4KZ1 A;  1K8A 4;  2XFS A;  1BSD A;  1I2G A;  2YFI B;  3E99 A;  1TRQ A;  2W2C A;  3CME 3;  1Q86 4;  3OWS A;  1JB4 A;  1I2E A;  4HVN A;  1OF5 B;  1RNB A;  1RNT A;  1YVB I;  4J9A A;  2BU4 A;  4EW5 A;  1Q82 4;  1UGH I;  5AI1 A;  1M9G A;  3D9R A;  1BSB A;  1YGE A;  3UL6 A;  3K9M C;  3FCS B;  5IG3 A;  2PZV A;  4HM8 B;  1RCL A;  1SJW A;  1Q7Y 4;  4HYZ A;  3NV0 A;  4N6V 0;  4LZI A;  5IEO A;  1PU4 A;  2XH9 A;  1YVS A;  1LQM B;  1TFK A;  1AQZ A;  5CLK A;  2ZDJ A;  1IV9 A;  3EN1 B;  1I2F A;  4WYK A;  1OHO A;  4XM4 A;  3SYU A;  3EF8 A;  1FUS A;  1MNL A;  5FW5 A;  2STD A;  5RNT A;  2KF6 A;  3LTA A;  2RSX A;  1AY7 A;  1UI8 A;  3QRD A;  1VQM 3;  3BU4 A;  4KFF A;  4EYC A;  1NDO B;  1GOU A;  2E2U A;  4BTY A;  1OCV A;  6STD A;  2ML5 A;  1NB3 I;  1GS3 A;  1TP6 A;  3F7S A;  3CCE 3;  1N5P A;  3NBB A;  6GSP A;  3GAX A;  2CHC A;  4J8T A;  3CC2 3;  4N3V A;  1FGQ A;  1O7W B;  4R1K A;  3S29 A;  1LOX A;  4K1V A;  5M1A A;  1VQO 3;  3PGB A;  1UCJ A;  3UJM A;  1RLS A;  3CXC 2;  5EQL A;  1VQ5 3;  4N6O B;  3RNT A;  5TGN A;  3K0Z A;  2F4Y A;  3ZG0 A;  2QIY A;  1BSC A;  1VZZ A;  3RGR A;  3X3X A;  3MPH A;  2WOH A;  3KSE D;  2H0I A;  3KSP A;  3HK4 A;  4ILF A;  1KQS 2;  1CH0 A;  5D82 A;  1JB5 A;  1W7C A;  2P05 A;  2F98 A;  1B21 A;  3V99 A;  1MWS A;  1RGA A;  1JKG B;  3DZL A;  2D42 A;  1D6U A;  2UX0 A;  1T5Y A;  4LEH A;  1EKM A;  3MG3 A;  3LML A;  1YJN 3;  1BRN L;  4EBG A;  4FCJ A;  3FGY A;  1N8Q A;  3DGL A;  4GSP A;  7RNT A;  1SPU A;  2Z7A A;  1BVI A;  1OGZ A;  4K90 B;  4U13 A;  3CCQ 3;  2HMM B;  3CD6 3;  3KZT A;  1RN7 A;  3Q2P A;  8RNT A;  1UCI A;  3UL5 A;  3F14 A;  4CDL A;  2AAE A;  4FR9 A;  1STF I;  3WOF B;  3ECF A;  3F9S A;  3QK9 A;  1OAC A;  5EEO A;  3FSD A;  3HIG A;  2BO9 B;  1KSI A;  1BRH A;  3X3Z A;  3K5T A;  3G4S 3;  1N8R 4;  3LYG A;  1DVD A;  2CFW A;  5AIH A;  1IDP A;  4N6L A;  2W56 B;  5IER A;  3B4P A;  1KWI A;  1B2S A;  3F8X A;  2GEY A;  3CPW 2;  3H51 A;  3V92 A;  2BMQ B;  1DMM A;  3LTB A;  1LOY A;  1RRL A;  4EC6 A;  3WA3 A;  3NQZ A;  1I3I A;  1RN1 A;  1US1 A;  2F99 A;  1MWU A;  2D1W A;  3OXA A;  1GD4 A;  1V74 A;  3S28 A;  1LVN A;  3JVC A;  3DUK A;  3G16 A;  5D83 A;  2UGI A;  3EC9 A;  3HZP A;  1B2Z A;  1K41 A;  1VQ4 3;  2HMN B;  4CCV A;  1BRG A;  2SBL A;  3DGY A;  1JKG A;  3B8L A;  1MWT A;  5CF1 A;  3I0Y A;  1K9M 4;  1GY6 A;  4MEI A;  2ZHX B;  3Q90 A;  3D4A A;  1HYF A;  3LH4 A;  4WFO A;  3DGM A;  1FA3 A;  5BVB A;  5CK6 A;  1VQN 3;  1ZGX A;  4QWT A;  3I55 3;  1Q7H A;  1VQQ A;  4FCM A;  4N6U A;  3KKG A;  1O7H B;  1QVG 2;  2IYJ A;  3PYJ A;  3U1W A;  1HZ1 A;  3FG1 A;  4KT3 B;  2F5W A;  1AV4 A;  1W5Z A;  1E3R A;  1OHS A;  4ORL A;  2E2T A;  2INX A;  5KP4 A;  1BRI A;  3EBY A;  2GEX A;  5STD A;  3CU3 A;  3OX9 A;  3BNB A;  2XEP A;  1NNV A;  3JUO A;  4HM0 B;  1I3F A;  1NJI 4;  1LQG C;  3MG1 A;  4LMI A;  2CKF B;  4LGQ A;  2KCD A;  1IVX A;  5G1K A;  1MGW A;  1W6C A;  2KF5 A;  3GZX B;  3IJE B;  3MYT A;  3FF2 A;  3WOD G;  1JN5 A;  1F8N A;  1NU3 A;  3BIR A;  3K63 A;  4CJN A;  1WMN A;  2W9Q A;  1RSN A;  1B2M A;  5AII A;  1IVV A;  1WQL B;  3AGN A;  5DRE A;  2HML B;  2SAR A;  1MGR A;  1CYU A;  1LOW A;  4TX4 A;  3LT8 A;  3NUV A;  1YIJ 3;  1IQX A;  1EQK A;  1RMS A;  1FGO A;  3NM2 A;  1ULI B;  2AAD A;  1PYL A;  1IK3 A;  4RNT A;  1OPY A;  2WGO A;  1JRQ A;  5DRV A;  1C7H A;  1QMA A;  2W03 A;  1A2V A;  4R80 A;  1YNV X;  1FGM A;  2BMO B;  3Q3F A;  4GHO A;  1N9J A;  1D6Z A;  1W6G A;  3V98 A;  2Y73 A;  4J5K A;  2JDI H;  3FKA A;  3WA2 X;  3EX9 A;  4OVM A;  1ISK A;  3GSP A;  3BB9 A;  4FMB A;  4NPB A;  3N8B A; 
#chains in the Genus database with same CATH homology
 1VQ7 3;  3RGA A;  1IT7 A;  1RRH A;  3LTC A;  4FMA A;  3BLZ A;  1JV2 B;  2CG0 A;  1IVU A;  1OGX A;  4XDV A;  1U5O A;  2XFT A;  3SX1 A;  1UW1 A;  5BXQ A;  1QAL A;  2OOV A;  4HKV B;  3JUM A;  1R4C A;  1M90 4;  2OQE A;  2IMJ A;  2CWT A;  3MWZ A;  5AIF A;  2HMK B;  1GD3 A;  1O7G B;  2W04 A;  2WO0 A;  3DMC A;  5G2G A;  2OTL 3;  2CW9 A;  2XSO B;  4PEJ A;  2Z76 A;  2YFL B;  2F86 B;  2XR8 B;  1S5A A;  2OWP A;  3UB1 A;  7STD A;  2OCT A;  3KFQ C;  1W2B 2;  1G96 A;  3DGO A;  2GU3 A;  4O3V A;  3JUP A;  3G8Z A;  4HM7 B;  1OF5 A;  1IU7 A;  5IEP A;  3RDE A;  4G1M B;  1L5G B;  1AR0 A;  3SOA A;  2QA4 3;  1Y4K A;  3GZY B;  5ELJ A;  3TDG A;  2Q07 A;  3ER7 A;  1HU9 A;  3DY5 A;  1KD1 4;  2I9W A;  2HMO B;  3OWY A;  1IQ8 A;  2CWU A;  4GB5 A;  2WOF A;  3A76 A;  3FG4 A;  2XSH B;  3GZR A;  2B1X B;  2L4V A;  1NB5 I;  4X2O A;  2CFK A;  5IW9 A;  2CG1 A;  1A67 A;  4L7K A;  1OHP A;  3L0R A;  1ULJ B;  3AMO B;  4HBR A;  3T8U A;  1GY7 A;  1E97 A;  1O7M B;  4XDW A;  3T8N A;  5AEU B;  3SVA A;  1SII A;  2IUK A;  3BNE A;  3MSO A;  1W6Y A;  3J7Y d;  3BNC A;  4IIA A;  2BMR B;  2KXG A;  3CC7 3;  4EV5 A;  5LC7 A;  2KRT A;  2O9U X;  3KII A;  5JPU A;  3IMA B;  1IV7 A;  3F8H A;  3GWR A;  4HZ9 B;  3LXU X;  2YFJ B;  2XRX B;  5ELU A;  2GBW B;  1YIT 3;  3ALA A;  1W4N A;  2ML6 A;  3IPT A;  4KFE A;  3NX0 A;  2XF3 A;  1JB2 A;  3LZA A;  2FGT A;  5AYR B;  3VGN A;  5D81 A;  1A2K A;  1DMN A;  1UUV B;  2K54 A;  4HM6 B;  1UI7 A;  3H3H A;  1YHQ 3;  1D6Y A;  2C11 A;  3EQQ B;  4XBY A;  1WMO A;  1RKY A;  3OV4 A;  2O3O A;  4MMY B;  2RFR A;  1NWW A;  4MMZ B;  1K28 A;  3M8C A;  3EJV A;  4K61 A;  4K1U A;  3CCV 3;  1DMQ A;  1GYB A;  1STD A;  2A15 A;  5CXO A;  3LTD A;  1SQW A;  3NBJ A;  3HX8 A;  5JPP A;  1Q40 B;  3CCS 3;  2W0Q A;  1UUW B;  2CFL A;  3N9H A;  5HGR A;  5AEW B;  4N6N B;  5AYS C;  4H3U A;  1WNH A;  3T0U A;  3CCR 3;  1IVW A;  1BUQ A;  2W56 A;  3JUQ A;  3NV0 B;  3BND A;  4WHA A;  1YI2 3;  8CHO A;  4NRE A;  1O7N B;  4Q53 A;  1N5H A;  2FXT A;  3KE7 A;  3X3Y A;  3I56 3;  4HM2 B;  3G0K A;  3CMA 3;  4LSO A;  4OK0 A;  3CCJ 3;  2QEX 3;  3CCU 3;  3FF0 A;  2YX9 A;  4ZM8 A;  1QVF 2;  2CIU A;  2P0M A;  4R9L A;  1VQL 3;  3VSY A;  4BTX A;  3LOY A;  3GZB A;  4AEQ A;  1EA2 A;  5IG5 A;  3SED A;  1KC8 4;  4EV2 A;  2M7O A;  5FGO A;  1OUN A;  4O02 B;  1VQK 3;  1TU5 A;  2QGU A;  2ZL8 A;  2GU1 A;  4N6M A;  2GBX B;  4WP5 A;  3PCR A;  3Q1C A;  2C10 A;  3LT9 A;  2MF7 A;  3CNX A;  2V1L A;  3SLU A;  3F40 A;  1Q40 A;  4FMC A;  1Q42 A;  1O7P B;  3B4O A;  1ROV A;  1S72 3;  2CH9 A;  4HM5 B;  1Q81 4;  4IPB A;  1WTH A;  1WMP A;  2MC8 A;  3NQY A;  1W00 A;  1TUH A;  1CEW I;  1TFO A;  1FGR A;  1AVK A;  2JQ5 A;  4JRF A;  1QAK A;  1DVC A;  2LYX A;  3X42 A;  1YJ9 3;  2RGQ A;  3G71 3;  4H61 A;  3CC4 3;  3NBR A;  3X40 A;  5I97 A;  2Z77 A;  4OUQ A;  1K73 4;  4MJD A;  1W01 A;  4O2H A;  4NHF A;  4FMD A;  3FZW A;  3S5C A;  1A90 A;  3KN4 A;  1AVL A;  1EG9 B;  1LXE A;  2FNQ A;  2BT3 A;  2HMJ B;  4AKY A;  4JF8 A;  3FLJ A;  1W2Z A;  2Y74 A;  3U97 A;  4KFD A;  3CCM 3;  5KP3 A;  4R9K A;  3X41 A;  2W9P A;  1FUW A;  1JNQ A;  2E2V A;  1J2B A;  3NXJ A;  1YJW 3;  2P0X A;  2OTJ 3;  1VQ6 3;  2CC3 A;  3EN8 A;  1ZX2 A;  3MKI A;  4XBT A;  3WOE B;  1FGT A;  1RJO A;  4XBX A;  3OWU A;  5LC6 A;  3K7C A;  3PXM A;  1U8C B;  1IQY A;  1HKX A;  3JUN A;  3O8Y A;  3N54 B;  3VF1 A;  3CNM A;  4L8P A;  4O8S A;  2W6J H;  3MHE A;  5IF6 A;  3MG2 A;  4HM1 B;  1ASK A;  1GY5 A;  4IT7 A;  1M1X B;  4EXR A;  3CPO A;  4WWU C;  2PNC A;  1NO3 A;  2XGL A;  2Z6B A;  2LQV A;  1CQS A;  1VQ8 3;  2GXF A;  1VQ9 3;  4STD A;  3FG3 A;  4L8O A;  3PS8 A;  4X2H A;  1SIH A;  2P38 A;  1Z1S A;  3UNL A;  3HII A;  3G6E 3;  3FH1 A;  3EE1 A;  2XGN A;  4I4K A;  2K0M A;  1IT8 A;  5IG4 A;  3NHX A;  1CYV A;  1E3V A;  1JN5 B;  3PZW A;  1W02 A;  3DXO A;  3WDG B;  4XB5 A;  1LNH A;  4RBN A;  4FCZ A;  1M1K 4;  4BTW A;  4HM3 B;  3AMO A;  2R4I A;  3GRD A;  2CFG A;  2B24 B;  4RNY A;  2BNG A;  3DM8 A;  4HJL B;  5AIG A;  2P09 A;  3D3L A;  1ZO2 A;  3WMD A;  1MOL A;  5EVH A;  5JBS A;  4R4K A;  2CWV A;  5IEN A;  4GL6 A;  1N9E A;  3EBT A;  2CK3 H;  4RNZ A;  5A0O B;  3B7C A;  4WYK B;  3S27 A;  3F7X A;  4HM4 B;  2OOV C;  4HZB B;  1DYU A;  5CF2 A;  3EHC A;  4KVH A;  2OQE C;  2CFD A;  3ROB A;  3SOY A;  3NM7 A;  1OH0 A;  3S67 A;  1ROA A;  3EB8 A;  4AKZ A;  2WGQ A;  1TIJ A;  1QJG A;  3DGN A;  3STD A;  2IA7 A;  2IUJ A;  3OW2 2;  1PFP A;  5IG0 A;  3SXX A;  3CCL 3;  3PCS A;  4N6T A;  5KP1 A;  1QAF A;  4RZM A;  4MMX B;  1VQP 3;  3HI7 A;  2RCD A;  2BHM A;  4KZ1 A;  1K8A 4;  2XFS A;  2YFI B;  3E99 A;  2W2C A;  3CME 3;  1Q86 4;  3OWS A;  1JB4 A;  4HVN A;  1OF5 B;  1YVB I;  4J9A A;  1Q82 4;  5AI1 A;  1M9G A;  3D9R A;  1YGE A;  3UL6 A;  5IG3 A;  3K9M C;  3FCS B;  2PZV A;  4HM8 B;  1SJW A;  1Q7Y 4;  1JJ2 2;  4HYZ A;  3NV0 A;  4N6V 0;  4LZI A;  5IEO A;  1PU4 A;  2XH9 A;  1TFK A;  5CLK A;  2ZDJ A;  1IV9 A;  3EN1 B;  4WYK A;  1OHO A;  4XM4 A;  3EF8 A;  1MNL A;  5FW5 A;  2STD A;  3LTA A;  2RSX A;  1UI8 A;  3QRD A;  1VQM 3;  4KFF A;  4EYC A;  1NDO B;  4BTY A;  2E2U A;  1OCV A;  6STD A;  2ML5 A;  1NB3 I;  1GS3 A;  1TP6 A;  3F7S A;  3CCE 3;  1N5P A;  3NBB A;  3GAX A;  2CHC A;  4J8T A;  3CC2 3;  4N3V A;  1FGQ A;  1O7W B;  4R1K A;  3S29 A;  1LOX A;  4K1V A;  1VQO 3;  3PGB A;  3UJM A;  3CXC 2;  5EQL A;  1VQ5 3;  4N6O B;  5TGN A;  3K0Z A;  2QIY A;  1VZZ A;  3RGR A;  3X3X A;  3MPH A;  2WOH A;  3KSE D;  3KSP A;  3HK4 A;  1KQS 2;  5D82 A;  1JB5 A;  1W7C A;  2P05 A;  2F98 A;  3V99 A;  1JKG B;  3DZL A;  2D42 A;  1D6U A;  2UX0 A;  1T5Y A;  4LEH A;  1EKM A;  3MG3 A;  3LML A;  1YJN 3;  4EBG A;  4FCJ A;  3FGY A;  1N8Q A;  3DGL A;  1SPU A;  2Z7A A;  1OGZ A;  4K90 B;  4U13 A;  3CCQ 3;  3CD6 3;  2HMM B;  3KZT A;  1RN7 A;  3Q2P A;  3UL5 A;  3F14 A;  4CDL A;  4FR9 A;  1STF I;  3WOF B;  3ECF A;  3F9S A;  3QK9 A;  1OAC A;  5EEO A;  3FSD A;  3HIG A;  2BO9 B;  1KSI A;  3X3Z A;  3K5T A;  3G4S 3;  1N8R 4;  3LYG A;  1DVD A;  2CFW A;  5AIH A;  1IDP A;  4N6L A;  2W56 B;  5IER A;  3B4P A;  1KWI A;  3F8X A;  2GEY A;  3CPW 2;  3H51 A;  3V92 A;  2BMQ B;  1DMM A;  3LTB A;  1RRL A;  4EC6 A;  3WA3 A;  3NQZ A;  1US1 A;  2F99 A;  2D1W A;  3OXA A;  1GD4 A;  1V74 A;  3S28 A;  1LVN A;  3JVC A;  3DUK A;  3G16 A;  5D83 A;  3EC9 A;  3HZP A;  1K41 A;  1VQ4 3;  2HMN B;  4CCV A;  2SBL A;  1JKG A;  3B8L A;  5CF1 A;  3I0Y A;  1K9M 4;  1GY6 A;  4MEI A;  3Q90 A;  3LH4 A;  4WFO A;  3DGM A;  1FA3 A;  5BVB A;  5CK6 A;  1VQN 3;  4QWT A;  3I55 3;  4FCM A;  4N6U A;  3KKG A;  1O7H B;  1QVG 2;  3PYJ A;  3U1W A;  3FG1 A;  1AV4 A;  1E3R A;  1OHS A;  1W5Z A;  4ORL A;  2E2T A;  2INX A;  5KP4 A;  3EBY A;  2GEX A;  5STD A;  3CU3 A;  3OX9 A;  3BNB A;  2XEP A;  3JUO A;  4HM0 B;  1NJI 4;  3MG1 A;  4LMI A;  2CKF B;  4LGQ A;  2KCD A;  1IVX A;  1W6C A;  3GZX B;  3MYT A;  3IJE B;  3FF2 A;  3WOD G;  1JN5 A;  1F8N A;  1NU3 A;  3K63 A;  1WMN A;  2W9Q A;  5AII A;  1IVV A;  1WQL B;  5DRE A;  2HML B;  1CYU A;  4TX4 A;  3LT8 A;  3NUV A;  1YIJ 3;  1IQX A;  1EQK A;  1FGO A;  3NM2 A;  1ULI B;  1IK3 A;  1OPY A;  2WGO A;  1JRQ A;  5DRV A;  1C7H A;  1QMA A;  2W03 A;  1A2V A;  4R80 A;  1FGM A;  2BMO B;  1N9J A;  1D6Z A;  1W6G A;  3V98 A;  2Y73 A;  2JDI H;  3FKA A;  3WA2 X;  3EX9 A;  4OVM A;  1ISK A;  3BB9 A;  4FMB A;  3N8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...