5IEPA

Structure of cdl2.3b, a computationally designed vitamin-d3 binder
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
121
Chain Sequence
QSAKEAIEAALADFVKVYNSKDAAGVASKYMDDAAIFPLDMAPVDGRQNIQKLWQGLMDMGVSEPKFTTLNVQKSGDFAFESGSFSLKGPLVDIAGIYVEVWRKGQDGGWKLYRTIANLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDL2.3b
publication title Structure of CDL2.3b, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 37
structure length 121
sequence length 126
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5iepA00
1O7HB 1SJWA 2UX0A 3OWYA 5IERA 1O7MB 3F9SA 3OX9A 5AIHA 3B4PA 4KVHA 2GBXB 1ZO2A 1W02A 5STDA 1BUQA 5BXQA 3JUNA 3BB9A 3F7SA 8CHOA 1OHOA 2YFJB 3D9RA 4K1VA 1AR0A 4STDA 4HM2B 5IF6A 2BMQB 1OF5B 3ER7A 3GZYB 3EX9A 4R9LA 3MKIA 3DM8A 1OGXA 3OXAA 1DMNA 3FH1A 3LZAA 3CNXA 1GYBA 5TGNA 4H3UA 1DMQA 1W01A 2W2CA 2A15A 3CU3A 3FF0A 2XR8B 3EHCA 5DREA 5HGRA 3UJMA 3SOYA 3B7CA 2STDA 3G0KA 2XSHB 2GEYA 3EBYA 1HKXA 4ORLA 1ULJB 5EVHA 6STDA 3HK4A 5CF2A 1NU3A 3JUPA 5AI1A 1QMAA 5AIIA 1W00A 4Q53A 5AEWB 2RFRA 2RGQA 2Z76A 5DRVA 4L8PA 3H3HA 2GXFA 4FCMA 2HMNB 4X2OA 2K54A 4HZBB 1O7WB 1S5AA 2B24B 3Q90A 3T8NA 4HM7B 3H51A 1JB2A 3KE7A 1ASKA 1TUHA 1DMMA 5IENA 3ECFA 2XRXB 1C7HA 3DZLA 4XBXA 5CF1A 4HM5B 3ROBA 3S5CA 3JUOA 3BLZA 3JUMA 4PEJA 4GB5A 4LGQA 3DMCA 2RCDA 3KSPA 1GY5A 3NUVA 1OF5A 3MG2A 4J9AA 3B4OA 4WWUC 5D82A 1Z1SA 2CKFB 3STDA 3KZTA 5IEOA 4OVMA 4FCJA 4LMIA 4XBYA 4N3VA 5D81A 3G16A 3GRDA 2Z7AA 2QIYA 3FZWA 1W6YA 2HMJB 3K7CA 4K1UA 4RZMA 3GWRA 3M8CA 1OCVA 2HMMB 4XBTA 2BNGA 4OUQA 1EG9B 1Q40A 4HM3B 1O7PB 3I0YA 5KP3A 2INXA 1UUVB 3FSDA 1JN5A 3NHXA 5FW5A 1OHPA 1Q40B 3EN1B 3G8ZA 4XDVA 5AIGA 5IEPA 2CHCA 3EQQB 3A76A 1GS3A 1OPYA 1JN5B 3NXJA 3SOAA 2F99A 2HMLB 4HM0B 4XM4A 4HM6B 3VGNA 1A2KA 1WQLB 4WYKA 2R4IA 3MG3A 3VSYA 5IG5A 2GEXA 2YFIB 3DUKA 3MHEA 4L7KA 4HZ9B 3IPTA 1OHSA 3E99A 1EA2A 3HX8A 4WYKB 2JQ5A 4XB5A 1GY6A 1QJGA 1GY7A 3F8HA 3NV0A 1E3VA 1CQSA 1U5OA 4XDWA 3F7XA 2HMOB 3EN8A 1OUNA 1OGZA 3CPOA 2QGUA 3MG1A 3NV0B 5BVBA 2BMRB 5D83A 1OH0A 3FLJA 2B1XB 1ISKA 2GBWB 3MSOA 1K41A 4HJLB 3UNLA 4HM1B 2HMKB 1UUWB 4U13A 2IMJA 3T8UA 5AIFA 1IDPA 1JKGA 3LYGA 5IG3A 3KKGA 4J8TA 5KP4A 3EJVA 3F8XA 2YFLB 3B8LA 4HVNA 4WP5A 1E97A 5CXOA 1JKGB 1ULIB 5CLKA 1STDA 4R1KA 4CDLA 3EF8A 2OWPA 3GZRA 2BMOB 3CNMA 3GZBA 5KP1A 4IIAA 2Z77A 3OWUA 1NDOB 5JPUA 3K0ZA 4HM8B 4R9KA 4I4KA 3FGYA 5CK6A 1JB5A 1NWWA 3GZXB 4LEHA 1O7NB 3FKAA 3DXOA 3SEDA 3JUQA 3EBTA 4HKVB 5IG0A 3EC9A 4X2HA 3OV4A 2F98A 3F14A 3F40A 7STDA 1E3RA 3HZPA 5IG4A 2XSOB 1ZX2A 3MYTA 5JPPA 3RGRA 3NM2A 1VZZA 4HM4B 5G2GA 3OWSA 3FF2A 1TP6A 3NBRA 4MJDA 3RGAA 2F86B 3WMDA 1Q42A 1O7GB 1JB4A 2I9WA 5AEUB 2PZVA 4L8OA
chains in the Genus database with same CATH superfamily
3LOYA 3CCS3 2CH9A 3CCE3 4AEQA 1D6ZA 3LTDA 1O7HB 1QVF2 2K0MA 2JDIH 1BRSA 2O3OA 1LOXA 2XFTA 3DGOA 1RGAA 1PY3A 4EV2A 3WOEB 1SQWA 1RKYA 1SJWA 2UX0A 3OWYA 2F56A 4CCVA 1T5YA 5IERA 1O7MB 4J5KA 1YVSA 1VQ73 3KSED 1M1XB 1IQ8A 3F9SA 1QVG2 2AADA 3OX9A 2M7OA 3B4PA 5AIHA 4KVHA 3O8YA 2L4VA 2GBXB 1ZO2A 3X41A 1MWRA 4HOHA 1W4NA 1GSPA 1EQKA 4BL3A 2OTL3 1A2PA 1RGHA 1W02A 1RLSA 4R4KA 2AAEA 2CK3H 2L1SA 2W0QA 5I97A 2P09A 1GOYA 1BRIA 5STDA 1I2EA 1BUQA 1MOLA 1W5ZA 1W2B2 1RMSA 2K3DA 3AHSA 3K5TA 3JUNA 3BB9A 1LRAA 3F7SA 5BXQA 2XEPA 1W2ZA 1B20A 1UI7A 1FUTA 2W56A 8CHOA 4AKYA 1OHOA 2W9QA 1MWUA 1M1K4 2C11A 1ROAA 2YFJB 4IPBA 3NQZA 4N6NB 3D9RA 4K1VA 1AR0A 1AV4A 4STDA 4BL2A 4HM2B 5IF6A 1VQN3 3ZG5A 2BMQB 1OF5B 2CFWA 3ER7A 3GZYB 1LQGC 3G6E3 1S723 3EX9A 1UDII 1PYLA 3ZG0A 4R9LA 2XFSA 3TDGA 3MKIA 1VQ93 1IVUA 1PU4A 2W56B 3DM8A 1OGXA 3SXXA 3CC73 5ELUA 2F5MA 2W9PA 3EE1A 1VQM3 1RSNA 3D5IA 3CC23 3OXAA 4O3VA 1DMNA 4BTXA 1BRKA 3V92A 3NQYA 2IYJA 1RCKA 3FH1A 2CFLA 3LZAA 1BNFA 3CNXA 1GYBA 5TGNA 2FNQA 4N6LA 1V58A 4H3UA 1DMQA 1SIHA 1W01A 2W2CA 1RGGA 3D4AA 2A15A 1AVLA 1Q814 3BIRA 7GSPA 1RN7A 3CU3A 3FF0A 1B2UA 2OOVC 3X3ZA 2XR8B 2BT3A 1W6GA 3EHCA 5IW9A 1KC84 5DREA 5HGRA 3SOYA 4GHOA 3UJMA 1TIJA 2STDA 3B7CA 4MEIA 3G0KA 3PGBA 3UL5A 1B2XA 1IVXA 2XSHB 2GEYA 3JVCA 5EQLA 3EBYA 3V98A 1EKMA 1M904 1YIT3 1FGTA 1HKXA 1VQQA 2OCTA 1BRJA 4ORLA 1ULJB 1K9M4 1I70A 5EVHA 6STDA 5M19A 2Z6BA 3HK4A 2MF7A 4NREA 1UCIA 1YVBI 5CF2A 6GSPA 4WFOA 1VQ83 1NU3A 2BIRA 1IVWA 1RDSA 3JUPA 5AI1A 3G713 1QMAA 5AIIA 1FGOA 3FCSB 1W00A 4Q53A 1X1UA 3CCL3 1HU9A 1Q864 2ML5A 1K734 5AEWB 2KF4A 2RFRA 1I2GA 3PXMA 1QALA 3DH2A 1EEJA 4FMBA 1Q7Y4 3K9MC 2W6JH 1F8NA 1CYUA 2RGQA 2Z76A 5DRVA 4L8PA 1A2VA 1RGCA 1B27A 1VQK3 1V74A 3J7Yd 3CCR3 3H3HA 1MNLA 2BO9B 4O2HA 4GL6A 1X1XA 2GXFA 4FCMA 1BVIA 2W03A 2OOVA 1BNSA 2HMNB 1UCKA 2RSXA 4X2OA 1RGEA 1LQMB 3X3XA 1WMOA 2CC3A 2K54A 4HZBB 1O7WB 1S5AA 2B24B 3MWZA 3Q90A 1RRLA 3LTCA 1JRQA 1WNHA 3PCRA 4KZ1A 3T8NA 2F5WA 3A5EA 3CME3 4LYLB 1RGKA 3IJEB 4HM7B 2CG1A 3H51A 4RNZA 1JB2A 3RDEA 1BANA 3KE7A 1ASKA 1RNBA 2GU3A 2IY2A 2CFGA 1TUHA 1DMMA 4FMCA 5BU4A 3KCHA 3BNCA 1VQ43 1FGRA 1DVDA 5JBSA 5BIRA 5IENA 2ZA4A 3Q2PA 2FXTA 1UI8A 3ECFA 1JZDA 2XRXB 3I553 1NB5I 1C7HA 1K28A 2W04A 3DZLA 1TRPA 4H61A 4N6UA 1IU7A 4EC6A 4XBXA 3SLUA 5CF1A 1HZ1A 1BSAA 4HM5B 1UGHI 3LT8A 5FGOA 1ROVA 4FMDA 3ROBA 3S5CA 1R4CA 2QA43 3JUOA 3BLZA 1B2ZA 3JUMA 5ELJA 1T3BA 4PEJA 2C4BA 3HOHA 2XGLA 4GB5A 4LGQA 2XGNA 3DMCA 1TJDA 1BRHA 4K61A 2RCDA 3KSPA 2OQEA 2XF3A 3DGLA 1N8QA 1GY5A 3NUVA 1L5GB 3U1WA 1OF5A 3MG2A 1UUGB 4J9AA 1BRNL 3B4OA 4NHFA 4WWUC 1BSCA 1I0XA 2SARA 5D82A 3PYJA 1Z1SA 2ML6A 1B2MA 2CKFB 3STDA 2H0HA 3KZTA 1UCJA 5IEOA 4EW5A 1LOYA 4OVMA 1YGWA 4FCJA 1MWTA 4ILFA 4KFDA 4LMIA 4XBYA 4BTWA 3HIGA 4N3VA 5D81A 4RBNA 3VF1A 1Q9EA 1IQXA 3G16A 3SX1A 1UGIA 3CPW2 3GRDA 1D6YA 2Z7AA 2QIYA 3S29A 3CCM3 1BGSA 3FZWA 1GD4A 1W6YA 6RNTA 2HMJB 1VQL3 4FMAA 3K7CA 1BNGA 3HI7A 5LC7A 2V1LA 3IMAB 2OTJ3 4K1UA 4KFFA 4RZMA 5AYSC 3GWRA 1DE3A 3M8CA 1OCVA 2HMMB 2D42A 2BNGA 3LMLA 4XBTA 4OUQA 2LYXA 3CCV3 1EG9B 1M9GA 1Q40A 4HM3B 3UL6A 1OACA 2CIUA 1O7PB 3I0YA 5KP3A 1IVVA 1VQO3 3X40A 3EB8A 2INXA 1YI23 1UUVB 3FSDA 1JN5A 1N5HA 1FZUA 4O02B 5G1LA 2UGIA 3NHXA 1IK3A 5FW5A 1I8VA 3CXC2 3BNBA 1R4YA 1OHPA 1Q40B 1WMPA 1BSDA 1AQZA 2CX1A 3EN1B 1I3FA 3G8ZA 1FGQA 3GAXA 2E2VA 2QEX3 3L0RA 1GMRA 1G02A 4XDVA 2RBIA 1MGRA 5AIGA 5IEPA 1LOVA 3I563 2CHCA 3EQQB 3A76A 1GS3A 3N8BA 1OPYA 1JN5B 2CWTA 3NM7A 1YJ93 3NXJA 1GD3A 3SOAA 1FW7A 1QAFA 2F99A 2HMLB 1N9EA 4K90B 2HOHA 4HM0B 4XM4A 2KF3A 3URPA 5EEOA 1BU4A 1BOXA 4HM6B 3D3LA 3VGNA 5HOHA 1JBTA 3QK9A 1A2KA 1WQLB 4WYKA 3QRDA 2PNCA 2R4IA 1J2BA 3NX0A 3ZFZA 3MG3A 3VSYA 1NO3A 3D79A 5IG5A 2LQVA 3Q3FA 2GEXA 2YFIB 3DUKA 3MHEA 4HYZA 4L7KA 1BSBA 2CW9A 2P38A 4HZ9B 3IPTA 1HYFA 1KWIA 3S67A 3ALAA 1OHSA 3T0UA 3E99A 1EA2A 4MMYB 4MMZB 3WODG 2FGTA 1FYSA 1RHLA 1JJ22 4EV5A 3HX8A 4WYKB 3FG1A 3AMOA 1Q824 2JQ5A 4GSPA 1RGLA 4O8SA 4ZM8A 1LXEA 1LVNA 1PFPA 4XB5A 1EUIC 1GY6A 4JF8A 3DGMA 1QJGA 1V57A 1DYUA 1GOUA 1GY7A 1A90A 1IYYA 4BU4A 5G1KA 1YJW3 3F8HA 4EYCA 1FGMA 3FG3A 3NV0A 3NBJA 4FCZA 1X1YA 1I0VA 1STFI 1E3VA 1US1A 2CWUA 2IA7A 3AMOB 3WR2A 1CQSA 1JZOA 2KF5A 2CG0A 2ZL8A 1FUSA 1U5OA 2P0MA 2CFKA 2KAAA 3LXUX 3N9HA 1BIRA 1YIJ3 4XDWA 2WGQA 3F7XA 2HMOB 1KSIA 3EN8A 1G96A 1OUNA 1OGZA 5A0OB 3RNTA 3CPOA 3S28A 2QGUA 3MG1A 3NV0B 5BVBA 1IV9A 3KFQC 4BIRA 2BMRB 1TFKA 2UUGC 3DGYA 3PZWA 4WHAA 5D83A 4MMXB 4BTYA 3G4S3 1KQS2 1OH0A 3FLJA 1UCLA 2B1XB 1ISKA 2GBWB 2ZHXB 3MSOA 3NBBA 1I2FA 1ZGXA 3CC43 1K41A 3PCSA 4HJLB 3UNLA 4HM1B 2HMKB 1Q7HA 1WMNA 1UUWB 3CCQ3 2R41A 3WDGB 4U13A 3N54B 2IMJA 4DKIA 3KIIA 2GSPA 3S27A 3T8UA 7RNTA 2P05A 5AIFA 2RNTA 1CYVA 1IDPA 1TFOA 1JKGA 3LYGA 2KCDA 4I5QA 2H0IA 3LT9A 1ZS7A 1TU5A 1RN1A 1IV7A 2E2TA 3CMA3 5IG3A 3SVAA 2CFDA 3KKGA 4J8TA 1JNQA 5KP4A 1UW1A 2J8XB 2XH9A 2Y73A 2YFLB 3EJVA 3F8XA 2KRTA 4J5GA 2IUJA 3B8LA 8RNTA 1VQ53 1BRGA 2ZDJA 1RJOA 1NNVA 2BHMA 1GMQA 4HVNA 4WP5A 1CEWI 1E97A 1W6CA 3UB1A 5CXOA 1JKGB 2BU4A 1ULIB 1QAKA 5CLKA 3CCJ3 1I3IA 1STDA 2WOHA 2WOFA 4R1KA 2SBLA 4CDLA 1AY7A 1IT8A 3EF8A 1LNHA 1RNTA 2OWPA 3GZRA 3SYUA 1RRHA 2BMOB 3CNMA 3GZBA 5KP1A 3LTBA 4EXRA 1FA3A 1N9JA 2O9UX 4IIAA 2Z77A 3OWUA 3PS8A 1NDOB 5JPUA 4OK0A 1B3SA 3K0ZA 1MGWA 4KFEA 3Q1CA 2YX9A 2KF6A 1RCLA 3DGNA 1NB3I 1BUJA 4HM8B 1TRQA 4R9KA 1AVKA 1K8A4 2D1WA 1C54A 1A67A 1CH0A 1B21A 2F4YA 4I4KA 4IT7A 4CPKA 4G1MB 3WHOA 3FGYA 3KN4A 4N6OB 5CK6A 1YJN3 2WO0A 4N6TA 1JB5A 1NWWA 3CCU3 3AHWA 3GZXB 3HIIA 4LEHA 1LOWA 3LH4A 1O7NB 5AYRB 1W7CA 1D6UA 3DXOA 3FKAA 1SIIA 1SARA 3SEDA 5RNTA 3OW22 3BNEA 3JUQA 4R80A 1BNJA 1LNIA 2C10A 1RN4A 4RNYA 3EBTA 4EBGA 1N5PA 1TTOA 4HKVB 1N8R4 3CD63 5IG0A 4AKZA 3EC9A 4X2HA 3OV4A 4KT3B 1Y4KA 2IUKA 4FR9A 1U8CB 1VQP3 2F98A 1RGFA 1T2IA 4QWTA 1RTUA 3F14A 3F40A 3BU4A 1WTHA 2WGOA 5GSPA 7STDA 4N6V0 3AGOA 3X3YA 1E3RA 3X42A 4NPBA 3HZPA 2GU1A 1G0TA 2XSOB 3MPHA 5IG4A 1ZX2A 1JBSA 1IT7A 1GMPA 1T2HA 5LC6A 3MYTA 4LSOA 5JPPA 1GOVA 3K63A 2Q07A 3LTAA 1IQYA 3NM2A 4RNTA 3RGRA 1JBRA 3BNDA 1VZZA 1BNIA 4HBRA 5M18A 9RNTA 2KXGA 3FG4A 3D5GA 3U97A 4TX4A 4HM4B 5G2GA 3GSPA 1BNEA 2P0XA 3WOFB 3WA3A 2E2UA 4HAAA 1DETA 2Y74A 1SPUA 4JRFA 1KD14 1BSEA 3OWSA 3FF2A 1TP6A 3NBRA 4MJDA 1YHQ3 1MWSA 3RGAA 2MC8A 2CX0A 3AGNA 1YGEA 2CWVA 2OQEC 1NJI4 2F86B 1YNVX 1JV2B 4LZIA 3V99A 4CJNA 3WMDA 1Q42A 1O7GB 1VQ63 1BNRA 1JB4A 1X1WA 4N6MA 2I9WA 5M1AA 3WA2X 1B2SA 5AEUB 3DY5A 1FUWA 1BAOA 2H0GA 1DVCA 2PZVA 4L8OA
chains in the Genus database with same CATH topology
3LOYA 3CCS3 2CH9A 3CCE3 4AEQA 1D6ZA 3LTDA 1O7HB 1QVF2 2K0MA 2JDIH 2O3OA 1LOXA 2XFTA 3DGOA 4EV2A 3WOEB 1SQWA 1RKYA 1SJWA 2UX0A 3OWYA 4CCVA 1T5YA 5IERA 1O7MB 1VQ73 3KSED 1M1XB 1IQ8A 3F9SA 1QVG2 3OX9A 2M7OA 3B4PA 5AIHA 4KVHA 3O8YA 2L4VA 2GBXB 1ZO2A 3X41A 1W4NA 1EQKA 2OTL3 1W02A 4R4KA 2CK3H 2W0QA 5I97A 2P09A 5STDA 1BUQA 1MOLA 1W5ZA 1W2B2 3K5TA 3JUNA 3BB9A 3F7SA 5BXQA 2XEPA 1W2ZA 1UI7A 2W56A 8CHOA 4AKYA 1OHOA 2W9QA 1M1K4 2C11A 1ROAA 2YFJB 4IPBA 3NQZA 4N6NB 3D9RA 4K1VA 1AR0A 1AV4A 4STDA 1VQN3 4HM2B 5IF6A 2BMQB 1OF5B 2CFWA 3ER7A 3GZYB 3G6E3 1S723 3EX9A 4R9LA 2XFSA 3TDGA 3MKIA 1VQ93 1IVUA 1PU4A 2W56B 3DM8A 1OGXA 3SXXA 3CC73 5ELUA 2W9PA 3EE1A 1VQM3 3CC23 3OXAA 4O3VA 1DMNA 4BTXA 3V92A 3NQYA 3FH1A 2CFLA 3LZAA 3CNXA 1GYBA 5TGNA 2FNQA 4N6LA 4H3UA 1DMQA 1SIHA 1W01A 2W2CA 2A15A 1AVLA 1Q814 1RN7A 3CU3A 3FF0A 3X3ZA 2OOVC 5IW9A 2XR8B 2BT3A 1W6GA 3EHCA 1KC84 5DREA 5HGRA 3SOYA 3UJMA 1N8R4 1TIJA 2STDA 3B7CA 4MEIA 3G0KA 3PGBA 3UL5A 1IVXA 2XSHB 2GEYA 3JVCA 5EQLA 3EBYA 3V98A 1EKMA 1M904 1YIT3 1FGTA 1HKXA 2OCTA 4ORLA 1ULJB 1K9M4 5EVHA 6STDA 2Z6BA 3HK4A 2MF7A 4NREA 1YVBI 5CF2A 1VQ83 4WFOA 1NU3A 1IVWA 3JUPA 5AI1A 3G713 1QMAA 5AIIA 1FGOA 3FCSB 1W00A 4Q53A 3CCL3 1HU9A 1Q864 2ML5A 1K734 5AEWB 2RFRA 3PXMA 1QALA 4FMBA 1Q7Y4 3K9MC 2W6JH 1F8NA 1CYUA 2RGQA 2Z76A 5DRVA 4L8PA 1A2VA 1VQK3 1V74A 3J7Yd 3CCR3 3H3HA 1MNLA 2BO9B 4O2HA 4GL6A 2GXFA 4FCMA 2W03A 2OOVA 2HMNB 2RSXA 4X2OA 3X3XA 1WMOA 2CC3A 2K54A 4HZBB 1O7WB 1S5AA 2B24B 3MWZA 3Q90A 1RRLA 3LTCA 1JRQA 1WNHA 3PCRA 4KZ1A 3T8NA 3CME3 3IJEB 4HM7B 2CG1A 3H51A 4RNZA 1JB2A 3RDEA 3KE7A 1ASKA 2GU3A 2CFGA 1TUHA 1DMMA 4FMCA 1VQ43 3BNCA 1FGRA 1DVDA 5JBSA 5IENA 3Q2PA 2FXTA 1UI8A 3ECFA 2XRXB 3I553 1NB5I 1C7HA 1K28A 2W04A 3DZLA 4N6UA 4H61A 4EC6A 1IU7A 4XBXA 3SLUA 5CF1A 4HM5B 3LT8A 5FGOA 1ROVA 4FMDA 3ROBA 3S5CA 1R4CA 2QA43 3JUOA 3BLZA 3JUMA 5ELJA 4PEJA 2XGLA 4GB5A 4LGQA 2XGNA 3DMCA 4K61A 2RCDA 3KSPA 2OQEA 2XF3A 3DGLA 1N8QA 1GY5A 3NUVA 1L5GB 3U1WA 1OF5A 3MG2A 4J9AA 3B4OA 4NHFA 4WWUC 5D82A 3PYJA 1Z1SA 2ML6A 2CKFB 3STDA 3KZTA 5IEOA 4OVMA 4FCJA 4KFDA 4LMIA 4XBYA 4BTWA 3HIGA 4N3VA 5D81A 4RBNA 3VF1A 3G16A 1IQXA 3SX1A 3CPW2 3GRDA 1D6YA 2Z7AA 2QIYA 3S29A 3CCM3 3FZWA 1GD4A 1W6YA 2HMJB 1VQL3 4FMAA 3K7CA 3HI7A 5LC7A 2OTJ3 2V1LA 3IMAB 4K1UA 4KFFA 4RZMA 5AYSC 3GWRA 3M8CA 1OCVA 2HMMB 2D42A 2BNGA 3LMLA 4XBTA 4OUQA 2LYXA 3CCV3 1EG9B 1M9GA 1Q40A 4HM3B 3UL6A 1OACA 2CIUA 1O7PB 3I0YA 5KP3A 1IVVA 1VQO3 3X40A 3EB8A 2INXA 1YI23 1UUVB 3FSDA 1JN5A 1N5HA 4O02B 1IK3A 3NHXA 5FW5A 3CXC2 3BNBA 1OHPA 1Q40B 1WMPA 3EN1B 3G8ZA 1FGQA 3GAXA 2E2VA 2QEX3 3L0RA 4XDVA 5AIGA 5IEPA 3I563 2CHCA 3EQQB 3A76A 1GS3A 3N8BA 1OPYA 1JN5B 2CWTA 3NM7A 1YJ93 3NXJA 1GD3A 3SOAA 1QAFA 2F99A 2HMLB 1N9EA 4K90B 4HM0B 4XM4A 5EEOA 4HM6B 3VGNA 3D3LA 3QK9A 1A2KA 1WQLB 4WYKA 3QRDA 2PNCA 2R4IA 1J2BA 3NX0A 3MG3A 3VSYA 1NO3A 5IG5A 2LQVA 2GEXA 2YFIB 3DUKA 3MHEA 4HYZA 4L7KA 2CW9A 2P38A 4HZ9B 3IPTA 1KWIA 3S67A 3ALAA 1OHSA 3T0UA 3E99A 1EA2A 4MMYB 4MMZB 3WODG 2FGTA 1JJ22 4EV5A 3HX8A 4WYKB 3FG1A 3AMOA 1Q824 2JQ5A 4O8SA 4ZM8A 1LXEA 1LVNA 1PFPA 4XB5A 1GY6A 4JF8A 3DGMA 1QJGA 1DYUA 1A90A 1GY7A 1YJW3 3F8HA 4EYCA 1FGMA 3FG3A 3NV0A 3NBJA 4FCZA 2CWUA 1STFI 1E3VA 1US1A 2IA7A 3AMOB 1CQSA 2ZL8A 2CG0A 2P0MA 1U5OA 3LXUX 2CFKA 3N9HA 1YIJ3 4XDWA 2WGQA 3F7XA 2HMOB 1KSIA 3EN8A 1G96A 1OUNA 1OGZA 5A0OB 3CPOA 3S28A 2QGUA 3MG1A 3NV0B 5BVBA 1IV9A 3KFQC 2BMRB 1TFKA 3G4S3 4WHAA 3PZWA 5D83A 4MMXB 4BTYA 1KQS2 1OH0A 3FLJA 2B1XB 1ISKA 2GBWB 3NBBA 3MSOA 3CC43 1K41A 3PCSA 4HJLB 3UNLA 4HM1B 2HMKB 1WMNA 1UUWB 3CCQ3 3WDGB 4U13A 3N54B 2IMJA 3KIIA 3S27A 3T8UA 2P05A 5AIFA 1CYVA 1IDPA 1TFOA 1JKGA 3LYGA 2KCDA 3LT9A 1TU5A 2E2TA 1IV7A 3CMA3 5IG3A 3SVAA 2CFDA 3KKGA 4J8TA 1JNQA 5KP4A 1UW1A 2XH9A 3EJVA 2Y73A 2YFLB 3F8XA 2KRTA 2IUJA 3B8LA 1VQ53 2ZDJA 1RJOA 2BHMA 4HVNA 4WP5A 1CEWI 1E97A 1W6CA 3UB1A 5CXOA 1JKGB 1ULIB 1QAKA 5CLKA 3CCJ3 1STDA 2WOHA 2WOFA 4R1KA 2SBLA 4CDLA 1IT8A 3EF8A 1LNHA 2OWPA 3GZRA 1RRHA 2BMOB 3CNMA 3GZBA 5KP1A 3LTBA 4EXRA 1FA3A 1N9JA 2O9UX 4IIAA 2Z77A 3OWUA 3PS8A 1NDOB 5JPUA 4OK0A 3K0ZA 4KFEA 3Q1CA 2YX9A 3DGNA 1NB3I 4HM8B 4R9KA 1AVKA 1K8A4 2D1WA 1A67A 4I4KA 4IT7A 4G1MB 3FGYA 3KN4A 4N6OB 5CK6A 1YJN3 2WO0A 4N6TA 1JB5A 1NWWA 3CCU3 3GZXB 3HIIA 4LEHA 3LH4A 1O7NB 5AYRB 1W7CA 1D6UA 3DXOA 3FKAA 1SIIA 3SEDA 3OW22 3BNEA 3JUQA 4R80A 2C10A 4RNYA 3EBTA 4EBGA 1N5PA 4HKVB 3CD63 5IG0A 4AKZA 3EC9A 4X2HA 3OV4A 1Y4KA 2IUKA 4FR9A 1U8CB 1VQP3 2F98A 4QWTA 3F14A 3F40A 1WTHA 2WGOA 7STDA 4N6V0 3X3YA 1E3RA 3X42A 3HZPA 2GU1A 3MPHA 2XSOB 5IG4A 1ZX2A 1IT7A 5LC6A 3MYTA 4LSOA 5JPPA 3K63A 2Q07A 3LTAA 1IQYA 3NM2A 3RGRA 3BNDA 1VZZA 4HBRA 2KXGA 3FG4A 3U97A 4TX4A 4HM4B 5G2GA 2P0XA 3WOFB 3WA3A 2E2UA 2Y74A 1SPUA 4JRFA 1KD14 3OWSA 3FF2A 1TP6A 3NBRA 4MJDA 1YHQ3 3RGAA 2MC8A 1NJI4 1YGEA 2CWVA 2OQEC 2F86B 3V99A 1JV2B 4LZIA 3WMDA 1Q42A 1O7GB 1VQ63 1JB4A 4N6MA 2I9WA 3WA2X 5AEUB 1FUWA 3DY5A 1DVCA 2PZVA 4L8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7H B;  1SJW A;  2UX0 A;  3OWY A;  5IER A;  1O7M B;  3F9S A;  3OX9 A;  5AIH A;  3B4P A;  4KVH A;  2GBX B;  1ZO2 A;  1W02 A;  5STD A;  1BUQ A;  5BXQ A;  3JUN A;  3BB9 A;  3F7S A;  8CHO A;  1OHO A;  2YFJ B;  3D9R A;  4K1V A;  1AR0 A;  4STD A;  4HM2 B;  5IF6 A;  2BMQ B;  1OF5 B;  3ER7 A;  3GZY B;  3EX9 A;  4R9L A;  3MKI A;  3DM8 A;  1OGX A;  3OXA A;  1DMN A;  3FH1 A;  3LZA A;  3CNX A;  1GYB A;  5TGN A;  4H3U A;  1DMQ A;  1W01 A;  2W2C A;  2A15 A;  3CU3 A;  3FF0 A;  2XR8 B;  3EHC A;  5DRE A;  5HGR A;  3UJM A;  3SOY A;  3B7C A;  2STD A;  3G0K A;  2XSH B;  2GEY A;  3EBY A;  1HKX A;  4ORL A;  1ULJ B;  5EVH A;  6STD A;  3HK4 A;  5CF2 A;  1NU3 A;  3JUP A;  5AI1 A;  1QMA A;  5AII A;  1W00 A;  4Q53 A;  5AEW B;  2RFR A;  2RGQ A;  2Z76 A;  5DRV A;  4L8P A;  3H3H A;  2GXF A;  4FCM A;  2HMN B;  4X2O A;  2K54 A;  4HZB B;  1O7W B;  1S5A A;  2B24 B;  3Q90 A;  3T8N A;  4HM7 B;  3H51 A;  1JB2 A;  3KE7 A;  1ASK A;  1TUH A;  1DMM A;  5IEN A;  3ECF A;  2XRX B;  1C7H A;  3DZL A;  4XBX A;  5CF1 A;  4HM5 B;  3ROB A;  3S5C A;  3JUO A;  3BLZ A;  3JUM A;  4PEJ A;  4GB5 A;  4LGQ A;  3DMC A;  2RCD A;  3KSP A;  1GY5 A;  3NUV A;  1OF5 A;  3MG2 A;  4J9A A;  3B4O A;  4WWU C;  5D82 A;  1Z1S A;  2CKF B;  3STD A;  3KZT A;  5IEO A;  4OVM A;  4FCJ A;  4LMI A;  4XBY A;  4N3V A;  5D81 A;  3G16 A;  3GRD A;  2Z7A A;  2QIY A;  3FZW A;  1W6Y A;  2HMJ B;  3K7C A;  4K1U A;  4RZM A;  3GWR A;  3M8C A;  1OCV A;  2HMM B;  4XBT A;  2BNG A;  4OUQ A;  1EG9 B;  1Q40 A;  4HM3 B;  1O7P B;  3I0Y A;  5KP3 A;  2INX A;  1UUV B;  3FSD A;  1JN5 A;  3NHX A;  5FW5 A;  1OHP A;  1Q40 B;  3EN1 B;  3G8Z A;  4XDV A;  5AIG A;  5IEP A;  2CHC A;  3EQQ B;  3A76 A;  1GS3 A;  1OPY A;  1JN5 B;  3NXJ A;  3SOA A;  2F99 A;  2HML B;  4HM0 B;  4XM4 A;  4HM6 B;  3VGN A;  1A2K A;  1WQL B;  4WYK A;  2R4I A;  3MG3 A;  3VSY A;  5IG5 A;  2GEX A;  2YFI B;  3DUK A;  3MHE A;  4L7K A;  4HZ9 B;  3IPT A;  1OHS A;  3E99 A;  1EA2 A;  3HX8 A;  4WYK B;  2JQ5 A;  4XB5 A;  1GY6 A;  1QJG A;  1GY7 A;  3F8H A;  3NV0 A;  1E3V A;  1CQS A;  1U5O A;  4XDW A;  3F7X A;  2HMO B;  3EN8 A;  1OUN A;  1OGZ A;  3CPO A;  2QGU A;  3MG1 A;  3NV0 B;  5BVB A;  2BMR B;  5D83 A;  1OH0 A;  3FLJ A;  2B1X B;  1ISK A;  2GBW B;  3MSO A;  1K41 A;  4HJL B;  3UNL A;  4HM1 B;  2HMK B;  1UUW B;  4U13 A;  2IMJ A;  3T8U A;  5AIF A;  1IDP A;  1JKG A;  3LYG A;  5IG3 A;  3KKG A;  4J8T A;  5KP4 A;  3EJV A;  3F8X A;  2YFL B;  3B8L A;  4HVN A;  4WP5 A;  1E97 A;  5CXO A;  1JKG B;  1ULI B;  5CLK A;  1STD A;  4R1K A;  4CDL A;  3EF8 A;  2OWP A;  3GZR A;  2BMO B;  3CNM A;  3GZB A;  5KP1 A;  4IIA A;  2Z77 A;  3OWU A;  1NDO B;  5JPU A;  3K0Z A;  4HM8 B;  4R9K A;  4I4K A;  3FGY A;  5CK6 A;  1JB5 A;  1NWW A;  3GZX B;  4LEH A;  1O7N B;  3FKA A;  3DXO A;  3SED A;  3JUQ A;  3EBT A;  4HKV B;  5IG0 A;  3EC9 A;  4X2H A;  3OV4 A;  2F98 A;  3F14 A;  3F40 A;  7STD A;  1E3R A;  3HZP A;  5IG4 A;  2XSO B;  1ZX2 A;  3MYT A;  5JPP A;  3RGR A;  3NM2 A;  1VZZ A;  4HM4 B;  5G2G A;  3OWS A;  3FF2 A;  1TP6 A;  3NBR A;  4MJD A;  3RGA A;  2F86 B;  3WMD A;  1Q42 A;  1O7G B;  1JB4 A;  2I9W A;  5AEU B;  2PZV A;  4L8O A; 
#chains in the Genus database with same CATH topology
 3LOY A;  3CCS 3;  2CH9 A;  3CCE 3;  4AEQ A;  1D6Z A;  3LTD A;  1O7H B;  1QVF 2;  2K0M A;  2JDI H;  1BRS A;  2O3O A;  1LOX A;  2XFT A;  3DGO A;  1RGA A;  1PY3 A;  4EV2 A;  3WOE B;  1SQW A;  1RKY A;  1SJW A;  2UX0 A;  3OWY A;  2F56 A;  4CCV A;  1T5Y A;  5IER A;  1O7M B;  4J5K A;  1YVS A;  1VQ7 3;  3KSE D;  1M1X B;  1IQ8 A;  3F9S A;  1QVG 2;  2AAD A;  3OX9 A;  2M7O A;  3B4P A;  5AIH A;  4KVH A;  3O8Y A;  2L4V A;  2GBX B;  1ZO2 A;  3X41 A;  1MWR A;  4HOH A;  1W4N A;  1GSP A;  1EQK A;  4BL3 A;  2OTL 3;  1A2P A;  1RGH A;  1W02 A;  1RLS A;  4R4K A;  2AAE A;  2CK3 H;  2L1S A;  2W0Q A;  5I97 A;  2P09 A;  1GOY A;  1BRI A;  5STD A;  1I2E A;  1BUQ A;  1MOL A;  1W5Z A;  1W2B 2;  1RMS A;  2K3D A;  3AHS A;  3K5T A;  3JUN A;  3BB9 A;  1LRA A;  3F7S A;  5BXQ A;  2XEP A;  1W2Z A;  1B20 A;  1UI7 A;  1FUT A;  2W56 A;  8CHO A;  4AKY A;  1OHO A;  2W9Q A;  1MWU A;  1M1K 4;  2C11 A;  1ROA A;  2YFJ B;  4IPB A;  3NQZ A;  4N6N B;  3D9R A;  4K1V A;  1AR0 A;  1AV4 A;  4STD A;  4BL2 A;  4HM2 B;  5IF6 A;  1VQN 3;  3ZG5 A;  2BMQ B;  1OF5 B;  2CFW A;  3ER7 A;  3GZY B;  1LQG C;  3G6E 3;  1S72 3;  3EX9 A;  1UDI I;  1PYL A;  3ZG0 A;  4R9L A;  2XFS A;  3TDG A;  3MKI A;  1VQ9 3;  1IVU A;  1PU4 A;  2W56 B;  3DM8 A;  1OGX A;  3SXX A;  3CC7 3;  5ELU A;  2F5M A;  2W9P A;  3EE1 A;  1VQM 3;  1RSN A;  3D5I A;  3CC2 3;  3OXA A;  4O3V A;  1DMN A;  4BTX A;  1BRK A;  3V92 A;  3NQY A;  2IYJ A;  1RCK A;  3FH1 A;  2CFL A;  3LZA A;  1BNF A;  3CNX A;  1GYB A;  5TGN A;  2FNQ A;  4N6L A;  1V58 A;  4H3U A;  1DMQ A;  1SIH A;  1W01 A;  2W2C A;  1RGG A;  3D4A A;  2A15 A;  1AVL A;  1Q81 4;  3BIR A;  7GSP A;  1RN7 A;  3CU3 A;  3FF0 A;  1B2U A;  2OOV C;  3X3Z A;  2XR8 B;  2BT3 A;  1W6G A;  3EHC A;  5IW9 A;  1KC8 4;  5DRE A;  5HGR A;  3SOY A;  4GHO A;  3UJM A;  1TIJ A;  2STD A;  3B7C A;  4MEI A;  3G0K A;  3PGB A;  3UL5 A;  1B2X A;  1IVX A;  2XSH B;  2GEY A;  3JVC A;  5EQL A;  3EBY A;  3V98 A;  1EKM A;  1M90 4;  1YIT 3;  1FGT A;  1HKX A;  1VQQ A;  2OCT A;  1BRJ A;  4ORL A;  1ULJ B;  1K9M 4;  1I70 A;  5EVH A;  6STD A;  5M19 A;  2Z6B A;  3HK4 A;  2MF7 A;  4NRE A;  1UCI A;  1YVB I;  5CF2 A;  6GSP A;  4WFO A;  1VQ8 3;  1NU3 A;  2BIR A;  1IVW A;  1RDS A;  3JUP A;  5AI1 A;  3G71 3;  1QMA A;  5AII A;  1FGO A;  3FCS B;  1W00 A;  4Q53 A;  1X1U A;  3CCL 3;  1HU9 A;  1Q86 4;  2ML5 A;  1K73 4;  5AEW B;  2KF4 A;  2RFR A;  1I2G A;  3PXM A;  1QAL A;  3DH2 A;  1EEJ A;  4FMB A;  1Q7Y 4;  3K9M C;  2W6J H;  1F8N A;  1CYU A;  2RGQ A;  2Z76 A;  5DRV A;  4L8P A;  1A2V A;  1RGC A;  1B27 A;  1VQK 3;  1V74 A;  3J7Y d;  3CCR 3;  3H3H A;  1MNL A;  2BO9 B;  4O2H A;  4GL6 A;  1X1X A;  2GXF A;  4FCM A;  1BVI A;  2W03 A;  2OOV A;  1BNS A;  2HMN B;  1UCK A;  2RSX A;  4X2O A;  1RGE A;  1LQM B;  3X3X A;  1WMO A;  2CC3 A;  2K54 A;  4HZB B;  1O7W B;  1S5A A;  2B24 B;  3MWZ A;  3Q90 A;  1RRL A;  3LTC A;  1JRQ A;  1WNH A;  3PCR A;  4KZ1 A;  3T8N A;  2F5W A;  3A5E A;  3CME 3;  4LYL B;  1RGK A;  3IJE B;  4HM7 B;  2CG1 A;  3H51 A;  4RNZ A;  1JB2 A;  3RDE A;  1BAN A;  3KE7 A;  1ASK A;  1RNB A;  2GU3 A;  2IY2 A;  2CFG A;  1TUH A;  1DMM A;  4FMC A;  5BU4 A;  3KCH A;  3BNC A;  1VQ4 3;  1FGR A;  1DVD A;  5JBS A;  5BIR A;  5IEN A;  2ZA4 A;  3Q2P A;  2FXT A;  1UI8 A;  3ECF A;  1JZD A;  2XRX B;  3I55 3;  1NB5 I;  1C7H A;  1K28 A;  2W04 A;  3DZL A;  1TRP A;  4H61 A;  4N6U A;  1IU7 A;  4EC6 A;  4XBX A;  3SLU A;  5CF1 A;  1HZ1 A;  1BSA A;  4HM5 B;  1UGH I;  3LT8 A;  5FGO A;  1ROV A;  4FMD A;  3ROB A;  3S5C A;  1R4C A;  2QA4 3;  3JUO A;  3BLZ A;  1B2Z A;  3JUM A;  5ELJ A;  1T3B A;  4PEJ A;  2C4B A;  3HOH A;  2XGL A;  4GB5 A;  4LGQ A;  2XGN A;  3DMC A;  1TJD A;  1BRH A;  4K61 A;  2RCD A;  3KSP A;  2OQE A;  2XF3 A;  3DGL A;  1N8Q A;  1GY5 A;  3NUV A;  1L5G B;  3U1W A;  1OF5 A;  3MG2 A;  1UUG B;  4J9A A;  1BRN L;  3B4O A;  4NHF A;  4WWU C;  1BSC A;  1I0X A;  2SAR A;  5D82 A;  3PYJ A;  1Z1S A;  2ML6 A;  1B2M A;  2CKF B;  3STD A;  2H0H A;  3KZT A;  1UCJ A;  5IEO A;  4EW5 A;  1LOY A;  4OVM A;  1YGW A;  4FCJ A;  1MWT A;  4ILF A;  4KFD A;  4LMI A;  4XBY A;  4BTW A;  3HIG A;  4N3V A;  5D81 A;  4RBN A;  3VF1 A;  1Q9E A;  1IQX A;  3G16 A;  3SX1 A;  1UGI A;  3CPW 2;  3GRD A;  1D6Y A;  2Z7A A;  2QIY A;  3S29 A;  3CCM 3;  1BGS A;  3FZW A;  1GD4 A;  1W6Y A;  6RNT A;  2HMJ B;  1VQL 3;  4FMA A;  3K7C A;  1BNG A;  3HI7 A;  5LC7 A;  2V1L A;  3IMA B;  2OTJ 3;  4K1U A;  4KFF A;  4RZM A;  5AYS C;  3GWR A;  1DE3 A;  3M8C A;  1OCV A;  2HMM B;  2D42 A;  2BNG A;  3LML A;  4XBT A;  4OUQ A;  2LYX A;  3CCV 3;  1EG9 B;  1M9G A;  1Q40 A;  4HM3 B;  3UL6 A;  1OAC A;  2CIU A;  1O7P B;  3I0Y A;  5KP3 A;  1IVV A;  1VQO 3;  3X40 A;  3EB8 A;  2INX A;  1YI2 3;  1UUV B;  3FSD A;  1JN5 A;  1N5H A;  1FZU A;  4O02 B;  5G1L A;  2UGI A;  3NHX A;  1IK3 A;  5FW5 A;  1I8V A;  3CXC 2;  3BNB A;  1R4Y A;  1OHP A;  1Q40 B;  1WMP A;  1BSD A;  1AQZ A;  2CX1 A;  3EN1 B;  1I3F A;  3G8Z A;  1FGQ A;  3GAX A;  2E2V A;  2QEX 3;  3L0R A;  1GMR A;  1G02 A;  4XDV A;  2RBI A;  1MGR A;  5AIG A;  5IEP A;  1LOV A;  3I56 3;  2CHC A;  3EQQ B;  3A76 A;  1GS3 A;  3N8B A;  1OPY A;  1JN5 B;  2CWT A;  3NM7 A;  1YJ9 3;  3NXJ A;  1GD3 A;  3SOA A;  1FW7 A;  1QAF A;  2F99 A;  2HML B;  1N9E A;  4K90 B;  2HOH A;  4HM0 B;  4XM4 A;  2KF3 A;  3URP A;  5EEO A;  1BU4 A;  1BOX A;  4HM6 B;  3D3L A;  3VGN A;  5HOH A;  1JBT A;  3QK9 A;  1A2K A;  1WQL B;  4WYK A;  3QRD A;  2PNC A;  2R4I A;  1J2B A;  3NX0 A;  3ZFZ A;  3MG3 A;  3VSY A;  1NO3 A;  3D79 A;  5IG5 A;  2LQV A;  3Q3F A;  2GEX A;  2YFI B;  3DUK A;  3MHE A;  4HYZ A;  4L7K A;  1BSB A;  2CW9 A;  2P38 A;  4HZ9 B;  3IPT A;  1HYF A;  1KWI A;  3S67 A;  3ALA A;  1OHS A;  3T0U A;  3E99 A;  1EA2 A;  4MMY B;  4MMZ B;  3WOD G;  2FGT A;  1FYS A;  1RHL A;  1JJ2 2;  4EV5 A;  3HX8 A;  4WYK B;  3FG1 A;  3AMO A;  1Q82 4;  2JQ5 A;  4GSP A;  1RGL A;  4O8S A;  4ZM8 A;  1LXE A;  1LVN A;  1PFP A;  4XB5 A;  1EUI C;  1GY6 A;  4JF8 A;  3DGM A;  1QJG A;  1V57 A;  1DYU A;  1GOU A;  1GY7 A;  1A90 A;  1IYY A;  4BU4 A;  5G1K A;  1YJW 3;  3F8H A;  4EYC A;  1FGM A;  3FG3 A;  3NV0 A;  3NBJ A;  4FCZ A;  1X1Y A;  1I0V A;  1STF I;  1E3V A;  1US1 A;  2CWU A;  2IA7 A;  3AMO B;  3WR2 A;  1CQS A;  1JZO A;  2KF5 A;  2CG0 A;  2ZL8 A;  1FUS A;  1U5O A;  2P0M A;  2CFK A;  2KAA A;  3LXU X;  3N9H A;  1BIR A;  1YIJ 3;  4XDW A;  2WGQ A;  3F7X A;  2HMO B;  1KSI A;  3EN8 A;  1G96 A;  1OUN A;  1OGZ A;  5A0O B;  3RNT A;  3CPO A;  3S28 A;  2QGU A;  3MG1 A;  3NV0 B;  5BVB A;  1IV9 A;  3KFQ C;  4BIR A;  2BMR B;  1TFK A;  2UUG C;  3DGY A;  3PZW A;  4WHA A;  5D83 A;  4MMX B;  4BTY A;  3G4S 3;  1KQS 2;  1OH0 A;  3FLJ A;  1UCL A;  2B1X B;  1ISK A;  2GBW B;  2ZHX B;  3MSO A;  3NBB A;  1I2F A;  1ZGX A;  3CC4 3;  1K41 A;  3PCS A;  4HJL B;  3UNL A;  4HM1 B;  2HMK B;  1Q7H A;  1WMN A;  1UUW B;  3CCQ 3;  2R41 A;  3WDG B;  4U13 A;  3N54 B;  2IMJ A;  4DKI A;  3KII A;  2GSP A;  3S27 A;  3T8U A;  7RNT A;  2P05 A;  5AIF A;  2RNT A;  1CYV A;  1IDP A;  1TFO A;  1JKG A;  3LYG A;  2KCD A;  4I5Q A;  2H0I A;  3LT9 A;  1ZS7 A;  1TU5 A;  1RN1 A;  1IV7 A;  2E2T A;  3CMA 3;  5IG3 A;  3SVA A;  2CFD A;  3KKG A;  4J8T A;  1JNQ A;  5KP4 A;  1UW1 A;  2J8X B;  2XH9 A;  2Y73 A;  2YFL B;  3EJV A;  3F8X A;  2KRT A;  4J5G A;  2IUJ A;  3B8L A;  8RNT A;  1VQ5 3;  1BRG A;  2ZDJ A;  1RJO A;  1NNV A;  2BHM A;  1GMQ A;  4HVN A;  4WP5 A;  1CEW I;  1E97 A;  1W6C A;  3UB1 A;  5CXO A;  1JKG B;  2BU4 A;  1ULI B;  1QAK A;  5CLK A;  3CCJ 3;  1I3I A;  1STD A;  2WOH A;  2WOF A;  4R1K A;  2SBL A;  4CDL A;  1AY7 A;  1IT8 A;  3EF8 A;  1LNH A;  1RNT A;  2OWP A;  3GZR A;  3SYU A;  1RRH A;  2BMO B;  3CNM A;  3GZB A;  5KP1 A;  3LTB A;  4EXR A;  1FA3 A;  1N9J A;  2O9U X;  4IIA A;  2Z77 A;  3OWU A;  3PS8 A;  1NDO B;  5JPU A;  4OK0 A;  1B3S A;  3K0Z A;  1MGW A;  4KFE A;  3Q1C A;  2YX9 A;  2KF6 A;  1RCL A;  3DGN A;  1NB3 I;  1BUJ A;  4HM8 B;  1TRQ A;  4R9K A;  1AVK A;  1K8A 4;  2D1W A;  1C54 A;  1A67 A;  1CH0 A;  1B21 A;  2F4Y A;  4I4K A;  4IT7 A;  4CPK A;  4G1M B;  3WHO A;  3FGY A;  3KN4 A;  4N6O B;  5CK6 A;  1YJN 3;  2WO0 A;  4N6T A;  1JB5 A;  1NWW A;  3CCU 3;  3AHW A;  3GZX B;  3HII A;  4LEH A;  1LOW A;  3LH4 A;  1O7N B;  5AYR B;  1W7C A;  1D6U A;  3DXO A;  3FKA A;  1SII A;  1SAR A;  3SED A;  5RNT A;  3OW2 2;  3BNE A;  3JUQ A;  4R80 A;  1BNJ A;  1LNI A;  2C10 A;  1RN4 A;  4RNY A;  3EBT A;  4EBG A;  1N5P A;  1TTO A;  4HKV B;  1N8R 4;  3CD6 3;  5IG0 A;  4AKZ A;  3EC9 A;  4X2H A;  3OV4 A;  4KT3 B;  1Y4K A;  2IUK A;  4FR9 A;  1U8C B;  1VQP 3;  2F98 A;  1RGF A;  1T2I A;  4QWT A;  1RTU A;  3F14 A;  3F40 A;  3BU4 A;  1WTH A;  2WGO A;  5GSP A;  7STD A;  4N6V 0;  3AGO A;  3X3Y A;  1E3R A;  3X42 A;  4NPB A;  3HZP A;  2GU1 A;  1G0T A;  2XSO B;  3MPH A;  5IG4 A;  1ZX2 A;  1JBS A;  1IT7 A;  1GMP A;  1T2H A;  5LC6 A;  3MYT A;  4LSO A;  5JPP A;  1GOV A;  3K63 A;  2Q07 A;  3LTA A;  1IQY A;  3NM2 A;  4RNT A;  3RGR A;  1JBR A;  3BND A;  1VZZ A;  1BNI A;  4HBR A;  5M18 A;  9RNT A;  2KXG A;  3FG4 A;  3D5G A;  3U97 A;  4TX4 A;  4HM4 B;  5G2G A;  3GSP A;  1BNE A;  2P0X A;  3WOF B;  3WA3 A;  2E2U A;  4HAA A;  1DET A;  2Y74 A;  1SPU A;  4JRF A;  1KD1 4;  1BSE A;  3OWS A;  3FF2 A;  1TP6 A;  3NBR A;  4MJD A;  1YHQ 3;  1MWS A;  3RGA A;  2MC8 A;  2CX0 A;  3AGN A;  1YGE A;  2CWV A;  2OQE C;  1NJI 4;  2F86 B;  1YNV X;  1JV2 B;  4LZI A;  3V99 A;  4CJN A;  3WMD A;  1Q42 A;  1O7G B;  1VQ6 3;  1BNR A;  1JB4 A;  1X1W A;  4N6M A;  2I9W A;  5M1A A;  3WA2 X;  1B2S A;  5AEU B;  3DY5 A;  1FUW A;  1BAO A;  2H0G A;  1DVC A;  2PZV A;  4L8O A; 
#chains in the Genus database with same CATH homology
 3LOY A;  3CCS 3;  2CH9 A;  3CCE 3;  4AEQ A;  1D6Z A;  3LTD A;  1O7H B;  1QVF 2;  2K0M A;  2JDI H;  2O3O A;  1LOX A;  2XFT A;  3DGO A;  4EV2 A;  3WOE B;  1SQW A;  1RKY A;  1SJW A;  2UX0 A;  3OWY A;  4CCV A;  1T5Y A;  5IER A;  1O7M B;  1VQ7 3;  3KSE D;  1M1X B;  1IQ8 A;  3F9S A;  1QVG 2;  3OX9 A;  2M7O A;  3B4P A;  5AIH A;  4KVH A;  3O8Y A;  2L4V A;  2GBX B;  1ZO2 A;  3X41 A;  1W4N A;  1EQK A;  2OTL 3;  1W02 A;  4R4K A;  2CK3 H;  2W0Q A;  5I97 A;  2P09 A;  5STD A;  1BUQ A;  1MOL A;  1W5Z A;  1W2B 2;  3K5T A;  3JUN A;  3BB9 A;  3F7S A;  5BXQ A;  2XEP A;  1W2Z A;  1UI7 A;  2W56 A;  8CHO A;  4AKY A;  1OHO A;  2W9Q A;  1M1K 4;  2C11 A;  1ROA A;  2YFJ B;  4IPB A;  3NQZ A;  4N6N B;  3D9R A;  4K1V A;  1AR0 A;  1AV4 A;  4STD A;  1VQN 3;  4HM2 B;  5IF6 A;  2BMQ B;  1OF5 B;  2CFW A;  3ER7 A;  3GZY B;  3G6E 3;  1S72 3;  3EX9 A;  4R9L A;  2XFS A;  3TDG A;  3MKI A;  1VQ9 3;  1IVU A;  1PU4 A;  2W56 B;  3DM8 A;  1OGX A;  3SXX A;  3CC7 3;  5ELU A;  2W9P A;  3EE1 A;  1VQM 3;  3CC2 3;  3OXA A;  4O3V A;  1DMN A;  4BTX A;  3V92 A;  3NQY A;  3FH1 A;  2CFL A;  3LZA A;  3CNX A;  1GYB A;  5TGN A;  2FNQ A;  4N6L A;  4H3U A;  1DMQ A;  1SIH A;  1W01 A;  2W2C A;  2A15 A;  1AVL A;  1Q81 4;  1RN7 A;  3CU3 A;  3FF0 A;  3X3Z A;  2OOV C;  5IW9 A;  2XR8 B;  2BT3 A;  1W6G A;  3EHC A;  1KC8 4;  5DRE A;  5HGR A;  3SOY A;  3UJM A;  1N8R 4;  1TIJ A;  2STD A;  3B7C A;  4MEI A;  3G0K A;  3PGB A;  3UL5 A;  1IVX A;  2XSH B;  2GEY A;  3JVC A;  5EQL A;  3EBY A;  3V98 A;  1EKM A;  1M90 4;  1YIT 3;  1FGT A;  1HKX A;  2OCT A;  4ORL A;  1ULJ B;  1K9M 4;  5EVH A;  6STD A;  2Z6B A;  3HK4 A;  2MF7 A;  4NRE A;  1YVB I;  5CF2 A;  1VQ8 3;  4WFO A;  1NU3 A;  1IVW A;  3JUP A;  5AI1 A;  3G71 3;  1QMA A;  5AII A;  1FGO A;  3FCS B;  1W00 A;  4Q53 A;  3CCL 3;  1HU9 A;  1Q86 4;  2ML5 A;  1K73 4;  5AEW B;  2RFR A;  3PXM A;  1QAL A;  4FMB A;  1Q7Y 4;  3K9M C;  2W6J H;  1F8N A;  1CYU A;  2RGQ A;  2Z76 A;  5DRV A;  4L8P A;  1A2V A;  1VQK 3;  1V74 A;  3J7Y d;  3CCR 3;  3H3H A;  1MNL A;  2BO9 B;  4O2H A;  4GL6 A;  2GXF A;  4FCM A;  2W03 A;  2OOV A;  2HMN B;  2RSX A;  4X2O A;  3X3X A;  1WMO A;  2CC3 A;  2K54 A;  4HZB B;  1O7W B;  1S5A A;  2B24 B;  3MWZ A;  3Q90 A;  1RRL A;  3LTC A;  1JRQ A;  1WNH A;  3PCR A;  4KZ1 A;  3T8N A;  3CME 3;  3IJE B;  4HM7 B;  2CG1 A;  3H51 A;  4RNZ A;  1JB2 A;  3RDE A;  3KE7 A;  1ASK A;  2GU3 A;  2CFG A;  1TUH A;  1DMM A;  4FMC A;  1VQ4 3;  3BNC A;  1FGR A;  1DVD A;  5JBS A;  5IEN A;  3Q2P A;  2FXT A;  1UI8 A;  3ECF A;  2XRX B;  3I55 3;  1NB5 I;  1C7H A;  1K28 A;  2W04 A;  3DZL A;  4N6U A;  4H61 A;  4EC6 A;  1IU7 A;  4XBX A;  3SLU A;  5CF1 A;  4HM5 B;  3LT8 A;  5FGO A;  1ROV A;  4FMD A;  3ROB A;  3S5C A;  1R4C A;  2QA4 3;  3JUO A;  3BLZ A;  3JUM A;  5ELJ A;  4PEJ A;  2XGL A;  4GB5 A;  4LGQ A;  2XGN A;  3DMC A;  4K61 A;  2RCD A;  3KSP A;  2OQE A;  2XF3 A;  3DGL A;  1N8Q A;  1GY5 A;  3NUV A;  1L5G B;  3U1W A;  1OF5 A;  3MG2 A;  4J9A A;  3B4O A;  4NHF A;  4WWU C;  5D82 A;  3PYJ A;  1Z1S A;  2ML6 A;  2CKF B;  3STD A;  3KZT A;  5IEO A;  4OVM A;  4FCJ A;  4KFD A;  4LMI A;  4XBY A;  4BTW A;  3HIG A;  4N3V A;  5D81 A;  4RBN A;  3VF1 A;  3G16 A;  1IQX A;  3SX1 A;  3CPW 2;  3GRD A;  1D6Y A;  2Z7A A;  2QIY A;  3S29 A;  3CCM 3;  3FZW A;  1GD4 A;  1W6Y A;  2HMJ B;  1VQL 3;  4FMA A;  3K7C A;  3HI7 A;  5LC7 A;  2OTJ 3;  2V1L A;  3IMA B;  4K1U A;  4KFF A;  4RZM A;  5AYS C;  3GWR A;  3M8C A;  1OCV A;  2HMM B;  2D42 A;  2BNG A;  3LML A;  4XBT A;  4OUQ A;  2LYX A;  3CCV 3;  1EG9 B;  1M9G A;  1Q40 A;  4HM3 B;  3UL6 A;  1OAC A;  2CIU A;  1O7P B;  3I0Y A;  5KP3 A;  1IVV A;  1VQO 3;  3X40 A;  3EB8 A;  2INX A;  1YI2 3;  1UUV B;  3FSD A;  1JN5 A;  1N5H A;  4O02 B;  1IK3 A;  3NHX A;  5FW5 A;  3CXC 2;  3BNB A;  1OHP A;  1Q40 B;  1WMP A;  3EN1 B;  3G8Z A;  1FGQ A;  3GAX A;  2E2V A;  2QEX 3;  3L0R A;  4XDV A;  5AIG A;  5IEP A;  3I56 3;  2CHC A;  3EQQ B;  3A76 A;  1GS3 A;  3N8B A;  1OPY A;  1JN5 B;  2CWT A;  3NM7 A;  1YJ9 3;  3NXJ A;  1GD3 A;  3SOA A;  1QAF A;  2F99 A;  2HML B;  1N9E A;  4K90 B;  4HM0 B;  4XM4 A;  5EEO A;  4HM6 B;  3VGN A;  3D3L A;  3QK9 A;  1A2K A;  1WQL B;  4WYK A;  3QRD A;  2PNC A;  2R4I A;  1J2B A;  3NX0 A;  3MG3 A;  3VSY A;  1NO3 A;  5IG5 A;  2LQV A;  2GEX A;  2YFI B;  3DUK A;  3MHE A;  4HYZ A;  4L7K A;  2CW9 A;  2P38 A;  4HZ9 B;  3IPT A;  1KWI A;  3S67 A;  3ALA A;  1OHS A;  3T0U A;  3E99 A;  1EA2 A;  4MMY B;  4MMZ B;  3WOD G;  2FGT A;  1JJ2 2;  4EV5 A;  3HX8 A;  4WYK B;  3FG1 A;  3AMO A;  1Q82 4;  2JQ5 A;  4O8S A;  4ZM8 A;  1LXE A;  1LVN A;  1PFP A;  4XB5 A;  1GY6 A;  4JF8 A;  3DGM A;  1QJG A;  1DYU A;  1A90 A;  1GY7 A;  1YJW 3;  3F8H A;  4EYC A;  1FGM A;  3FG3 A;  3NV0 A;  3NBJ A;  4FCZ A;  2CWU A;  1STF I;  1E3V A;  1US1 A;  2IA7 A;  3AMO B;  1CQS A;  2ZL8 A;  2CG0 A;  2P0M A;  1U5O A;  3LXU X;  2CFK A;  3N9H A;  1YIJ 3;  4XDW A;  2WGQ A;  3F7X A;  2HMO B;  1KSI A;  3EN8 A;  1G96 A;  1OUN A;  1OGZ A;  5A0O B;  3CPO A;  3S28 A;  2QGU A;  3MG1 A;  3NV0 B;  5BVB A;  1IV9 A;  3KFQ C;  2BMR B;  1TFK A;  3G4S 3;  4WHA A;  3PZW A;  5D83 A;  4MMX B;  4BTY A;  1KQS 2;  1OH0 A;  3FLJ A;  2B1X B;  1ISK A;  2GBW B;  3NBB A;  3MSO A;  3CC4 3;  1K41 A;  3PCS A;  4HJL B;  3UNL A;  4HM1 B;  2HMK B;  1WMN A;  1UUW B;  3CCQ 3;  3WDG B;  4U13 A;  3N54 B;  2IMJ A;  3KII A;  3S27 A;  3T8U A;  2P05 A;  5AIF A;  1CYV A;  1IDP A;  1TFO A;  1JKG A;  3LYG A;  2KCD A;  3LT9 A;  1TU5 A;  2E2T A;  1IV7 A;  3CMA 3;  5IG3 A;  3SVA A;  2CFD A;  3KKG A;  4J8T A;  1JNQ A;  5KP4 A;  1UW1 A;  2XH9 A;  3EJV A;  2Y73 A;  2YFL B;  3F8X A;  2KRT A;  2IUJ A;  3B8L A;  1VQ5 3;  2ZDJ A;  1RJO A;  2BHM A;  4HVN A;  4WP5 A;  1CEW I;  1E97 A;  1W6C A;  3UB1 A;  5CXO A;  1JKG B;  1ULI B;  1QAK A;  5CLK A;  3CCJ 3;  1STD A;  2WOH A;  2WOF A;  4R1K A;  2SBL A;  4CDL A;  1IT8 A;  3EF8 A;  1LNH A;  2OWP A;  3GZR A;  1RRH A;  2BMO B;  3CNM A;  3GZB A;  5KP1 A;  3LTB A;  4EXR A;  1FA3 A;  1N9J A;  2O9U X;  4IIA A;  2Z77 A;  3OWU A;  3PS8 A;  1NDO B;  5JPU A;  4OK0 A;  3K0Z A;  4KFE A;  3Q1C A;  2YX9 A;  3DGN A;  1NB3 I;  4HM8 B;  4R9K A;  1AVK A;  1K8A 4;  2D1W A;  1A67 A;  4I4K A;  4IT7 A;  4G1M B;  3FGY A;  3KN4 A;  4N6O B;  5CK6 A;  1YJN 3;  2WO0 A;  4N6T A;  1JB5 A;  1NWW A;  3CCU 3;  3GZX B;  3HII A;  4LEH A;  3LH4 A;  1O7N B;  5AYR B;  1W7C A;  1D6U A;  3DXO A;  3FKA A;  1SII A;  3SED A;  3OW2 2;  3BNE A;  3JUQ A;  4R80 A;  2C10 A;  4RNY A;  3EBT A;  4EBG A;  1N5P A;  4HKV B;  3CD6 3;  5IG0 A;  4AKZ A;  3EC9 A;  4X2H A;  3OV4 A;  1Y4K A;  2IUK A;  4FR9 A;  1U8C B;  1VQP 3;  2F98 A;  4QWT A;  3F14 A;  3F40 A;  1WTH A;  2WGO A;  7STD A;  4N6V 0;  3X3Y A;  1E3R A;  3X42 A;  3HZP A;  2GU1 A;  3MPH A;  2XSO B;  5IG4 A;  1ZX2 A;  1IT7 A;  5LC6 A;  3MYT A;  4LSO A;  5JPP A;  3K63 A;  2Q07 A;  3LTA A;  1IQY A;  3NM2 A;  3RGR A;  3BND A;  1VZZ A;  4HBR A;  2KXG A;  3FG4 A;  3U97 A;  4TX4 A;  4HM4 B;  5G2G A;  2P0X A;  3WOF B;  3WA3 A;  2E2U A;  2Y74 A;  1SPU A;  4JRF A;  1KD1 4;  3OWS A;  3FF2 A;  1TP6 A;  3NBR A;  4MJD A;  1YHQ 3;  3RGA A;  2MC8 A;  1NJI 4;  1YGE A;  2CWV A;  2OQE C;  2F86 B;  3V99 A;  1JV2 B;  4LZI A;  3WMD A;  1Q42 A;  1O7G B;  1VQ6 3;  1JB4 A;  4N6M A;  2I9W A;  3WA2 X;  5AEU B;  1FUW A;  3DY5 A;  1DVC A;  2PZV A;  4L8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...