5IEPA

Structure of cdl2.3b, a computationally designed vitamin-d3 binder
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
121
Chain Sequence
QSAKEAIEAALADFVKVYNSKDAAGVASKYMDDAAIFPLDMAPVDGRQNIQKLWQGLMDMGVSEPKFTTLNVQKSGDFAFESGSFSLKGPLVDIAGIYVEVWRKGQDGGWKLYRTIANLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDL2.3b
publication title Structure of CDL2.3b, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 37
structure length 121
sequence length 126
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iepA00
3NM2A 3EN8A 5BVBA 3Q90A 1VZZA 3FZWA 1ISKA 2QIYA 1ZO2A 3KE7A 5JPPA 4HVNA 5D81A 1OHOA 3STDA 4FCMA 2YFIB 3OXAA 2Z7AA 1STDA 5IEPA 5AEWB 2HMJB 4XBXA 1OGXA 3CNMA 1ULJB 1AR0A 4OUQA 2YFJB 3NBRA 3G0KA 5CXOA 4HM0B 5AIGA 4LMIA 3F9SA 1DMNA 4HM8B 8CHOA 5STDA 2XRXB 3LZAA 3T8UA 4XM4A 4R1KA 4WYKB 3B8LA 1OH0A 1OHPA 5IEOA 3CPOA 3JUMA 2HMKB 2BNGA 3BLZA 1HKXA 4RZMA 2GBXB 2K54A 3OWSA 2IMJA 1ASKA 4HM6B 2HMLB 3FH1A 3WMDA 1WQLB 1W6YA 5TGNA 3S5CA 5IERA 3FF2A 3EBTA 4L8OA 1QJGA 5IG3A 5AEUB 1W02A 4CDLA 2STDA 2GBWB 2HMMB 3IPTA 4J8TA 4H3UA 1O7HB 3KZTA 1GY5A 1JB5A 3LYGA 4XBTA 2I9WA 4ORLA 1O7PB 3E99A 2Z77A 5CLKA 4J9AA 2XSOB 1O7MB 4HM1B 2A15A 7STDA 2CHCA 5CF1A 1EG9B 3MSOA 3GWRA 3RGRA 1JB2A 3B4OA 2B24B 5IG5A 3SOAA 1O7GB 3GZXB 2HMNB 3CNXA 1Z1SA 5AIIA 4XDVA 3MKIA 2BMOB 1OUNA 4R9LA 1CQSA 3T8NA 1JN5A 3DZLA 3EN1B 1ULIB 5KP3A 5HGRA 3MG1A 3EQQB 1E97A 3EHCA 4MJDA 4N3VA 2GEYA 3D9RA 1OCVA 1Q40B 4K1UA 4LGQA 3NHXA 5DRVA 3MHEA 5AIHA 2RCDA 3FGYA 4L8PA 3OWUA 3HZPA 3JUQA 2GXFA 1BUQA 5D83A 4HM3B 1IDPA 2QGUA 5G2GA 3GZRA 4Q53A 4WWUC 2BMQB 1DMMA 2W2CA 1W00A 4PEJA 3EF8A 2CKFB 3F14A 2XSHB 3F40A 3GZYB 1TUHA 1SJWA 4HZ9B 5DREA 3NUVA 2JQ5A 3JUNA 1NU3A 4OVMA 5IF6A 1K41A 1JN5B 3MYTA 1Q42A 4K1VA 2F86B 2F99A 1JKGA 2F98A 4I4KA 1JB4A 3FF0A 4LEHA 1Q40A 3HK4A 3VSYA 6STDA 1OPYA 2GEXA 4HM7B 5D82A 3EC9A 1E3VA 3G8ZA 1A2KA 2PZVA 1TP6A 3NV0B 4XDWA 3OV4A 1S5AA 3GRDA 5FW5A 2BMRB 2YFLB 4XB5A 1U5OA 1OHSA 2RGQA 4HM4B 1W01A 3RGAA 1O7WB 5KP4A 2R4IA 1UUVB 3OX9A 3BB9A 1OGZA 1NWWA 4HM5B 4HZBB 3DXOA 1C7HA 3ROBA 1NDOB 3KSPA 1JKGB 5JPUA 1ZX2A 3A76A 4X2HA 1OF5A 3G16A 5BXQA 3K7CA 3GZBA 3DUKA 3UJMA 3H3HA 3JUOA 5IG0A 3M8CA 4L7KA 3NXJA 3NV0A 3F8HA 3B7CA 3FLJA 3CU3A 5IENA 5KP1A 3DMCA 5IG4A 3SEDA 1GY7A 4KVHA 4IIAA 3VGNA 2B1XB 3EJVA 4STDA 3ECFA 3DM8A 2XR8B 3B4PA 1QMAA 1E3RA 2UX0A 2HMOB 3EBYA 3MG3A 3JUPA 5AIFA 4GB5A 3MG2A 1O7NB 3FSDA 1EA2A 4U13A 3F7XA 3KKGA 3OWYA 4WP5A 3HX8A 3I0YA 2OWPA 3FKAA 1OF5B 3F8XA 5AI1A 3K0ZA 5EVHA 2RFRA 4FCJA 3SOYA 3EX9A 1DMQA 3H51A 5CK6A 5CF2A 1GS3A 2Z76A 2INXA 1UUWB 4HJLB 4XBYA 4HM2B 4HKVB 4WYKA 3ER7A 1GYBA 3F7SA 4X2OA 3UNLA 4R9KA 1GY6A
chains in the Genus database with same CATH superfamily
3BNEA 2WGQA 1LOWA 3NM2A 3EN8A 5BVBA 1MOLA 4EYCA 5HOHA 3Q90A 4FMBA 4O8SA 7RNTA 3N54B 3WOEB 1VZZA 4HOHA 2ZA4A 2GU3A 2KF5A 3FZWA 3UL6A 4EW5A 5JBSA 1D6UA 1ISKA 2QIYA 3VF1A 4HAAA 1ZO2A 1RJOA 2AADA 2WOHA 3FCSB 2SARA 3KE7A 4MEIA 4K90B 3ZFZA 9RNTA 1BNGA 1NO3A 1I0VA 1UDII 2OOVA 5JPPA 2OCTA 4HVNA 3X42A 5D81A 1IVWA 1OHOA 3STDA 3V92A 4FCMA 2IYJA 2OTJ3 2XH9A 3AMOA 2YFIB 3OXAA 4N6NB 3D4AA 2Z7AA 3PYJA 3X40A 1NB5I 3WA2X 1STDA 1BRIA 2O9UX 3NM7A 1RGHA 2HMJB 4XBXA 2CFLA 5AEWB 5IEPA 1AV4A 1OGXA 2P0XA 1ULJB 1V74A 3CNMA 1FYSA 1US1A 3MPHA 4I5QA 4N6MA 6GSPA 1AR0A 3AGOA 1VQ93 7GSPA 1BNEA 3NQZA 4OUQA 3EE1A 2YFJB 1I2EA 2CW9A 3X3YA 2W6JH 1V57A 3KN4A 1BUJA 3NBRA 3G0KA 5CXOA 1TJDA 2KRTA 4EBGA 1FUTA 4HM0B 1CEWI 1PY3A 3F9SA 4LMIA 5AIGA 3ZG0A 4ZM8A 1RNBA 1DMNA 4HM8B 1Q9EA 2K0MA 8CHOA 5STDA 2IUKA 2XRXB 3LZAA 1TTOA 3MWZA 1LRAA 3T8UA 3NQYA 4XM4A 4R1KA 1K28A 4WYKB 4BL2A 3CCM3 3B8LA 2OQEC 1YVSA 2W56A 1EKMA 1UI8A 1GSPA 5FGOA 1OH0A 4JF8A 1GD3A 2W9QA 1OHPA 2W04A 1JBSA 5IEOA 3CPOA 1M1XB 2CK3H 1JZDA 1DVCA 1RCKA 2HMKB 2O3OA 2W03A 3JUMA 2BNGA 3BLZA 2LQVA 3DGLA 1Q814 2E2TA 2KXGA 5M18A 1LQMB 3CPW2 1HKXA 3FG4A 1UCIA 1DVDA 4EV5A 3X41A 1N5PA 3U97A 4RZMA 3LOYA 1BAOA 4O2HA 3CCS3 3CD63 2GBXB 2K54A 2RBIA 1DETA 3OWSA 3DY5A 1FGRA 2IMJA 1W6CA 2P38A 8RNTA 1B2MA 2F4YA 1ASKA 1VQ83 4HM6B 3BIRA 1BSAA 2HMLB 3FH1A 2QEX3 1N9JA 1SQWA 1GOUA 2XEPA 3WMDA 1WQLB 1BSBA 1W6YA 2IY2A 2M7OA 5TGNA 1FUWA 4EC6A 2WO0A 3LTDA 3S5CA 5G1LA 3WOFB 2XFTA 4O3VA 5EEOA 3V98A 3PGBA 5IERA 3FF2A 4BL3A 3AGNA 1RNTA 1I0XA 3EBTA 4L8OA 2KF6A 3IMAB 4AKZA 2L1SA 1QJGA 2WGOA 6RNTA 3ZG5A 5IG3A 3AHWA 5AEUB 5RNTA 2H0HA 1GD4A 1EQKA 1W02A 1SIHA 1FGOA 5AYSC 1N5HA 1BU4A 4CDLA 1C54A 2STDA 1A2VA 2GBWB 3KIIA 1B20A 4MMYB 1KD14 3HOHA 4LZIA 1UGIA 3PZWA 3SYUA 5ELJA 1I3IA 2C10A 1KSIA 3CCJ3 1UGHI 4FCZA 4AEQA 5EQLA 2HMMB 3DGOA 3IPTA 4H3UA 4J8TA 1VQK3 1O7HB 2F5MA 2KF4A 3QRDA 1BNJA 1QAFA 1WMNA 1AY7A 3CCV3 3S67A 4FMAA 1M1K4 3KZTA 4KT3B 1GY5A 2K3DA 3HIIA 3LTBA 1BANA 1JB5A 2GU1A 3GSPA 3LYGA 3LXUX 4XBTA 1R4CA 2I9WA 1O7PB 4ORLA 4BTWA 1LVNA 2W56B 3O8YA 2Z6BA 4MMXB 5A0OB 3CME3 1RDSA 3E99A 2Z77A 1IQXA 4N6V0 3PXMA 1IU7A 2IA7A 5CLKA 4J9AA 2KCDA 2PNCA 2F56A 2XSOB 3CMA3 1O7MB 4HM1B 1W4NA 4DKIA 2A15A 1BRNL 5LC7A 2CHCA 7STDA 5CF1A 1UCLA 1RRHA 1EG9B 3LTCA 3MSOA 4H61A 1S723 3GWRA 5LC6A 3KCHA 1GMRA 1CH0A 1NNVA 4RNYA 1RN1A 3RGRA 1DYUA 4LSOA 1VQ43 3CC23 1JB2A 1GMPA 3B4OA 4FMDA 2HOHA 2B24B 5IG5A 4NPBA 3PCRA 4KFDA 3SOAA 1MNLA 1YGWA 2UUGC 3LMLA 1UCKA 1WNHA 1O7GB 1JBTA 1VQ53 3GZXB 2HMNB 2BIRA 3CNXA 1Z1SA 4TX4A 2CIUA 4N6OB 1TIJA 1BRJA 5AIIA 1U8CB 4XDVA 5BIRA 3TDGA 2XGNA 3MKIA 5G1KA 1YHQ3 2GSPA 2BMOB 1OUNA 4RBNA 1Q864 1IQ8A 1RGLA 3Q1CA 5I97A 1W6GA 2ZDJA 2IUJA 2CX0A 5BU4A 4R9LA 1J2BA 3KFQC 3CCL3 1CQSA 3T8NA 1CYVA 1JN5A 3DZLA 3EN1B 1MWTA 3G4S3 3WR2A 4AKYA 1ULIB 1FGTA 5KP3A 1IT8A 3Q3FA 4KFEA 5HGRA 3MG1A 1TU5A 2ML5A 2CFGA 2OQEA 3EQQB 1E97A 1V58A 1IV7A 1MWUA 5AYRB 3EHCA 2F5WA 3Q2PA 4MJDA 4N3VA 1G02A 2GEYA 1UUGB 3D9RA 1OCVA 1RGKA 4GSPA 1Q40B 1BOXA 2BHMA 4K1UA 4LGQA 4R4KA 3FG3A 2YX9A 4BTXA 2H0GA 1STFI 3NHXA 4R80A 1VQP3 1MGRA 2P09A 4BTYA 5DRVA 4FR9A 1B21A 3MHEA 5AIHA 2RCDA 3FGYA 2XFSA 4L8PA 2OOVC 3OWUA 3HZPA 3WODG 1AQZA 3JUQA 1W5ZA 2GXFA 1BVIA 2L4VA 1BUQA 1BNRA 1JRQA 4GHOA 2KF3A 5D83A 3DGNA 4HM3B 1Y4KA 3WA3A 1IDPA 4CCVA 1K9M4 3DGYA 1D6YA 2QGUA 3X3XA 1TRQA 2D42A 1UW1A 4J5KA 5G2GA 1ZGXA 1BNSA 3GZRA 2BU4A 2RSXA 4Q53A 4WWUC 3D79A 3K9MC 4ILFA 3OW22 2BMQB 1F8NA 3J7Yd 3CCE3 1DMMA 1X1XA 3G713 2W2CA 2CG0A 1W00A 1RKYA 4PEJA 3EF8A 2FNQA 2CKFB 3BNCA 1JJ22 3S27A 1R4YA 3F14A 2XSHB 3F40A 1IVUA 1A90A 1IQYA 3GZYB 1WMOA 1TUHA 3D3LA 4LYLB 1SJWA 4N6UA 1X1WA 4HZ9B 1JBRA 5DREA 3LT9A 1YIJ3 1WTHA 1YJN3 1YNVX 3NUVA 1B2XA 2JQ5A 3JUNA 2FXTA 1BRKA 1NU3A 1BSCA 1GOVA 2ZHXB 4OVMA 3CCR3 4NREA 1RN4A 1FW7A 1IVXA 5IF6A 1K41A 1JN5B 1RGGA 3MYTA 1Q42A 4K1VA 2F86B 1VQN3 3HIGA 2F99A 1EEJA 1PFPA 1JKGA 2F98A 1N9EA 3URPA 2WOFA 1MWSA 1G96A 1KWIA 1UCJA 1BSDA 4I4KA 1JB4A 3WHOA 2CWUA 1BRGA 3FF0A 1FA3A 4LEHA 3UL5A 5IW9A 1Q40A 1SIIA 1L5GB 1FUSA 3HK4A 1VQM3 2UGIA 1T3BA 1SPUA 1YVBI 2KAAA 2MC8A 1RLSA 3VSYA 6STDA 1OPYA 2CG1A 2GEXA 4HM7B 5D82A 2CH9A 3EC9A 3SX1A 1PYLA 1E3VA 3G8ZA 1A2KA 3GAXA 1OACA 1RCLA 1I2FA 1EUIC 2PZVA 1TRPA 1TP6A 2E2VA 3NV0B 3S29A 1W2B2 3QK9A 1I3FA 3SXXA 4XDWA 5M19A 3BNBA 3OV4A 1S5AA 1I2GA 3GRDA 5FW5A 2H0IA 4CPKA 2V1LA 1CYUA 2J8XB 2BMRB 1G0TA 2YFLB 1FZUA 1T2HA 4XB5A 1K734 1U5OA 1RGAA 1OHSA 1RSNA 3D5IA 2RGQA 1B2SA 3L0RA 2ML6A 4HM4B 2BO9B 1LQGC 1YIT3 1KQS2 1W01A 1YGEA 3RGAA 1T5YA 3N9HA 1KC84 1O7WB 1MWRA 3CCU3 5KP4A 4RNTA 1VQO3 2R4IA 1RHLA 3HI7A 1M9GA 1ROVA 1UUVB 3OX9A 1NJI4 4JRFA 3N8BA 3BB9A 1W7CA 1OGZA 2CWTA 1NWWA 4HM5B 4HZBB 4GL6A 3DXOA 1HU9A 1Q824 1C7HA 1GOYA 3ROBA 2C11A 2E2UA 4HBRA 2Y74A 1NDOB 3KSPA 1B2ZA 1ROAA 3A5EA 1RGCA 3IJEB 4J5GA 2CFWA 1M904 3V99A 3SVAA 1JKGB 5GSPA 1QVG2 2BT3A 3I563 1AVKA 3LT8A 5JPUA 3PCSA 1IK3A 1ZX2A 1QAKA 3A76A 1LOXA 1OF5A 4X2HA 1TFOA 3G16A 1N8R4 2CC3A 3RDEA 5BXQA 1LXEA 3K7CA 3GZBA 3DUKA 4QWTA 1MGWA 2XGLA 4RNZA 1GMQA 3UJMA 4BU4A 1A2PA 3H3HA 3JUOA 4KZ1A 5IG0A 3M8CA 4NHFA 4L7KA 4N6LA 2W9PA 3S28A 1YJ93 1BRHA 3NBJA 3CXC2 3NXJA 3NV0A 1HYFA 3B7CA 3EB8A 3F8HA 3FLJA 3CU3A 3SLUA 4CJNA 1DE3A 5IENA 5KP1A 1N8QA 3DMCA 4OK0A 5IG4A 1RRLA 1RMSA 1ZS7A 3SEDA 1RGFA 1GY7A 2RNTA 3DGMA 1A67A 4KVHA 4IIAA 4EXRA 4G1MB 3AHSA 1K8A4 2Y73A 3VGNA 3LH4A 1BGSA 2B1XB 3EJVA 4STDA 3ECFA 3DM8A 2XR8B 3B4PA 3PS8A 2W0QA 1X1UA 1QMAA 3D5GA 1LNIA 4IT7A 1VQQA 1E3RA 2ZL8A 3BU4A 3CCQ3 1B3SA 1WMPA 2UX0A 4EV2A 1NB3I 2HMOB 3EBYA 3MG3A 1VQL3 3JUPA 4WHAA 1IT7A 5AIFA 4GB5A 2LYXA 2P05A 1VQ63 4FMCA 3MG2A 1LNHA 1I8VA 5ELUA 1IV9A 1O7NB 5M1AA 3DH2A 3FSDA 1IVVA 1EA2A 1FGQA 2Q07A 1BRSA 1LOYA 3K5TA 4U13A 3F7XA 3FG1A 3KKGA 3NX0A 3OWYA 1BNFA 4HYZA 1SARA 4WP5A 3HX8A 1PU4A 1I70A 4MMZB 1AVLA 2AAEA 4BIRA 1YI23 1QALA 1JNQA 3I0YA 2OWPA 3FKAA 1OF5B 3G6E3 3X3ZA 4IPBA 3KSED 3F8XA 3NBBA 3BNDA 5AI1A 3K0ZA 3WDGB 2FGTA 2OTL3 3AMOB 3JVCA 3U1WA 1QVF2 5EVHA 2P0MA 3LTAA 3T0UA 4KFFA 2JDIH 2RFRA 4O02B 4FCJA 1RGEA 2MF7A 3ALAA 1B2UA 3SOYA 3EX9A 1DMQA 3H51A 1IYYA 2CX1A 5CK6A 1Q7HA 5CF2A 1GS3A 2Z76A 1D6ZA 3CC73 1VQ73 2INXA 1UUWB 4K61A 1RN7A 4WFOA 2C4BA 1JV2B 3CC43 2CFKA 1W2ZA 1BNIA 3K63A 1UI7A 4HJLB 4XBYA 1BSEA 1FGMA 4HM2B 4HKVB 2SBLA 1Q7Y4 4WYKA 1YJW3 4N6TA 3ER7A 2R41A 2XF3A 1GYBA 1T2IA 1JZOA 3UB1A 3RNTA 3F7SA 4X2OA 1HZ1A 1RTUA 1TFKA 2CWVA 2D1WA 3UNLA 1X1YA 4R9KA 1GY6A 1LOVA 1B27A 2CFDA 3I553 1BIRA 2QA43
chains in the Genus database with same CATH topology
3BNEA 2WGQA 3NM2A 3EN8A 5BVBA 1MOLA 4EYCA 3Q90A 4FMBA 4O8SA 3N54B 3WOEB 1VZZA 2GU3A 3FZWA 3UL6A 5JBSA 1ISKA 1D6UA 2QIYA 3VF1A 1ZO2A 1RJOA 2WOHA 3FCSB 3KE7A 4MEIA 4K90B 1NO3A 2OOVA 5JPPA 2OCTA 4HVNA 3X42A 5D81A 1IVWA 1OHOA 3STDA 3V92A 4FCMA 2OTJ3 2XH9A 3AMOA 2YFIB 3OXAA 4N6NB 3X40A 2Z7AA 3PYJA 1NB5I 3WA2X 1STDA 2O9UX 3NM7A 5AEWB 2HMJB 4XBXA 5IEPA 2CFLA 3CCL3 1AV4A 1OGXA 2P0XA 1ULJB 1V74A 3CNMA 3MPHA 1US1A 4N6MA 1AR0A 1VQ93 3NQZA 4OUQA 3EE1A 2YFJB 2CW9A 3X3YA 2W6JH 3KN4A 3NBRA 3G0KA 5CXOA 2KRTA 4EBGA 4HM0B 5AIGA 1CEWI 4LMIA 3F9SA 4ZM8A 1DMNA 4HM8B 2K0MA 8CHOA 5STDA 2IUKA 2XRXB 3LZAA 3MWZA 3T8UA 3NQYA 4XM4A 4R1KA 1K28A 4WYKB 3CCM3 3B8LA 2OQEC 2W56A 1EKMA 1UI8A 5FGOA 1OH0A 4JF8A 1GD3A 2W9QA 1OHPA 2W04A 5IEOA 3CPOA 1M1XB 2CK3H 3JUMA 1DVCA 2W03A 2HMKB 2O3OA 2BNGA 3BLZA 2LQVA 3DGLA 1Q814 2E2TA 2KXGA 3CPW2 1HKXA 3FG4A 1DVDA 4EV5A 3X41A 1N5PA 3U97A 4RZMA 3LOYA 4O2HA 3CCS3 3CD63 2GBXB 2K54A 3OWSA 3DY5A 1FGRA 2IMJA 1W6CA 2P38A 1VQ83 1ASKA 4HM6B 2HMLB 3FH1A 2QEX3 1N9JA 1SQWA 2XEPA 3WMDA 1WQLB 2M7OA 1W6YA 5TGNA 1FUWA 4EC6A 2WO0A 3LTDA 3S5CA 3WOFB 2XFTA 4O3VA 5EEOA 3V98A 3PGBA 5IERA 3FF2A 3EBTA 4L8OA 3IMAB 4AKZA 1QJGA 2WGOA 1EQKA 5IG3A 5AEUB 1GD4A 1W02A 1SIHA 1FGOA 5AYSC 1N5HA 4CDLA 2STDA 1A2VA 2GBWB 3KIIA 4MMYB 1KD14 4LZIA 3PZWA 5ELJA 2C10A 1KSIA 3CCJ3 4FCZA 4AEQA 5EQLA 2HMMB 3DGOA 3IPTA 4H3UA 4J8TA 1VQK3 1O7HB 3QRDA 1QAFA 1WMNA 3CCV3 3S67A 4FMAA 1M1K4 3KZTA 1GY5A 3HIIA 3LTBA 1JB5A 2GU1A 3LYGA 3LXUX 4XBTA 4BTWA 1R4CA 2I9WA 1O7PB 4ORLA 1LVNA 2W56B 3O8YA 2Z6BA 4MMXB 5A0OB 3CME3 3E99A 2Z77A 1IQXA 4N6V0 3PXMA 1IU7A 2IA7A 5CLKA 4J9AA 2KCDA 2PNCA 3CMA3 2XSOB 1O7MB 4HM1B 1W4NA 2A15A 5LC7A 2CHCA 7STDA 5CF1A 1RRHA 1EG9B 3LTCA 3MSOA 4H61A 1S723 3GWRA 5LC6A 4RNYA 3RGRA 1DYUA 4LSOA 1VQ43 3CC23 1JB2A 3B4OA 4FMDA 2B24B 5IG5A 3SOAA 3PCRA 4KFDA 1MNLA 3LMLA 1WNHA 1O7GB 1VQ53 3GZXB 2HMNB 3CNXA 1Z1SA 4TX4A 2CIUA 4N6OB 1TIJA 5AIIA 1U8CB 4XDVA 3TDGA 2XGNA 3MKIA 1YHQ3 2BMOB 1OUNA 4RBNA 1Q864 1IQ8A 3Q1CA 5I97A 1W6GA 2ZDJA 2IUJA 4R9LA 1J2BA 3KFQC 1CQSA 3T8NA 1CYVA 1JN5A 3DZLA 3EN1B 3G4S3 4AKYA 1ULIB 1FGTA 5KP3A 1IT8A 5HGRA 4KFEA 3MG1A 1TU5A 2ML5A 2CFGA 2OQEA 3EQQB 1E97A 1IV7A 5AYRB 3EHCA 3Q2PA 4MJDA 4N3VA 2GEYA 3D9RA 1OCVA 1Q40B 2BHMA 4K1UA 4LGQA 4R4KA 3FG3A 2YX9A 4BTXA 1STFI 3NHXA 4R80A 1VQP3 2P09A 4BTYA 5DRVA 4FR9A 3MHEA 5AIHA 2RCDA 3FGYA 2XFSA 4L8PA 2OOVC 3OWUA 3HZPA 3WODG 3JUQA 1W5ZA 2GXFA 2L4VA 1BUQA 1JRQA 5D83A 3DGNA 4HM3B 1Y4KA 3WA3A 1IDPA 4CCVA 1K9M4 1D6YA 2QGUA 3X3XA 2D42A 1UW1A 5G2GA 3GZRA 4Q53A 2RSXA 3OW22 4WWUC 3K9MC 2BMQB 1F8NA 3J7Yd 3CCE3 1DMMA 3G713 2W2CA 2CG0A 1W00A 1RKYA 4PEJA 3EF8A 2FNQA 2CKFB 3BNCA 1JJ22 3S27A 3F14A 2XSHB 3F40A 1IVUA 1A90A 1IQYA 3GZYB 1WMOA 1TUHA 3D3LA 1SJWA 4N6UA 4HZ9B 5DREA 3LT9A 1YIJ3 1WTHA 1YJN3 3NUVA 2JQ5A 3JUNA 2FXTA 1NU3A 4OVMA 3CCR3 4NREA 1IVXA 5IF6A 1K41A 1JN5B 3MYTA 1Q42A 4K1VA 2F86B 1VQN3 3HIGA 2F99A 1PFPA 1JKGA 2F98A 1N9EA 2WOFA 1G96A 1KWIA 4I4KA 1JB4A 2CWUA 1FA3A 3FF0A 4LEHA 3UL5A 5IW9A 1Q40A 1SIIA 1L5GB 3HK4A 1VQM3 1SPUA 1YVBI 2MC8A 3VSYA 6STDA 1OPYA 2CG1A 2GEXA 4HM7B 5D82A 2CH9A 3EC9A 3SX1A 1E3VA 3G8ZA 1A2KA 3GAXA 1OACA 2PZVA 1TP6A 2E2VA 3NV0B 3S29A 1W2B2 3QK9A 3SXXA 4XDWA 3BNBA 3OV4A 1S5AA 3GRDA 5FW5A 2V1LA 1CYUA 2BMRB 2YFLB 4XB5A 1K734 1U5OA 1OHSA 2RGQA 3L0RA 2ML6A 4HM4B 2BO9B 1YIT3 1KQS2 1W01A 1YGEA 3RGAA 1T5YA 3N9HA 1KC84 1O7WB 3CCU3 5KP4A 1VQO3 2R4IA 3HI7A 1M9GA 1ROVA 1UUVB 3OX9A 1NJI4 4JRFA 3N8BA 3BB9A 1W7CA 1OGZA 2CWTA 1NWWA 4HM5B 4HZBB 4GL6A 3DXOA 1HU9A 1Q824 1C7HA 3ROBA 2C11A 2E2UA 4HBRA 2Y74A 1NDOB 3KSPA 1ROAA 3IJEB 2CFWA 1M904 3V99A 3SVAA 1JKGB 1QVG2 2BT3A 3I563 1AVKA 3LT8A 5JPUA 3PCSA 1IK3A 1ZX2A 3A76A 1QAKA 1LOXA 1OF5A 4X2HA 1TFOA 3G16A 1N8R4 2CC3A 3RDEA 5BXQA 1LXEA 3K7CA 3GZBA 3DUKA 4QWTA 2XGLA 4RNZA 3UJMA 3H3HA 3JUOA 4KZ1A 5IG0A 3M8CA 4NHFA 4L7KA 4N6LA 2W9PA 3S28A 1YJ93 3NBJA 3CXC2 3NXJA 3NV0A 3F8HA 3B7CA 3EB8A 3FLJA 3SLUA 3CU3A 5IENA 5KP1A 1N8QA 3DMCA 4OK0A 5IG4A 1RRLA 3SEDA 1GY7A 3DGMA 1A67A 4KVHA 4IIAA 4EXRA 4G1MB 1K8A4 2Y73A 3VGNA 3LH4A 2B1XB 3EJVA 4STDA 3ECFA 3DM8A 2XR8B 3B4PA 3PS8A 2W0QA 1QMAA 4IT7A 1E3RA 2ZL8A 3CCQ3 1WMPA 2UX0A 4EV2A 1NB3I 2HMOB 3EBYA 3MG3A 1VQL3 3JUPA 4WHAA 1IT7A 5AIFA 4GB5A 2LYXA 2P05A 1VQ63 4FMCA 3MG2A 1LNHA 5ELUA 1IV9A 1O7NB 3FSDA 1IVVA 1EA2A 1FGQA 2Q07A 3K5TA 4U13A 3F7XA 3FG1A 3KKGA 3NX0A 3OWYA 4HYZA 4WP5A 3HX8A 1PU4A 4MMZB 1AVLA 1YI23 1QALA 1JNQA 3I0YA 2OWPA 3FKAA 1OF5B 3G6E3 3X3ZA 4IPBA 3KSED 3F8XA 3NBBA 3BNDA 5AI1A 3K0ZA 3WDGB 2FGTA 2OTL3 3AMOB 3JVCA 3U1WA 1QVF2 5EVHA 2P0MA 3LTAA 3T0UA 4KFFA 2JDIH 2RFRA 4O02B 4FCJA 2MF7A 3ALAA 3SOYA 3EX9A 1DMQA 3H51A 5CK6A 5CF2A 1GS3A 2Z76A 1D6ZA 3CC73 1VQ73 2INXA 1UUWB 4K61A 1RN7A 4WFOA 1JV2B 3CC43 2CFKA 1W2ZA 3K63A 1UI7A 4HJLB 4XBYA 1FGMA 4HM2B 4HKVB 2SBLA 1Q7Y4 4WYKA 1YJW3 4N6TA 3ER7A 2XF3A 1GYBA 3UB1A 3F7SA 4X2OA 1TFKA 2CWVA 2D1WA 3UNLA 4R9KA 1GY6A 2CFDA 3I553 2QA43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NM2 A;  3EN8 A;  5BVB A;  3Q90 A;  1VZZ A;  3FZW A;  1ISK A;  2QIY A;  1ZO2 A;  3KE7 A;  5JPP A;  4HVN A;  5D81 A;  1OHO A;  3STD A;  4FCM A;  2YFI B;  3OXA A;  2Z7A A;  1STD A;  5IEP A;  5AEW B;  2HMJ B;  4XBX A;  1OGX A;  3CNM A;  1ULJ B;  1AR0 A;  4OUQ A;  2YFJ B;  3NBR A;  3G0K A;  5CXO A;  4HM0 B;  5AIG A;  4LMI A;  3F9S A;  1DMN A;  4HM8 B;  8CHO A;  5STD A;  2XRX B;  3LZA A;  3T8U A;  4XM4 A;  4R1K A;  4WYK B;  3B8L A;  1OH0 A;  1OHP A;  5IEO A;  3CPO A;  3JUM A;  2HMK B;  2BNG A;  3BLZ A;  1HKX A;  4RZM A;  2GBX B;  2K54 A;  3OWS A;  2IMJ A;  1ASK A;  4HM6 B;  2HML B;  3FH1 A;  3WMD A;  1WQL B;  1W6Y A;  5TGN A;  3S5C A;  5IER A;  3FF2 A;  3EBT A;  4L8O A;  1QJG A;  5IG3 A;  5AEU B;  1W02 A;  4CDL A;  2STD A;  2GBW B;  2HMM B;  3IPT A;  4J8T A;  4H3U A;  1O7H B;  3KZT A;  1GY5 A;  1JB5 A;  3LYG A;  4XBT A;  2I9W A;  4ORL A;  1O7P B;  3E99 A;  2Z77 A;  5CLK A;  4J9A A;  2XSO B;  1O7M B;  4HM1 B;  2A15 A;  7STD A;  2CHC A;  5CF1 A;  1EG9 B;  3MSO A;  3GWR A;  3RGR A;  1JB2 A;  3B4O A;  2B24 B;  5IG5 A;  3SOA A;  1O7G B;  3GZX B;  2HMN B;  3CNX A;  1Z1S A;  5AII A;  4XDV A;  3MKI A;  2BMO B;  1OUN A;  4R9L A;  1CQS A;  3T8N A;  1JN5 A;  3DZL A;  3EN1 B;  1ULI B;  5KP3 A;  5HGR A;  3MG1 A;  3EQQ B;  1E97 A;  3EHC A;  4MJD A;  4N3V A;  2GEY A;  3D9R A;  1OCV A;  1Q40 B;  4K1U A;  4LGQ A;  3NHX A;  5DRV A;  3MHE A;  5AIH A;  2RCD A;  3FGY A;  4L8P A;  3OWU A;  3HZP A;  3JUQ A;  2GXF A;  1BUQ A;  5D83 A;  4HM3 B;  1IDP A;  2QGU A;  5G2G A;  3GZR A;  4Q53 A;  4WWU C;  2BMQ B;  1DMM A;  2W2C A;  1W00 A;  4PEJ A;  3EF8 A;  2CKF B;  3F14 A;  2XSH B;  3F40 A;  3GZY B;  1TUH A;  1SJW A;  4HZ9 B;  5DRE A;  3NUV A;  2JQ5 A;  3JUN A;  1NU3 A;  4OVM A;  5IF6 A;  1K41 A;  1JN5 B;  3MYT A;  1Q42 A;  4K1V A;  2F86 B;  2F99 A;  1JKG A;  2F98 A;  4I4K A;  1JB4 A;  3FF0 A;  4LEH A;  1Q40 A;  3HK4 A;  3VSY A;  6STD A;  1OPY A;  2GEX A;  4HM7 B;  5D82 A;  3EC9 A;  1E3V A;  3G8Z A;  1A2K A;  2PZV A;  1TP6 A;  3NV0 B;  4XDW A;  3OV4 A;  1S5A A;  3GRD A;  5FW5 A;  2BMR B;  2YFL B;  4XB5 A;  1U5O A;  1OHS A;  2RGQ A;  4HM4 B;  1W01 A;  3RGA A;  1O7W B;  5KP4 A;  2R4I A;  1UUV B;  3OX9 A;  3BB9 A;  1OGZ A;  1NWW A;  4HM5 B;  4HZB B;  3DXO A;  1C7H A;  3ROB A;  1NDO B;  3KSP A;  1JKG B;  5JPU A;  1ZX2 A;  3A76 A;  4X2H A;  1OF5 A;  3G16 A;  5BXQ A;  3K7C A;  3GZB A;  3DUK A;  3UJM A;  3H3H A;  3JUO A;  5IG0 A;  3M8C A;  4L7K A;  3NXJ A;  3NV0 A;  3F8H A;  3B7C A;  3FLJ A;  3CU3 A;  5IEN A;  5KP1 A;  3DMC A;  5IG4 A;  3SED A;  1GY7 A;  4KVH A;  4IIA A;  3VGN A;  2B1X B;  3EJV A;  4STD A;  3ECF A;  3DM8 A;  2XR8 B;  3B4P A;  1QMA A;  1E3R A;  2UX0 A;  2HMO B;  3EBY A;  3MG3 A;  3JUP A;  5AIF A;  4GB5 A;  3MG2 A;  1O7N B;  3FSD A;  1EA2 A;  4U13 A;  3F7X A;  3KKG A;  3OWY A;  4WP5 A;  3HX8 A;  3I0Y A;  2OWP A;  3FKA A;  1OF5 B;  3F8X A;  5AI1 A;  3K0Z A;  5EVH A;  2RFR A;  4FCJ A;  3SOY A;  3EX9 A;  1DMQ A;  3H51 A;  5CK6 A;  5CF2 A;  1GS3 A;  2Z76 A;  2INX A;  1UUW B;  4HJL B;  4XBY A;  4HM2 B;  4HKV B;  4WYK A;  3ER7 A;  1GYB A;  3F7S A;  4X2O A;  3UNL A;  4R9K A;  1GY6 A; 
#chains in the Genus database with same CATH topology
 3BNE A;  2WGQ A;  1LOW A;  3NM2 A;  3EN8 A;  5BVB A;  1MOL A;  4EYC A;  5HOH A;  3Q90 A;  4FMB A;  4O8S A;  7RNT A;  3N54 B;  3WOE B;  1VZZ A;  4HOH A;  2ZA4 A;  2GU3 A;  2KF5 A;  3FZW A;  3UL6 A;  4EW5 A;  5JBS A;  1D6U A;  1ISK A;  2QIY A;  3VF1 A;  4HAA A;  1ZO2 A;  1RJO A;  2AAD A;  2WOH A;  3FCS B;  2SAR A;  3KE7 A;  4MEI A;  4K90 B;  3ZFZ A;  9RNT A;  1BNG A;  1NO3 A;  1I0V A;  1UDI I;  2OOV A;  5JPP A;  2OCT A;  4HVN A;  3X42 A;  5D81 A;  1IVW A;  1OHO A;  3STD A;  3V92 A;  4FCM A;  2IYJ A;  2OTJ 3;  2XH9 A;  3AMO A;  2YFI B;  3OXA A;  4N6N B;  3D4A A;  2Z7A A;  3PYJ A;  3X40 A;  1NB5 I;  3WA2 X;  1STD A;  1BRI A;  2O9U X;  3NM7 A;  1RGH A;  2HMJ B;  4XBX A;  2CFL A;  5AEW B;  5IEP A;  1AV4 A;  1OGX A;  2P0X A;  1ULJ B;  1V74 A;  3CNM A;  1FYS A;  1US1 A;  3MPH A;  4I5Q A;  4N6M A;  6GSP A;  1AR0 A;  3AGO A;  1VQ9 3;  7GSP A;  1BNE A;  3NQZ A;  4OUQ A;  3EE1 A;  2YFJ B;  1I2E A;  2CW9 A;  3X3Y A;  2W6J H;  1V57 A;  3KN4 A;  1BUJ A;  3NBR A;  3G0K A;  5CXO A;  1TJD A;  2KRT A;  4EBG A;  1FUT A;  4HM0 B;  1CEW I;  1PY3 A;  3F9S A;  4LMI A;  5AIG A;  3ZG0 A;  4ZM8 A;  1RNB A;  1DMN A;  4HM8 B;  1Q9E A;  2K0M A;  8CHO A;  5STD A;  2IUK A;  2XRX B;  3LZA A;  1TTO A;  3MWZ A;  1LRA A;  3T8U A;  3NQY A;  4XM4 A;  4R1K A;  1K28 A;  4WYK B;  4BL2 A;  3CCM 3;  3B8L A;  2OQE C;  1YVS A;  2W56 A;  1EKM A;  1UI8 A;  1GSP A;  5FGO A;  1OH0 A;  4JF8 A;  1GD3 A;  2W9Q A;  1OHP A;  2W04 A;  1JBS A;  5IEO A;  3CPO A;  1M1X B;  2CK3 H;  1JZD A;  1DVC A;  1RCK A;  2HMK B;  2O3O A;  2W03 A;  3JUM A;  2BNG A;  3BLZ A;  2LQV A;  3DGL A;  1Q81 4;  2E2T A;  2KXG A;  5M18 A;  1LQM B;  3CPW 2;  1HKX A;  3FG4 A;  1UCI A;  1DVD A;  4EV5 A;  3X41 A;  1N5P A;  3U97 A;  4RZM A;  3LOY A;  1BAO A;  4O2H A;  3CCS 3;  3CD6 3;  2GBX B;  2K54 A;  2RBI A;  1DET A;  3OWS A;  3DY5 A;  1FGR A;  2IMJ A;  1W6C A;  2P38 A;  8RNT A;  1B2M A;  2F4Y A;  1ASK A;  1VQ8 3;  4HM6 B;  3BIR A;  1BSA A;  2HML B;  3FH1 A;  2QEX 3;  1N9J A;  1SQW A;  1GOU A;  2XEP A;  3WMD A;  1WQL B;  1BSB A;  1W6Y A;  2IY2 A;  2M7O A;  5TGN A;  1FUW A;  4EC6 A;  2WO0 A;  3LTD A;  3S5C A;  5G1L A;  3WOF B;  2XFT A;  4O3V A;  5EEO A;  3V98 A;  3PGB A;  5IER A;  3FF2 A;  4BL3 A;  3AGN A;  1RNT A;  1I0X A;  3EBT A;  4L8O A;  2KF6 A;  3IMA B;  4AKZ A;  2L1S A;  1QJG A;  2WGO A;  6RNT A;  3ZG5 A;  5IG3 A;  3AHW A;  5AEU B;  5RNT A;  2H0H A;  1GD4 A;  1EQK A;  1W02 A;  1SIH A;  1FGO A;  5AYS C;  1N5H A;  1BU4 A;  4CDL A;  1C54 A;  2STD A;  1A2V A;  2GBW B;  3KII A;  1B20 A;  4MMY B;  1KD1 4;  3HOH A;  4LZI A;  1UGI A;  3PZW A;  3SYU A;  5ELJ A;  1I3I A;  2C10 A;  1KSI A;  3CCJ 3;  1UGH I;  4FCZ A;  4AEQ A;  5EQL A;  2HMM B;  3DGO A;  3IPT A;  4H3U A;  4J8T A;  1VQK 3;  1O7H B;  2F5M A;  2KF4 A;  3QRD A;  1BNJ A;  1QAF A;  1WMN A;  1AY7 A;  3CCV 3;  3S67 A;  4FMA A;  1M1K 4;  3KZT A;  4KT3 B;  1GY5 A;  2K3D A;  3HII A;  3LTB A;  1BAN A;  1JB5 A;  2GU1 A;  3GSP A;  3LYG A;  3LXU X;  4XBT A;  1R4C A;  2I9W A;  1O7P B;  4ORL A;  4BTW A;  1LVN A;  2W56 B;  3O8Y A;  2Z6B A;  4MMX B;  5A0O B;  3CME 3;  1RDS A;  3E99 A;  2Z77 A;  1IQX A;  4N6V 0;  3PXM A;  1IU7 A;  2IA7 A;  5CLK A;  4J9A A;  2KCD A;  2PNC A;  2F56 A;  2XSO B;  3CMA 3;  1O7M B;  4HM1 B;  1W4N A;  4DKI A;  2A15 A;  1BRN L;  5LC7 A;  2CHC A;  7STD A;  5CF1 A;  1UCL A;  1RRH A;  1EG9 B;  3LTC A;  3MSO A;  4H61 A;  1S72 3;  3GWR A;  5LC6 A;  3KCH A;  1GMR A;  1CH0 A;  1NNV A;  4RNY A;  1RN1 A;  3RGR A;  1DYU A;  4LSO A;  1VQ4 3;  3CC2 3;  1JB2 A;  1GMP A;  3B4O A;  4FMD A;  2HOH A;  2B24 B;  5IG5 A;  4NPB A;  3PCR A;  4KFD A;  3SOA A;  1MNL A;  1YGW A;  2UUG C;  3LML A;  1UCK A;  1WNH A;  1O7G B;  1JBT A;  1VQ5 3;  3GZX B;  2HMN B;  2BIR A;  3CNX A;  1Z1S A;  4TX4 A;  2CIU A;  4N6O B;  1TIJ A;  1BRJ A;  5AII A;  1U8C B;  4XDV A;  5BIR A;  3TDG A;  2XGN A;  3MKI A;  5G1K A;  1YHQ 3;  2GSP A;  2BMO B;  1OUN A;  4RBN A;  1Q86 4;  1IQ8 A;  1RGL A;  3Q1C A;  5I97 A;  1W6G A;  2ZDJ A;  2IUJ A;  2CX0 A;  5BU4 A;  4R9L A;  1J2B A;  3KFQ C;  3CCL 3;  1CQS A;  3T8N A;  1CYV A;  1JN5 A;  3DZL A;  3EN1 B;  1MWT A;  3G4S 3;  3WR2 A;  4AKY A;  1ULI B;  1FGT A;  5KP3 A;  1IT8 A;  3Q3F A;  4KFE A;  5HGR A;  3MG1 A;  1TU5 A;  2ML5 A;  2CFG A;  2OQE A;  3EQQ B;  1E97 A;  1V58 A;  1IV7 A;  1MWU A;  5AYR B;  3EHC A;  2F5W A;  3Q2P A;  4MJD A;  4N3V A;  1G02 A;  2GEY A;  1UUG B;  3D9R A;  1OCV A;  1RGK A;  4GSP A;  1Q40 B;  1BOX A;  2BHM A;  4K1U A;  4LGQ A;  4R4K A;  3FG3 A;  2YX9 A;  4BTX A;  2H0G A;  1STF I;  3NHX A;  4R80 A;  1VQP 3;  1MGR A;  2P09 A;  4BTY A;  5DRV A;  4FR9 A;  1B21 A;  3MHE A;  5AIH A;  2RCD A;  3FGY A;  2XFS A;  4L8P A;  2OOV C;  3OWU A;  3HZP A;  3WOD G;  1AQZ A;  3JUQ A;  1W5Z A;  2GXF A;  1BVI A;  2L4V A;  1BUQ A;  1BNR A;  1JRQ A;  4GHO A;  2KF3 A;  5D83 A;  3DGN A;  4HM3 B;  1Y4K A;  3WA3 A;  1IDP A;  4CCV A;  1K9M 4;  3DGY A;  1D6Y A;  2QGU A;  3X3X A;  1TRQ A;  2D42 A;  1UW1 A;  4J5K A;  5G2G A;  1ZGX A;  1BNS A;  3GZR A;  2BU4 A;  2RSX A;  4Q53 A;  4WWU C;  3D79 A;  3K9M C;  4ILF A;  3OW2 2;  2BMQ B;  1F8N A;  3J7Y d;  3CCE 3;  1DMM A;  1X1X A;  3G71 3;  2W2C A;  2CG0 A;  1W00 A;  1RKY A;  4PEJ A;  3EF8 A;  2FNQ A;  2CKF B;  3BNC A;  1JJ2 2;  3S27 A;  1R4Y A;  3F14 A;  2XSH B;  3F40 A;  1IVU A;  1A90 A;  1IQY A;  3GZY B;  1WMO A;  1TUH A;  3D3L A;  4LYL B;  1SJW A;  4N6U A;  1X1W A;  4HZ9 B;  1JBR A;  5DRE A;  3LT9 A;  1YIJ 3;  1WTH A;  1YJN 3;  1YNV X;  3NUV A;  1B2X A;  2JQ5 A;  3JUN A;  2FXT A;  1BRK A;  1NU3 A;  1BSC A;  1GOV A;  2ZHX B;  4OVM A;  3CCR 3;  4NRE A;  1RN4 A;  1FW7 A;  1IVX A;  5IF6 A;  1K41 A;  1JN5 B;  1RGG A;  3MYT A;  1Q42 A;  4K1V A;  2F86 B;  1VQN 3;  3HIG A;  2F99 A;  1EEJ A;  1PFP A;  1JKG A;  2F98 A;  1N9E A;  3URP A;  2WOF A;  1MWS A;  1G96 A;  1KWI A;  1UCJ A;  1BSD A;  4I4K A;  1JB4 A;  3WHO A;  2CWU A;  1BRG A;  3FF0 A;  1FA3 A;  4LEH A;  3UL5 A;  5IW9 A;  1Q40 A;  1SII A;  1L5G B;  1FUS A;  3HK4 A;  1VQM 3;  2UGI A;  1T3B A;  1SPU A;  1YVB I;  2KAA A;  2MC8 A;  1RLS A;  3VSY A;  6STD A;  1OPY A;  2CG1 A;  2GEX A;  4HM7 B;  5D82 A;  2CH9 A;  3EC9 A;  3SX1 A;  1PYL A;  1E3V A;  3G8Z A;  1A2K A;  3GAX A;  1OAC A;  1RCL A;  1I2F A;  1EUI C;  2PZV A;  1TRP A;  1TP6 A;  2E2V A;  3NV0 B;  3S29 A;  1W2B 2;  3QK9 A;  1I3F A;  3SXX A;  4XDW A;  5M19 A;  3BNB A;  3OV4 A;  1S5A A;  1I2G A;  3GRD A;  5FW5 A;  2H0I A;  4CPK A;  2V1L A;  1CYU A;  2J8X B;  2BMR B;  1G0T A;  2YFL B;  1FZU A;  1T2H A;  4XB5 A;  1K73 4;  1U5O A;  1RGA A;  1OHS A;  1RSN A;  3D5I A;  2RGQ A;  1B2S A;  3L0R A;  2ML6 A;  4HM4 B;  2BO9 B;  1LQG C;  1YIT 3;  1KQS 2;  1W01 A;  1YGE A;  3RGA A;  1T5Y A;  3N9H A;  1KC8 4;  1O7W B;  1MWR A;  3CCU 3;  5KP4 A;  4RNT A;  1VQO 3;  2R4I A;  1RHL A;  3HI7 A;  1M9G A;  1ROV A;  1UUV B;  3OX9 A;  1NJI 4;  4JRF A;  3N8B A;  3BB9 A;  1W7C A;  1OGZ A;  2CWT A;  1NWW A;  4HM5 B;  4HZB B;  4GL6 A;  3DXO A;  1HU9 A;  1Q82 4;  1C7H A;  1GOY A;  3ROB A;  2C11 A;  2E2U A;  4HBR A;  2Y74 A;  1NDO B;  3KSP A;  1B2Z A;  1ROA A;  3A5E A;  1RGC A;  3IJE B;  4J5G A;  2CFW A;  1M90 4;  3V99 A;  3SVA A;  1JKG B;  5GSP A;  1QVG 2;  2BT3 A;  3I56 3;  1AVK A;  3LT8 A;  5JPU A;  3PCS A;  1IK3 A;  1ZX2 A;  1QAK A;  3A76 A;  1LOX A;  1OF5 A;  4X2H A;  1TFO A;  3G16 A;  1N8R 4;  2CC3 A;  3RDE A;  5BXQ A;  1LXE A;  3K7C A;  3GZB A;  3DUK A;  4QWT A;  1MGW A;  2XGL A;  4RNZ A;  1GMQ A;  3UJM A;  4BU4 A;  1A2P A;  3H3H A;  3JUO A;  4KZ1 A;  5IG0 A;  3M8C A;  4NHF A;  4L7K A;  4N6L A;  2W9P A;  3S28 A;  1YJ9 3;  1BRH A;  3NBJ A;  3CXC 2;  3NXJ A;  3NV0 A;  1HYF A;  3B7C A;  3EB8 A;  3F8H A;  3FLJ A;  3CU3 A;  3SLU A;  4CJN A;  1DE3 A;  5IEN A;  5KP1 A;  1N8Q A;  3DMC A;  4OK0 A;  5IG4 A;  1RRL A;  1RMS A;  1ZS7 A;  3SED A;  1RGF A;  1GY7 A;  2RNT A;  3DGM A;  1A67 A;  4KVH A;  4IIA A;  4EXR A;  4G1M B;  3AHS A;  1K8A 4;  2Y73 A;  3VGN A;  3LH4 A;  1BGS A;  2B1X B;  3EJV A;  4STD A;  3ECF A;  3DM8 A;  2XR8 B;  3B4P A;  3PS8 A;  2W0Q A;  1X1U A;  1QMA A;  3D5G A;  1LNI A;  4IT7 A;  1VQQ A;  1E3R A;  2ZL8 A;  3BU4 A;  3CCQ 3;  1B3S A;  1WMP A;  2UX0 A;  4EV2 A;  1NB3 I;  2HMO B;  3EBY A;  3MG3 A;  1VQL 3;  3JUP A;  4WHA A;  1IT7 A;  5AIF A;  4GB5 A;  2LYX A;  2P05 A;  1VQ6 3;  4FMC A;  3MG2 A;  1LNH A;  1I8V A;  5ELU A;  1IV9 A;  1O7N B;  5M1A A;  3DH2 A;  3FSD A;  1IVV A;  1EA2 A;  1FGQ A;  2Q07 A;  1BRS A;  1LOY A;  3K5T A;  4U13 A;  3F7X A;  3FG1 A;  3KKG A;  3NX0 A;  3OWY A;  1BNF A;  4HYZ A;  1SAR A;  4WP5 A;  3HX8 A;  1PU4 A;  1I70 A;  4MMZ B;  1AVL A;  2AAE A;  4BIR A;  1YI2 3;  1QAL A;  1JNQ A;  3I0Y A;  2OWP A;  3FKA A;  1OF5 B;  3G6E 3;  3X3Z A;  4IPB A;  3KSE D;  3F8X A;  3NBB A;  3BND A;  5AI1 A;  3K0Z A;  3WDG B;  2FGT A;  2OTL 3;  3AMO B;  3JVC A;  3U1W A;  1QVF 2;  5EVH A;  2P0M A;  3LTA A;  3T0U A;  4KFF A;  2JDI H;  2RFR A;  4O02 B;  4FCJ A;  1RGE A;  2MF7 A;  3ALA A;  1B2U A;  3SOY A;  3EX9 A;  1DMQ A;  3H51 A;  1IYY A;  2CX1 A;  5CK6 A;  1Q7H A;  5CF2 A;  1GS3 A;  2Z76 A;  1D6Z A;  3CC7 3;  1VQ7 3;  2INX A;  1UUW B;  4K61 A;  1RN7 A;  4WFO A;  2C4B A;  1JV2 B;  3CC4 3;  2CFK A;  1W2Z A;  1BNI A;  3K63 A;  1UI7 A;  4HJL B;  4XBY A;  1BSE A;  1FGM A;  4HM2 B;  4HKV B;  2SBL A;  1Q7Y 4;  4WYK A;  1YJW 3;  4N6T A;  3ER7 A;  2R41 A;  2XF3 A;  1GYB A;  1T2I A;  1JZO A;  3UB1 A;  3RNT A;  3F7S A;  4X2O A;  1HZ1 A;  1RTU A;  1TFK A;  2CWV A;  2D1W A;  3UNL A;  1X1Y A;  4R9K A;  1GY6 A;  1LOV A;  1B27 A;  2CFD A;  3I55 3;  1BIR A;  2QA4 3; 
#chains in the Genus database with same CATH homology
 3BNE A;  2WGQ A;  3NM2 A;  3EN8 A;  5BVB A;  1MOL A;  4EYC A;  3Q90 A;  4FMB A;  4O8S A;  3N54 B;  3WOE B;  1VZZ A;  2GU3 A;  3FZW A;  3UL6 A;  5JBS A;  1ISK A;  1D6U A;  2QIY A;  3VF1 A;  1ZO2 A;  1RJO A;  2WOH A;  3FCS B;  3KE7 A;  4MEI A;  4K90 B;  1NO3 A;  2OOV A;  5JPP A;  2OCT A;  4HVN A;  3X42 A;  5D81 A;  1IVW A;  1OHO A;  3STD A;  3V92 A;  4FCM A;  2OTJ 3;  2XH9 A;  3AMO A;  2YFI B;  3OXA A;  4N6N B;  3X40 A;  2Z7A A;  3PYJ A;  1NB5 I;  3WA2 X;  1STD A;  2O9U X;  3NM7 A;  5AEW B;  2HMJ B;  4XBX A;  5IEP A;  2CFL A;  3CCL 3;  1AV4 A;  1OGX A;  2P0X A;  1ULJ B;  1V74 A;  3CNM A;  3MPH A;  1US1 A;  4N6M A;  1AR0 A;  1VQ9 3;  3NQZ A;  4OUQ A;  3EE1 A;  2YFJ B;  2CW9 A;  3X3Y A;  2W6J H;  3KN4 A;  3NBR A;  3G0K A;  5CXO A;  2KRT A;  4EBG A;  4HM0 B;  5AIG A;  1CEW I;  4LMI A;  3F9S A;  4ZM8 A;  1DMN A;  4HM8 B;  2K0M A;  8CHO A;  5STD A;  2IUK A;  2XRX B;  3LZA A;  3MWZ A;  3T8U A;  3NQY A;  4XM4 A;  4R1K A;  1K28 A;  4WYK B;  3CCM 3;  3B8L A;  2OQE C;  2W56 A;  1EKM A;  1UI8 A;  5FGO A;  1OH0 A;  4JF8 A;  1GD3 A;  2W9Q A;  1OHP A;  2W04 A;  5IEO A;  3CPO A;  1M1X B;  2CK3 H;  3JUM A;  1DVC A;  2W03 A;  2HMK B;  2O3O A;  2BNG A;  3BLZ A;  2LQV A;  3DGL A;  1Q81 4;  2E2T A;  2KXG A;  3CPW 2;  1HKX A;  3FG4 A;  1DVD A;  4EV5 A;  3X41 A;  1N5P A;  3U97 A;  4RZM A;  3LOY A;  4O2H A;  3CCS 3;  3CD6 3;  2GBX B;  2K54 A;  3OWS A;  3DY5 A;  1FGR A;  2IMJ A;  1W6C A;  2P38 A;  1VQ8 3;  1ASK A;  4HM6 B;  2HML B;  3FH1 A;  2QEX 3;  1N9J A;  1SQW A;  2XEP A;  3WMD A;  1WQL B;  2M7O A;  1W6Y A;  5TGN A;  1FUW A;  4EC6 A;  2WO0 A;  3LTD A;  3S5C A;  3WOF B;  2XFT A;  4O3V A;  5EEO A;  3V98 A;  3PGB A;  5IER A;  3FF2 A;  3EBT A;  4L8O A;  3IMA B;  4AKZ A;  1QJG A;  2WGO A;  1EQK A;  5IG3 A;  5AEU B;  1GD4 A;  1W02 A;  1SIH A;  1FGO A;  5AYS C;  1N5H A;  4CDL A;  2STD A;  1A2V A;  2GBW B;  3KII A;  4MMY B;  1KD1 4;  4LZI A;  3PZW A;  5ELJ A;  2C10 A;  1KSI A;  3CCJ 3;  4FCZ A;  4AEQ A;  5EQL A;  2HMM B;  3DGO A;  3IPT A;  4H3U A;  4J8T A;  1VQK 3;  1O7H B;  3QRD A;  1QAF A;  1WMN A;  3CCV 3;  3S67 A;  4FMA A;  1M1K 4;  3KZT A;  1GY5 A;  3HII A;  3LTB A;  1JB5 A;  2GU1 A;  3LYG A;  3LXU X;  4XBT A;  4BTW A;  1R4C A;  2I9W A;  1O7P B;  4ORL A;  1LVN A;  2W56 B;  3O8Y A;  2Z6B A;  4MMX B;  5A0O B;  3CME 3;  3E99 A;  2Z77 A;  1IQX A;  4N6V 0;  3PXM A;  1IU7 A;  2IA7 A;  5CLK A;  4J9A A;  2KCD A;  2PNC A;  3CMA 3;  2XSO B;  1O7M B;  4HM1 B;  1W4N A;  2A15 A;  5LC7 A;  2CHC A;  7STD A;  5CF1 A;  1RRH A;  1EG9 B;  3LTC A;  3MSO A;  4H61 A;  1S72 3;  3GWR A;  5LC6 A;  4RNY A;  3RGR A;  1DYU A;  4LSO A;  1VQ4 3;  3CC2 3;  1JB2 A;  3B4O A;  4FMD A;  2B24 B;  5IG5 A;  3SOA A;  3PCR A;  4KFD A;  1MNL A;  3LML A;  1WNH A;  1O7G B;  1VQ5 3;  3GZX B;  2HMN B;  3CNX A;  1Z1S A;  4TX4 A;  2CIU A;  4N6O B;  1TIJ A;  5AII A;  1U8C B;  4XDV A;  3TDG A;  2XGN A;  3MKI A;  1YHQ 3;  2BMO B;  1OUN A;  4RBN A;  1Q86 4;  1IQ8 A;  3Q1C A;  5I97 A;  1W6G A;  2ZDJ A;  2IUJ A;  4R9L A;  1J2B A;  3KFQ C;  1CQS A;  3T8N A;  1CYV A;  1JN5 A;  3DZL A;  3EN1 B;  3G4S 3;  4AKY A;  1ULI B;  1FGT A;  5KP3 A;  1IT8 A;  5HGR A;  4KFE A;  3MG1 A;  1TU5 A;  2ML5 A;  2CFG A;  2OQE A;  3EQQ B;  1E97 A;  1IV7 A;  5AYR B;  3EHC A;  3Q2P A;  4MJD A;  4N3V A;  2GEY A;  3D9R A;  1OCV A;  1Q40 B;  2BHM A;  4K1U A;  4LGQ A;  4R4K A;  3FG3 A;  2YX9 A;  4BTX A;  1STF I;  3NHX A;  4R80 A;  1VQP 3;  2P09 A;  4BTY A;  5DRV A;  4FR9 A;  3MHE A;  5AIH A;  2RCD A;  3FGY A;  2XFS A;  4L8P A;  2OOV C;  3OWU A;  3HZP A;  3WOD G;  3JUQ A;  1W5Z A;  2GXF A;  2L4V A;  1BUQ A;  1JRQ A;  5D83 A;  3DGN A;  4HM3 B;  1Y4K A;  3WA3 A;  1IDP A;  4CCV A;  1K9M 4;  1D6Y A;  2QGU A;  3X3X A;  2D42 A;  1UW1 A;  5G2G A;  3GZR A;  4Q53 A;  2RSX A;  3OW2 2;  4WWU C;  3K9M C;  2BMQ B;  1F8N A;  3J7Y d;  3CCE 3;  1DMM A;  3G71 3;  2W2C A;  2CG0 A;  1W00 A;  1RKY A;  4PEJ A;  3EF8 A;  2FNQ A;  2CKF B;  3BNC A;  1JJ2 2;  3S27 A;  3F14 A;  2XSH B;  3F40 A;  1IVU A;  1A90 A;  1IQY A;  3GZY B;  1WMO A;  1TUH A;  3D3L A;  1SJW A;  4N6U A;  4HZ9 B;  5DRE A;  3LT9 A;  1YIJ 3;  1WTH A;  1YJN 3;  3NUV A;  2JQ5 A;  3JUN A;  2FXT A;  1NU3 A;  4OVM A;  3CCR 3;  4NRE A;  1IVX A;  5IF6 A;  1K41 A;  1JN5 B;  3MYT A;  1Q42 A;  4K1V A;  2F86 B;  1VQN 3;  3HIG A;  2F99 A;  1PFP A;  1JKG A;  2F98 A;  1N9E A;  2WOF A;  1G96 A;  1KWI A;  4I4K A;  1JB4 A;  2CWU A;  1FA3 A;  3FF0 A;  4LEH A;  3UL5 A;  5IW9 A;  1Q40 A;  1SII A;  1L5G B;  3HK4 A;  1VQM 3;  1SPU A;  1YVB I;  2MC8 A;  3VSY A;  6STD A;  1OPY A;  2CG1 A;  2GEX A;  4HM7 B;  5D82 A;  2CH9 A;  3EC9 A;  3SX1 A;  1E3V A;  3G8Z A;  1A2K A;  3GAX A;  1OAC A;  2PZV A;  1TP6 A;  2E2V A;  3NV0 B;  3S29 A;  1W2B 2;  3QK9 A;  3SXX A;  4XDW A;  3BNB A;  3OV4 A;  1S5A A;  3GRD A;  5FW5 A;  2V1L A;  1CYU A;  2BMR B;  2YFL B;  4XB5 A;  1K73 4;  1U5O A;  1OHS A;  2RGQ A;  3L0R A;  2ML6 A;  4HM4 B;  2BO9 B;  1YIT 3;  1KQS 2;  1W01 A;  1YGE A;  3RGA A;  1T5Y A;  3N9H A;  1KC8 4;  1O7W B;  3CCU 3;  5KP4 A;  1VQO 3;  2R4I A;  3HI7 A;  1M9G A;  1ROV A;  1UUV B;  3OX9 A;  1NJI 4;  4JRF A;  3N8B A;  3BB9 A;  1W7C A;  1OGZ A;  2CWT A;  1NWW A;  4HM5 B;  4HZB B;  4GL6 A;  3DXO A;  1HU9 A;  1Q82 4;  1C7H A;  3ROB A;  2C11 A;  2E2U A;  4HBR A;  2Y74 A;  1NDO B;  3KSP A;  1ROA A;  3IJE B;  2CFW A;  1M90 4;  3V99 A;  3SVA A;  1JKG B;  1QVG 2;  2BT3 A;  3I56 3;  1AVK A;  3LT8 A;  5JPU A;  3PCS A;  1IK3 A;  1ZX2 A;  3A76 A;  1QAK A;  1LOX A;  1OF5 A;  4X2H A;  1TFO A;  3G16 A;  1N8R 4;  2CC3 A;  3RDE A;  5BXQ A;  1LXE A;  3K7C A;  3GZB A;  3DUK A;  4QWT A;  2XGL A;  4RNZ A;  3UJM A;  3H3H A;  3JUO A;  4KZ1 A;  5IG0 A;  3M8C A;  4NHF A;  4L7K A;  4N6L A;  2W9P A;  3S28 A;  1YJ9 3;  3NBJ A;  3CXC 2;  3NXJ A;  3NV0 A;  3F8H A;  3B7C A;  3EB8 A;  3FLJ A;  3SLU A;  3CU3 A;  5IEN A;  5KP1 A;  1N8Q A;  3DMC A;  4OK0 A;  5IG4 A;  1RRL A;  3SED A;  1GY7 A;  3DGM A;  1A67 A;  4KVH A;  4IIA A;  4EXR A;  4G1M B;  1K8A 4;  2Y73 A;  3VGN A;  3LH4 A;  2B1X B;  3EJV A;  4STD A;  3ECF A;  3DM8 A;  2XR8 B;  3B4P A;  3PS8 A;  2W0Q A;  1QMA A;  4IT7 A;  1E3R A;  2ZL8 A;  3CCQ 3;  1WMP A;  2UX0 A;  4EV2 A;  1NB3 I;  2HMO B;  3EBY A;  3MG3 A;  1VQL 3;  3JUP A;  4WHA A;  1IT7 A;  5AIF A;  4GB5 A;  2LYX A;  2P05 A;  1VQ6 3;  4FMC A;  3MG2 A;  1LNH A;  5ELU A;  1IV9 A;  1O7N B;  3FSD A;  1IVV A;  1EA2 A;  1FGQ A;  2Q07 A;  3K5T A;  4U13 A;  3F7X A;  3FG1 A;  3KKG A;  3NX0 A;  3OWY A;  4HYZ A;  4WP5 A;  3HX8 A;  1PU4 A;  4MMZ B;  1AVL A;  1YI2 3;  1QAL A;  1JNQ A;  3I0Y A;  2OWP A;  3FKA A;  1OF5 B;  3G6E 3;  3X3Z A;  4IPB A;  3KSE D;  3F8X A;  3NBB A;  3BND A;  5AI1 A;  3K0Z A;  3WDG B;  2FGT A;  2OTL 3;  3AMO B;  3JVC A;  3U1W A;  1QVF 2;  5EVH A;  2P0M A;  3LTA A;  3T0U A;  4KFF A;  2JDI H;  2RFR A;  4O02 B;  4FCJ A;  2MF7 A;  3ALA A;  3SOY A;  3EX9 A;  1DMQ A;  3H51 A;  5CK6 A;  5CF2 A;  1GS3 A;  2Z76 A;  1D6Z A;  3CC7 3;  1VQ7 3;  2INX A;  1UUW B;  4K61 A;  1RN7 A;  4WFO A;  1JV2 B;  3CC4 3;  2CFK A;  1W2Z A;  3K63 A;  1UI7 A;  4HJL B;  4XBY A;  1FGM A;  4HM2 B;  4HKV B;  2SBL A;  1Q7Y 4;  4WYK A;  1YJW 3;  4N6T A;  3ER7 A;  2XF3 A;  1GYB A;  3UB1 A;  3F7S A;  4X2O A;  1TFK A;  2CWV A;  2D1W A;  3UNL A;  4R9K A;  1GY6 A;  2CFD A;  3I55 3;  2QA4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...