2RSXA

Solution structure of isea, an inhibitor protein of dl-endopeptidases from bacillus subtilis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
GKNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEKGFKDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Uncharacterized protein yoeB
publication title Solution Structure of IseA, an Inhibitor Protein of DL-Endopeptidases from Bacillus subtilis, Reveals a Novel Fold with a Characteristic Inhibitory Loop
pubmed doi rcsb
source organism Bacillus subtilis
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16800 Endopep_inhib IseA DL-endopeptidase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.420 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rsxA00
2RSXA
chains in the Genus database with same CATH superfamily
5KP1A 4JF8A 1UGHI 2P09A 3CPOA 2CWTA 1ROAA 3D5GA 1VZZA 4XBXA 3CCV3 3JUMA 1TUHA 1Q40B 1W00A 3EHCA 1O7GB 1O7HB 2A15A 2CHCA 3LOYA 1N9EA 1EA2A 3N8BA 4H3UA 1QALA 4MEIA 2FNQA 4OVMA 4WFOA 5G1LA 1CYUA 1B3SA 4GL6A 1D6YA 1FUWA 3OWYA 5A0OB 4MJDA 2K54A 1LQMB 1A2KA 3FF2A 1BNEA 2BMOB 1BANA 1GOYA 1NNVA 3G713 4HAAA 3KFQC 1OUNA 1S5AA 2O3OA 1R4YA 5BVBA 1IT8A 1RGKA 1DVCA 3IPTA 2KF6A 4NHFA 3LMLA 3LT9A 1VQK3 1RLSA 3NXJA 1FYSA 4GHOA 1CYVA 4BIRA 1RNBA 5IG5A 1WMPA 3LZAA 1RGAA 3NV0A 1NO3A 1N8QA 2BMRB 4R9LA 1BRSA 3CCL3 1BSEA 4J8TA 4KFEA 4O3VA 1I2EA 3KE7A 1OHSA 3OWUA 3KZTA 1STDA 1AR0A 1BNJA 1VQ83 1I2FA 1OGZA 2C10A 2KF4A 5M19A 3NM2A 1JNQA 2ZDJA 1IVUA 1S723 4L7KA 2YFIB 1DMNA 3ECFA 2QGUA 1O7MB 3CCQ3 3SOAA 4LGQA 3PZWA 1TU5A 3ROBA 1RGEA 1N9JA 1IQXA 2E2TA 3BNBA 3PS8A 3B4OA 5IERA 4HM7B 1UUWB 5GSPA 1BNGA 5LC6A 3M8CA 1FW7A 3D3LA 1TJDA 1LOYA 4K90B 3F7SA 1GMQA 3FG1A 3AHWA 1PU4A 5AI1A 3DZLA 1BU4A 1V57A 4N3VA 1OH0A 4KVHA 1BOXA 3LH4A 1O7PB 2J8XB 4HM0B 1B2XA 1E3VA 1LXEA 4N6OB 1MWTA 4N6NB 3RDEA 2ML5A 5RNTA 3CPW2 1AVLA 3HX8A 1BSDA 5BU4A 2CG1A 4L8OA 1YGWA 1RGLA 1RRLA 1YJW3 4LMIA 1G02A 5CF1A 4RBNA 3MG3A 7STDA 1YIJ3 1AY7A 4R4KA 1SARA 4XDVA 2HMMB 1B27A 3EBYA 2OQEA 5JPUA 2XF3A 1I3IA 1ZO2A 3LTCA 4XBTA 4K1VA 3BLZA 4K1UA 1Y4KA 3LYGA 1V74A 1GS3A 1K734 1AQZA 3AGNA 1O7WB 1W6YA 3OXAA 1OHPA 3F8XA 1BSBA 1D6UA 4J5KA 1JBSA 1RHLA 1BNRA 4EYCA 2CX1A 4G1MB 5IEPA 2CFDA 1YVSA 4KZ1A 3KN4A 1K8A4 4FR9A 2W2CA 1OGXA 1DVDA 1JB4A 3PGBA 4XBYA 4U13A 3EBTA 3JUOA 1BUJA 3X3ZA 2WO0A 2D42A 2Q07A 1IQYA 2CWUA 4FCJA 4HOHA 1MWUA 3RGAA 4CDLA 3HK4A 2MC8A 2B24B 2XSHB 1KWIA 3N9HA 4H61A 1DYUA 1JZDA 1LNIA 2KXGA 1EG9B 3BNCA 1JJ22 1N5HA 3KCHA 3NX0A 1WMNA 5IG0A 5M1AA 1IT7A 3KIIA 1Q7Y4 2IY2A 4Q53A 2H0HA 3DH2A 5IW9A 8RNTA 1DMQA 1EUIC 4FCMA 4DKIA 1FA3A 1SPUA 2GU3A 1N5PA 2ZL8A 3DGYA 5IF6A 4WP5A 1B2MA 5D82A 5STDA 4QWTA 2H0GA 4IIAA 1N8R4 2OCTA 1UCLA 3BU4A 1W6CA 1BNFA 1MOLA 2CFLA 1Q9EA 4IPBA 1I8VA 3BNDA 1SQWA 3SYUA 5IG3A 3LTAA 3UJMA 3X40A 3AGOA 3FF0A 3KSED 2KF5A 3BB9A 4FMDA 3HI7A 3STDA 2XFSA 3CCJ3 2QA43 2HMNB 1FGQA 1VQ53 2E2VA 2E2UA 3CC73 2QEX3 3DGNA 4KT3B 4LYLB 3K5TA 5ELUA 1NU3A 1UUVB 3SLUA 3OW22 3EJVA 3Q90A 2WGQA 3EX9A 1B20A 2OOVC 3L0RA 4GSPA 4HM2B 2HMLB 4K61A 3CCM3 1OHOA 2F99A 1BAOA 3MHEA 1QVF2 3CCU3 1ROVA 2CWVA 1GD4A 1GY7A 2OTJ3 1GSPA 1IV7A 4O8SA 1RN4A 1GY5A 3A5EA 1QMAA 3FKAA 3QK9A 1BNSA 3D9RA 4HZBB 6STDA 3X42A 1C7HA 3B8LA 3EQQB 2PNCA 3NM7A 3UL5A 4HVNA 9RNTA 1YGEA 1T2HA 3S29A 1U8CB 3EF8A 2IMJA 5IEOA 1A67A 3URPA 1FZUA 3TDGA 2R41A 1K9M4 1JN5A 1NB5I 2ZA4A 3B7CA 1BUQA 1T3BA 2BHMA 3H51A 1DE3A 1UUGB 1RGHA 1BRNL 3NQZA 2BO9B 3JVCA 2W03A 4HM8B 4XB5A 2WOFA 1LNHA 3IMAB 4HM1B 4N6UA 5AEWB 1JN5B 5G1KA 4HM5B 3Q3FA 3ZFZA 3RGRA 3S67A 2WGOA 3K0ZA 3K7CA 2GEYA 3PCRA 4XDWA 5M18A 2HOHA 3FH1A 4X2OA 1UGIA 3FLJA 1GOUA 3U97A 4STDA 1FUSA 2W9QA 3SXXA 2XH9A 3T8NA 1LVNA 3SEDA 3PYJA 2CG0A 1YHQ3 2BT3A 1VQN3 1TRQA 2BNGA 2XGNA 3Q1CA 1Q824 1K28A 1I2GA 1R4CA 1JV2B 1RJOA 1UW1A 3MPHA 4R80A 3WR2A 1YI23 3CD63 3Q2PA 1Z1SA 3IJEB 3QRDA 2OWPA 1MWRA 3ER7A 3EB8A 1BVIA 2V1LA 2AAEA 3WA2X 2OTL3 3ZG5A 1BRKA 2XFTA 3FG3A 3CMA3 4NPBA 2W56A 1VQ93 1CEWI 2KRTA 3G8ZA 4RNZA 3CC43 2CIUA 1RCLA 4HYZA 3RNTA 2L1SA 5G2GA 3K63A 3NUVA 1B2UA 4RNTA 3GZYB 3EC9A 5KP3A 5CF2A 3FGYA 6GSPA 1G0TA 3MYTA 5AYRB 1W2ZA 1SIIA 1FGRA 4J5GA 1VQO3 1G96A 3B4PA 4TX4A 3NHXA 4RZMA 1ASKA 2W56B 3ALAA 5AYSC 1IDPA 3LTBA 2IUJA 4BTWA 1BSAA 1GMPA 3BNEA 1TIJA 2YX9A 1ZX2A 3WOFB 4EV2A 5FW5A 4MMZB 1MGRA 1SIHA 3FZWA 2UX0A 1VQL3 3GZBA 3X41A 3OX9A 4FCZA 2IA7A 2SBLA 4MMYB 2BIRA 2C4BA 4RNYA 1PY3A 5AIGA 1OPYA 1W7CA 1IQ8A 1YJ93 1IU7A 1FGOA 1BRJA 1LOWA 1TFOA 1U5OA 2W04A 2W9PA 2BMQB 1BSCA 2KF3A 3I0YA 4O02B 3WHOA 5EVHA 1M1K4 1ISKA 1M904 1QAKA 1US1A 4WWUC 1NWWA 4EV5A 1STFI 4EC6A 4FMCA 1Q864 3DMCA 2B1XB 2SARA 1GOVA 2L4VA 3CME3 1NB3I 3AMOA 4HM3B 2Z77A 1UCKA 2F5WA 2LQVA 1OF5A 1VQP3 1IVWA 1TRPA 4WYKB 2HMJB 3ZG0A 4ILFA 5HOHA 1DETA 1FGMA 2W0QA 1RN7A 3DM8A 1PYLA 1I70A 1KQS2 1X1UA 4WHAA 1AVKA 1IV9A 3H3HA 2CH9A 2AADA 2ML6A 3AMOB 5CK6A 4AEQA 2HMKB 1X1YA 4KFDA 4AKZA 5BXQA 2CK3H 1OF5B 2Y73A 3I553 4LEHA 1FGTA 3F7XA 4R1KA 1HYFA 5DRVA 4ZM8A 3NBJA 3WA3A 2Z7AA 1KC84 3DY5A 1M1XB 3SVAA 4BTYA 1RMSA 3DGMA 5BIRA 1F8NA 2Y74A 1CQSA 5HGRA 1MGWA 5IENA 1BGSA 3VGNA 1O7NB 2F98A 5AEUB 1ULIB 3CC23 2Z76A 4BL2A 1VQ73 1KD14 2JDIH 1AV4A 2GU1A 4LZIA 3CCS3 2I9WA 4CJNA 2KAAA 3NBRA 1UI8A 2GBWB 3F9SA 1T2IA 4JRFA 1CH0A 2GXFA 2OQEC 1Q814 1PFPA 3G16A 1RTUA 5KP4A 2RGQA 2XSOB 4BU4A 4PEJA 1LQGC 2ZHXB 3X3YA 5D83A 1T5YA 4GB5A 1J2BA 3V99A 4EBGA 1X1WA 2IYJA 1RGFA 2O9UX 3S28A 1RKYA 3BIRA 3DUKA 3D5IA 3JUNA 5EQLA 1W01A 4IT7A 3CNXA 1VQ63 1HZ1A 3WDGB 4N6LA 2XR8B 4CCVA 2F4YA 1B21A 2GSPA 4FMAA 1YJN3 1EEJA 1BIRA 2PZVA 1LOXA 3CNMA 1FUTA 2W6JH 1MNLA 2F86B 3EN1B 2GBXB 2H0IA 3NBBA 3G4S3 5EEOA 2R4IA 1KSIA 4HKVB 3I563 3CXC2 2MF7A 3KKGA 4LSOA 3OWSA 4OUQA 1IK3A 1C54A 3GZRA 3WODG 3V98A 1L5GB 3CU3A 2QIYA 4N6MA 4R9KA 5FGOA 3HIGA 1A2VA 4I5QA 4HJLB 1BRGA 1WTHA 4N6TA 2BU4A 3N54B 3CCE3 2HMOB 1ULJB 3PCSA 3NV0B 1IVXA 2FGTA 1QVG2 2STDA 1QAFA 2JQ5A 3NQYA 3VSYA 1Q42A 2RSXA 4MMXB 8CHOA 2C11A 1RGCA 1ZGXA 1Q7HA 4J9AA 1GYBA 1RN1A 4OK0A 3UB1A 2KCDA 3F14A 1I3FA 3HOHA 4BL3A 3GAXA 3S27A 3OV4A 1I0XA 3MG1A 1BRHA 1E3RA 3MSOA 3HZPA 4O2HA 2XEPA 1JB2A 5CXOA 2F5MA 7RNTA 3HIIA 1HU9A 3JUQA 1WMOA 5LC7A 2P0XA 3VF1A 1IVVA 1RGGA 1UCIA 1HKXA 2F56A 3KSPA 4ORLA 2P05A 4HBRA 3GSPA 4BTXA 3LTDA 3LXUX 5AIHA 3F40A 3JUPA 1GMRA 3DXOA 4N6V0 1W4NA 3X3XA 1NJI4 3J7Yd 2GEXA 1W5ZA 1RNTA 3EE1A 1OCVA 1VQM3 3LT8A 2IUKA 3G6E3 1QJGA 2CX0A 1W6GA 2OOVA 2YFLB 5AIFA 3UL6A 1IYYA 2K0MA 3FCSB 1ZS7A 1MWSA 2CFWA 1BNIA 2YFJB 3FSDA 4I4KA 5CLKA 1TTOA 2CFGA 1K41A 5JPPA 1UDII 1GY6A 1B2ZA 1B2SA 3T0UA 4WYKA 3T8UA 3WMDA 2RFRA 4XM4A 2FXTA 2K3DA 1A90A 1UI7A 3V92A 1TFKA 1UCJA 2P0MA 1BRIA 2Z6BA 1I0VA 2RBIA 3AHSA 4X2HA 1LRAA 3GRDA 1OACA 3FG4A 2UUGC 2CW9A 4CPKA 3A76A 3GWRA 1JKGA 1YNVX 2WOHA 3E99A 5ELJA 5JBSA 4L8PA 2P38A 2INXA 2XGLA 4FMBA 4EW5A 3MKIA 3D4AA 1M9GA 3UNLA 4KFFA 2M7OA 3G0KA 3EN8A 2RNTA 1WQLB 2XRXB 3O8YA 3GZXB 1WNHA 1JRQA 1V58A 1X1XA 1YVBI 3D79A 3K9MC 5TGNA 1RDSA 1W02A 3WOEB 1RRHA 1JKGB 1RSNA 4HM4B 1EQKA 1EKMA 3U1WA 3SOYA 1JBRA 1DMMA 2D1WA 5I97A 5DREA 2LYXA 5IG4A 3MWZA 1JZOA 1TP6A 5AIIA 3PXMA 1SJWA 1GD3A 1VQQA 3DGOA 3DGLA 3F8HA 4HZ9B 2UGIA 4NREA 3S5CA 4EXRA 2CFKA 1D6ZA 2RCDA 3MG2A 1JB5A 4HM6B 2CC3A 4AKYA 1W2B2 1Q40A 1NDOB 3CCR3 1JBTA 1VQ43 1RCKA 1YIT3 1LOVA 3SX1A 6RNTA 2CKFB 1A2PA 5D81A 7GSPA 1E97A
chains in the Genus database with same CATH topology
5KP1A 4JF8A 3CPOA 2P09A 2CWTA 1ROAA 4XBXA 1VZZA 3CCV3 3JUMA 1TUHA 1Q40B 1W00A 3EHCA 1O7GB 1O7HB 2A15A 2CHCA 3LOYA 1N9EA 1EA2A 3N8BA 4H3UA 1QALA 4MEIA 2FNQA 4OVMA 4WFOA 1CYUA 4GL6A 1D6YA 1FUWA 3OWYA 5A0OB 4MJDA 2K54A 1A2KA 3FF2A 2BMOB 3G713 3KFQC 1OUNA 1S5AA 2O3OA 5BVBA 1IT8A 1DVCA 3IPTA 4NHFA 3LMLA 3LT9A 1VQK3 3NXJA 1CYVA 5IG5A 1WMPA 3LZAA 3NV0A 1NO3A 1N8QA 2BMRB 4R9LA 3CCL3 4J8TA 4KFEA 4O3VA 3KE7A 1OHSA 3OWUA 3KZTA 1STDA 1AR0A 1VQ83 1OGZA 2C10A 3NM2A 1JNQA 2ZDJA 1IVUA 1S723 4L7KA 2YFIB 1DMNA 3ECFA 2QGUA 1O7MB 3CCQ3 3SOAA 4LGQA 3PZWA 1TU5A 3ROBA 1N9JA 1IQXA 2E2TA 3BNBA 3PS8A 3B4OA 5IERA 4HM7B 1UUWB 5LC6A 3M8CA 3D3LA 4K90B 3F7SA 3FG1A 1PU4A 5AI1A 3DZLA 4N3VA 1OH0A 4KVHA 3LH4A 1O7PB 4HM0B 4N6OB 1LXEA 1E3VA 4N6NB 2ML5A 3CPW2 1AVLA 3HX8A 2CG1A 4L8OA 1RRLA 1YJW3 4LMIA 5CF1A 4RBNA 3MG3A 7STDA 1YIJ3 4R4KA 4XDVA 2HMMB 2OQEA 3EBYA 5JPUA 2XF3A 1ZO2A 3LTCA 4XBTA 4K1VA 3BLZA 4K1UA 1Y4KA 3LYGA 1V74A 1GS3A 1K734 1O7WB 1W6YA 3OXAA 1OHPA 3F8XA 1D6UA 4EYCA 4G1MB 5IEPA 2CFDA 4KZ1A 3KN4A 1K8A4 4FR9A 2W2CA 1OGXA 1DVDA 1JB4A 3PGBA 4XBYA 4U13A 3EBTA 3JUOA 3X3ZA 2WO0A 2D42A 2Q07A 1IQYA 2CWUA 4FCJA 4CDLA 3RGAA 3HK4A 2MC8A 2B24B 2XSHB 1KWIA 3N9HA 4H61A 1DYUA 2KXGA 1EG9B 3BNCA 1JJ22 1N5HA 3NX0A 1Q7Y4 1WMNA 5IG0A 1IT7A 3KIIA 4Q53A 5IW9A 1DMQA 4FCMA 1FA3A 1SPUA 2GU3A 1N5PA 2ZL8A 5IF6A 4WP5A 5D82A 5STDA 4QWTA 4IIAA 1N8R4 2OCTA 3T0UA 1W6CA 1MOLA 2CFLA 4IPBA 3BNDA 1SQWA 5IG3A 3LTAA 3UJMA 3X40A 3FF0A 3KSED 3BB9A 4FMDA 3HI7A 3STDA 2XFSA 3CCJ3 2QA43 2HMNB 1FGQA 1VQ53 2E2VA 2E2UA 3CC73 2QEX3 3DGNA 3K5TA 5ELUA 1NU3A 1UUVB 3SLUA 3OW22 3EJVA 3Q90A 2WGQA 3EX9A 3L0RA 2OOVC 4HM2B 2HMLB 4K61A 3CCM3 1OHOA 2F99A 3MHEA 1QVF2 3CCU3 1ROVA 2CWVA 1GD4A 1GY7A 2OTJ3 1IV7A 4O8SA 1GY5A 1QMAA 3FKAA 3QK9A 3D9RA 4HZBB 6STDA 3X42A 1C7HA 3B8LA 3EQQB 2PNCA 3NM7A 3UL5A 4HVNA 1YGEA 3S29A 1U8CB 3EF8A 2IMJA 5IEOA 1A67A 3TDGA 1K9M4 1JN5A 1NB5I 3B7CA 1BUQA 2BHMA 3H51A 3NQZA 2BO9B 3JVCA 2W03A 4HM8B 4XB5A 2WOFA 1LNHA 3IMAB 4HM1B 4N6UA 5AEWB 1JN5B 4HM5B 3RGRA 3S67A 2WGOA 3K0ZA 3K7CA 2GEYA 3PCRA 4XDWA 3FH1A 4X2OA 3FLJA 3U97A 4STDA 2W9QA 3SXXA 3T8NA 2XH9A 1LVNA 3SEDA 3PYJA 2CG0A 1YHQ3 2BT3A 1VQN3 2BNGA 1Q824 2XGNA 3Q1CA 1K28A 1R4CA 1RJOA 1JV2B 1UW1A 3MPHA 1YI23 4R80A 3CD63 3Q2PA 1Z1SA 3IJEB 3QRDA 2OWPA 3ER7A 3EB8A 2V1LA 3WA2X 2OTL3 3FG3A 2XFTA 2W56A 1VQ93 1CEWI 2KRTA 3G8ZA 4RNZA 3CC43 2CIUA 4HYZA 5G2GA 3K63A 3NUVA 3GZYB 3EC9A 5KP3A 5CF2A 3FGYA 3MYTA 5AYRB 1W2ZA 1SIIA 1FGRA 1VQO3 1G96A 3B4PA 4TX4A 3NHXA 4RZMA 1ASKA 2W56B 3ALAA 5AYSC 1IDPA 3LTBA 2IUJA 4BTWA 5IENA 3BNEA 3WOFB 1TIJA 2YX9A 1ZX2A 4EV2A 5FW5A 4MMZB 1SIHA 3FZWA 2UX0A 1VQL3 3GZBA 3X41A 3OX9A 4FCZA 2IA7A 2SBLA 4MMYB 4RNYA 5AIGA 1OPYA 1W7CA 1IQ8A 1YJ93 1IU7A 1FGOA 1TFOA 1U5OA 2W04A 2W9PA 4O02B 2BMQB 1M1K4 3I0YA 5EVHA 1ISKA 1M904 1QAKA 1US1A 4WWUC 1NWWA 4EV5A 1STFI 4EC6A 4FMCA 1Q864 3DMCA 2B1XB 2L4VA 3CME3 1NB3I 3AMOA 4HM3B 2Z77A 2LQVA 1OF5A 1VQP3 1IVWA 4WYKB 2HMJB 2W0QA 1FGMA 1RN7A 3DM8A 1KQS2 4WHAA 1AVKA 1IV9A 3H3HA 2CH9A 2ML6A 3AMOB 5CK6A 4AEQA 2HMKB 4KFDA 4AKZA 5BXQA 2CK3H 1OF5B 2Y73A 3I553 4LEHA 1FGTA 3F7XA 4R1KA 5DRVA 4ZM8A 3NBJA 3WA3A 2Z7AA 1KC84 3DY5A 1M1XB 3SVAA 4BTYA 3DGMA 1F8NA 2Y74A 1CQSA 5HGRA 3VGNA 1O7NB 2F98A 5AEUB 1ULIB 3CC23 2Z76A 1VQ73 1KD14 2JDIH 1AV4A 2GU1A 4LZIA 3CCS3 2I9WA 3NBRA 1UI8A 2GBWB 3F9SA 4JRFA 2GXFA 2OQEC 1Q814 1PFPA 3G16A 5KP4A 2RGQA 2XSOB 4PEJA 3X3YA 5D83A 1T5YA 4GB5A 1J2BA 3V99A 4EBGA 2O9UX 3S28A 1RKYA 3DUKA 3JUNA 5EQLA 1W01A 4IT7A 3CNXA 1VQ63 3WDGB 4N6LA 2XR8B 4CCVA 4FMAA 1YJN3 3CNMA 2PZVA 1LOXA 2W6JH 1MNLA 2F86B 3EN1B 2GBXB 3NBBA 3G4S3 5EEOA 2R4IA 1KSIA 4HKVB 3I563 3CXC2 2MF7A 3KKGA 4LSOA 3OWSA 4OUQA 1IK3A 3GZRA 3WODG 3V98A 1L5GB 3CU3A 2QIYA 4N6MA 4R9KA 5FGOA 3HIGA 1A2VA 4HJLB 1WTHA 4N6TA 3N54B 3CCE3 2HMOB 1ULJB 3PCSA 3NV0B 1IVXA 2FGTA 1QVG2 2STDA 1QAFA 2JQ5A 3NQYA 3VSYA 1Q42A 2RSXA 4MMXB 8CHOA 2C11A 4J9AA 1GYBA 4OK0A 3UB1A 2KCDA 3F14A 3GAXA 3S27A 3OV4A 3MG1A 1E3RA 3MSOA 3HZPA 4O2HA 2XEPA 1JB2A 5CXOA 3HIIA 1HU9A 3JUQA 1WMOA 5LC7A 2P0XA 3VF1A 1IVVA 3KSPA 1HKXA 4ORLA 2P05A 4HBRA 4BTXA 3LTDA 3LXUX 5AIHA 3F40A 3JUPA 3DXOA 4N6V0 1W4NA 3X3XA 1NJI4 3J7Yd 2GEXA 1W5ZA 3EE1A 1OCVA 1VQM3 3LT8A 2IUKA 3G6E3 1QJGA 1W6GA 2OOVA 2YFLB 5AIFA 3UL6A 2K0MA 3FCSB 2CFWA 2YFJB 3RDEA 4I4KA 3WOEB 3FSDA 5JPPA 5CLKA 3CMA3 2CFGA 1K41A 1GY6A 4WYKA 3T8UA 3WMDA 2RFRA 4XM4A 2FXTA 1A90A 1UI7A 3V92A 1TFKA 2P0MA 4X2HA 2Z6BA 3GRDA 1OACA 3FG4A 2CW9A 3A76A 3GWRA 1JKGA 2WOHA 3E99A 5ELJA 5JBSA 4L8PA 2P38A 2INXA 2XGLA 4FMBA 3MKIA 1M9GA 3UNLA 4KFFA 2M7OA 3G0KA 3EN8A 1WQLB 2XRXB 3O8YA 3GZXB 1WNHA 1JRQA 1YVBI 3K9MC 5TGNA 1W02A 1RRHA 1JKGB 4HM4B 1EQKA 1EKMA 3U1WA 3SOYA 1DMMA 2D1WA 5I97A 5DREA 2LYXA 5IG4A 3MWZA 1TP6A 5AIIA 3PXMA 1SJWA 1GD3A 4HZ9B 3DGOA 3DGLA 3F8HA 4NREA 3S5CA 4EXRA 2RCDA 2CFKA 1D6ZA 3MG2A 1JB5A 4HM6B 2CC3A 4AKYA 1W2B2 1Q40A 1NDOB 3CCR3 1VQ43 1YIT3 3SX1A 2CKFB 5D81A 1E97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSX A; 
#chains in the Genus database with same CATH topology
 5KP1 A;  4JF8 A;  1UGH I;  2P09 A;  3CPO A;  2CWT A;  1ROA A;  3D5G A;  1VZZ A;  4XBX A;  3CCV 3;  3JUM A;  1TUH A;  1Q40 B;  1W00 A;  3EHC A;  1O7G B;  1O7H B;  2A15 A;  2CHC A;  3LOY A;  1N9E A;  1EA2 A;  3N8B A;  4H3U A;  1QAL A;  4MEI A;  2FNQ A;  4OVM A;  4WFO A;  5G1L A;  1CYU A;  1B3S A;  4GL6 A;  1D6Y A;  1FUW A;  3OWY A;  5A0O B;  4MJD A;  2K54 A;  1LQM B;  1A2K A;  3FF2 A;  1BNE A;  2BMO B;  1BAN A;  1GOY A;  1NNV A;  3G71 3;  4HAA A;  3KFQ C;  1OUN A;  1S5A A;  2O3O A;  1R4Y A;  5BVB A;  1IT8 A;  1RGK A;  1DVC A;  3IPT A;  2KF6 A;  4NHF A;  3LML A;  3LT9 A;  1VQK 3;  1RLS A;  3NXJ A;  1FYS A;  4GHO A;  1CYV A;  4BIR A;  1RNB A;  5IG5 A;  1WMP A;  3LZA A;  1RGA A;  3NV0 A;  1NO3 A;  1N8Q A;  2BMR B;  4R9L A;  1BRS A;  3CCL 3;  1BSE A;  4J8T A;  4KFE A;  4O3V A;  1I2E A;  3KE7 A;  1OHS A;  3OWU A;  3KZT A;  1STD A;  1AR0 A;  1BNJ A;  1VQ8 3;  1I2F A;  1OGZ A;  2C10 A;  2KF4 A;  5M19 A;  3NM2 A;  1JNQ A;  2ZDJ A;  1IVU A;  1S72 3;  4L7K A;  2YFI B;  1DMN A;  3ECF A;  2QGU A;  1O7M B;  3CCQ 3;  3SOA A;  4LGQ A;  3PZW A;  1TU5 A;  3ROB A;  1RGE A;  1N9J A;  1IQX A;  2E2T A;  3BNB A;  3PS8 A;  3B4O A;  5IER A;  4HM7 B;  1UUW B;  5GSP A;  1BNG A;  5LC6 A;  3M8C A;  1FW7 A;  3D3L A;  1TJD A;  1LOY A;  4K90 B;  3F7S A;  1GMQ A;  3FG1 A;  3AHW A;  1PU4 A;  5AI1 A;  3DZL A;  1BU4 A;  1V57 A;  4N3V A;  1OH0 A;  4KVH A;  1BOX A;  3LH4 A;  1O7P B;  2J8X B;  4HM0 B;  1B2X A;  1E3V A;  1LXE A;  4N6O B;  1MWT A;  4N6N B;  3RDE A;  2ML5 A;  5RNT A;  3CPW 2;  1AVL A;  3HX8 A;  1BSD A;  5BU4 A;  2CG1 A;  4L8O A;  1YGW A;  1RGL A;  1RRL A;  1YJW 3;  4LMI A;  1G02 A;  5CF1 A;  4RBN A;  3MG3 A;  7STD A;  1YIJ 3;  1AY7 A;  4R4K A;  1SAR A;  4XDV A;  2HMM B;  1B27 A;  3EBY A;  2OQE A;  5JPU A;  2XF3 A;  1I3I A;  1ZO2 A;  3LTC A;  4XBT A;  4K1V A;  3BLZ A;  4K1U A;  1Y4K A;  3LYG A;  1V74 A;  1GS3 A;  1K73 4;  1AQZ A;  3AGN A;  1O7W B;  1W6Y A;  3OXA A;  1OHP A;  3F8X A;  1BSB A;  1D6U A;  4J5K A;  1JBS A;  1RHL A;  1BNR A;  4EYC A;  2CX1 A;  4G1M B;  5IEP A;  2CFD A;  1YVS A;  4KZ1 A;  3KN4 A;  1K8A 4;  4FR9 A;  2W2C A;  1OGX A;  1DVD A;  1JB4 A;  3PGB A;  4XBY A;  4U13 A;  3EBT A;  3JUO A;  1BUJ A;  3X3Z A;  2WO0 A;  2D42 A;  2Q07 A;  1IQY A;  2CWU A;  4FCJ A;  4HOH A;  1MWU A;  3RGA A;  4CDL A;  3HK4 A;  2MC8 A;  2B24 B;  2XSH B;  1KWI A;  3N9H A;  4H61 A;  1DYU A;  1JZD A;  1LNI A;  2KXG A;  1EG9 B;  3BNC A;  1JJ2 2;  1N5H A;  3KCH A;  3NX0 A;  1WMN A;  5IG0 A;  5M1A A;  1IT7 A;  3KII A;  1Q7Y 4;  2IY2 A;  4Q53 A;  2H0H A;  3DH2 A;  5IW9 A;  8RNT A;  1DMQ A;  1EUI C;  4FCM A;  4DKI A;  1FA3 A;  1SPU A;  2GU3 A;  1N5P A;  2ZL8 A;  3DGY A;  5IF6 A;  4WP5 A;  1B2M A;  5D82 A;  5STD A;  4QWT A;  2H0G A;  4IIA A;  1N8R 4;  2OCT A;  1UCL A;  3BU4 A;  1W6C A;  1BNF A;  1MOL A;  2CFL A;  1Q9E A;  4IPB A;  1I8V A;  3BND A;  1SQW A;  3SYU A;  5IG3 A;  3LTA A;  3UJM A;  3X40 A;  3AGO A;  3FF0 A;  3KSE D;  2KF5 A;  3BB9 A;  4FMD A;  3HI7 A;  3STD A;  2XFS A;  3CCJ 3;  2QA4 3;  2HMN B;  1FGQ A;  1VQ5 3;  2E2V A;  2E2U A;  3CC7 3;  2QEX 3;  3DGN A;  4KT3 B;  4LYL B;  3K5T A;  5ELU A;  1NU3 A;  1UUV B;  3SLU A;  3OW2 2;  3EJV A;  3Q90 A;  2WGQ A;  3EX9 A;  1B20 A;  2OOV C;  3L0R A;  4GSP A;  4HM2 B;  2HML B;  4K61 A;  3CCM 3;  1OHO A;  2F99 A;  1BAO A;  3MHE A;  1QVF 2;  3CCU 3;  1ROV A;  2CWV A;  1GD4 A;  1GY7 A;  2OTJ 3;  1GSP A;  1IV7 A;  4O8S A;  1RN4 A;  1GY5 A;  3A5E A;  1QMA A;  3FKA A;  3QK9 A;  1BNS A;  3D9R A;  4HZB B;  6STD A;  3X42 A;  1C7H A;  3B8L A;  3EQQ B;  2PNC A;  3NM7 A;  3UL5 A;  4HVN A;  9RNT A;  1YGE A;  1T2H A;  3S29 A;  1U8C B;  3EF8 A;  2IMJ A;  5IEO A;  1A67 A;  3URP A;  1FZU A;  3TDG A;  2R41 A;  1K9M 4;  1JN5 A;  1NB5 I;  2ZA4 A;  3B7C A;  1BUQ A;  1T3B A;  2BHM A;  3H51 A;  1DE3 A;  1UUG B;  1RGH A;  1BRN L;  3NQZ A;  2BO9 B;  3JVC A;  2W03 A;  4HM8 B;  4XB5 A;  2WOF A;  1LNH A;  3IMA B;  4HM1 B;  4N6U A;  5AEW B;  1JN5 B;  5G1K A;  4HM5 B;  3Q3F A;  3ZFZ A;  3RGR A;  3S67 A;  2WGO A;  3K0Z A;  3K7C A;  2GEY A;  3PCR A;  4XDW A;  5M18 A;  2HOH A;  3FH1 A;  4X2O A;  1UGI A;  3FLJ A;  1GOU A;  3U97 A;  4STD A;  1FUS A;  2W9Q A;  3SXX A;  2XH9 A;  3T8N A;  1LVN A;  3SED A;  3PYJ A;  2CG0 A;  1YHQ 3;  2BT3 A;  1VQN 3;  1TRQ A;  2BNG A;  2XGN A;  3Q1C A;  1Q82 4;  1K28 A;  1I2G A;  1R4C A;  1JV2 B;  1RJO A;  1UW1 A;  3MPH A;  4R80 A;  3WR2 A;  1YI2 3;  3CD6 3;  3Q2P A;  1Z1S A;  3IJE B;  3QRD A;  2OWP A;  1MWR A;  3ER7 A;  3EB8 A;  1BVI A;  2V1L A;  2AAE A;  3WA2 X;  2OTL 3;  3ZG5 A;  1BRK A;  2XFT A;  3FG3 A;  3CMA 3;  4NPB A;  2W56 A;  1VQ9 3;  1CEW I;  2KRT A;  3G8Z A;  4RNZ A;  3CC4 3;  2CIU A;  1RCL A;  4HYZ A;  3RNT A;  2L1S A;  5G2G A;  3K63 A;  3NUV A;  1B2U A;  4RNT A;  3GZY B;  3EC9 A;  5KP3 A;  5CF2 A;  3FGY A;  6GSP A;  1G0T A;  3MYT A;  5AYR B;  1W2Z A;  1SII A;  1FGR A;  4J5G A;  1VQO 3;  1G96 A;  3B4P A;  4TX4 A;  3NHX A;  4RZM A;  1ASK A;  2W56 B;  3ALA A;  5AYS C;  1IDP A;  3LTB A;  2IUJ A;  4BTW A;  1BSA A;  1GMP A;  3BNE A;  1TIJ A;  2YX9 A;  1ZX2 A;  3WOF B;  4EV2 A;  5FW5 A;  4MMZ B;  1MGR A;  1SIH A;  3FZW A;  2UX0 A;  1VQL 3;  3GZB A;  3X41 A;  3OX9 A;  4FCZ A;  2IA7 A;  2SBL A;  4MMY B;  2BIR A;  2C4B A;  4RNY A;  1PY3 A;  5AIG A;  1OPY A;  1W7C A;  1IQ8 A;  1YJ9 3;  1IU7 A;  1FGO A;  1BRJ A;  1LOW A;  1TFO A;  1U5O A;  2W04 A;  2W9P A;  2BMQ B;  1BSC A;  2KF3 A;  3I0Y A;  4O02 B;  3WHO A;  5EVH A;  1M1K 4;  1ISK A;  1M90 4;  1QAK A;  1US1 A;  4WWU C;  1NWW A;  4EV5 A;  1STF I;  4EC6 A;  4FMC A;  1Q86 4;  3DMC A;  2B1X B;  2SAR A;  1GOV A;  2L4V A;  3CME 3;  1NB3 I;  3AMO A;  4HM3 B;  2Z77 A;  1UCK A;  2F5W A;  2LQV A;  1OF5 A;  1VQP 3;  1IVW A;  1TRP A;  4WYK B;  2HMJ B;  3ZG0 A;  4ILF A;  5HOH A;  1DET A;  1FGM A;  2W0Q A;  1RN7 A;  3DM8 A;  1PYL A;  1I70 A;  1KQS 2;  1X1U A;  4WHA A;  1AVK A;  1IV9 A;  3H3H A;  2CH9 A;  2AAD A;  2ML6 A;  3AMO B;  5CK6 A;  4AEQ A;  2HMK B;  1X1Y A;  4KFD A;  4AKZ A;  5BXQ A;  2CK3 H;  1OF5 B;  2Y73 A;  3I55 3;  4LEH A;  1FGT A;  3F7X A;  4R1K A;  1HYF A;  5DRV A;  4ZM8 A;  3NBJ A;  3WA3 A;  2Z7A A;  1KC8 4;  3DY5 A;  1M1X B;  3SVA A;  4BTY A;  1RMS A;  3DGM A;  5BIR A;  1F8N A;  2Y74 A;  1CQS A;  5HGR A;  1MGW A;  5IEN A;  1BGS A;  3VGN A;  1O7N B;  2F98 A;  5AEU B;  1ULI B;  3CC2 3;  2Z76 A;  4BL2 A;  1VQ7 3;  1KD1 4;  2JDI H;  1AV4 A;  2GU1 A;  4LZI A;  3CCS 3;  2I9W A;  4CJN A;  2KAA A;  3NBR A;  1UI8 A;  2GBW B;  3F9S A;  1T2I A;  4JRF A;  1CH0 A;  2GXF A;  2OQE C;  1Q81 4;  1PFP A;  3G16 A;  1RTU A;  5KP4 A;  2RGQ A;  2XSO B;  4BU4 A;  4PEJ A;  1LQG C;  2ZHX B;  3X3Y A;  5D83 A;  1T5Y A;  4GB5 A;  1J2B A;  3V99 A;  4EBG A;  1X1W A;  2IYJ A;  1RGF A;  2O9U X;  3S28 A;  1RKY A;  3BIR A;  3DUK A;  3D5I A;  3JUN A;  5EQL A;  1W01 A;  4IT7 A;  3CNX A;  1VQ6 3;  1HZ1 A;  3WDG B;  4N6L A;  2XR8 B;  4CCV A;  2F4Y A;  1B21 A;  2GSP A;  4FMA A;  1YJN 3;  1EEJ A;  1BIR A;  2PZV A;  1LOX A;  3CNM A;  1FUT A;  2W6J H;  1MNL A;  2F86 B;  3EN1 B;  2GBX B;  2H0I A;  3NBB A;  3G4S 3;  5EEO A;  2R4I A;  1KSI A;  4HKV B;  3I56 3;  3CXC 2;  2MF7 A;  3KKG A;  4LSO A;  3OWS A;  4OUQ A;  1IK3 A;  1C54 A;  3GZR A;  3WOD G;  3V98 A;  1L5G B;  3CU3 A;  2QIY A;  4N6M A;  4R9K A;  5FGO A;  3HIG A;  1A2V A;  4I5Q A;  4HJL B;  1BRG A;  1WTH A;  4N6T A;  2BU4 A;  3N54 B;  3CCE 3;  2HMO B;  1ULJ B;  3PCS A;  3NV0 B;  1IVX A;  2FGT A;  1QVG 2;  2STD A;  1QAF A;  2JQ5 A;  3NQY A;  3VSY A;  1Q42 A;  2RSX A;  4MMX B;  8CHO A;  2C11 A;  1RGC A;  1ZGX A;  1Q7H A;  4J9A A;  1GYB A;  1RN1 A;  4OK0 A;  3UB1 A;  2KCD A;  3F14 A;  1I3F A;  3HOH A;  4BL3 A;  3GAX A;  3S27 A;  3OV4 A;  1I0X A;  3MG1 A;  1BRH A;  1E3R A;  3MSO A;  3HZP A;  4O2H A;  2XEP A;  1JB2 A;  5CXO A;  2F5M A;  7RNT A;  3HII A;  1HU9 A;  3JUQ A;  1WMO A;  5LC7 A;  2P0X A;  3VF1 A;  1IVV A;  1RGG A;  1UCI A;  1HKX A;  2F56 A;  3KSP A;  4ORL A;  2P05 A;  4HBR A;  3GSP A;  4BTX A;  3LTD A;  3LXU X;  5AIH A;  3F40 A;  3JUP A;  1GMR A;  3DXO A;  4N6V 0;  1W4N A;  3X3X A;  1NJI 4;  3J7Y d;  2GEX A;  1W5Z A;  1RNT A;  3EE1 A;  1OCV A;  1VQM 3;  3LT8 A;  2IUK A;  3G6E 3;  1QJG A;  2CX0 A;  1W6G A;  2OOV A;  2YFL B;  5AIF A;  3UL6 A;  1IYY A;  2K0M A;  3FCS B;  1ZS7 A;  1MWS A;  2CFW A;  1BNI A;  2YFJ B;  3FSD A;  4I4K A;  5CLK A;  1TTO A;  2CFG A;  1K41 A;  5JPP A;  1UDI I;  1GY6 A;  1B2Z A;  1B2S A;  3T0U A;  4WYK A;  3T8U A;  3WMD A;  2RFR A;  4XM4 A;  2FXT A;  2K3D A;  1A90 A;  1UI7 A;  3V92 A;  1TFK A;  1UCJ A;  2P0M A;  1BRI A;  2Z6B A;  1I0V A;  2RBI A;  3AHS A;  4X2H A;  1LRA A;  3GRD A;  1OAC A;  3FG4 A;  2UUG C;  2CW9 A;  4CPK A;  3A76 A;  3GWR A;  1JKG A;  1YNV X;  2WOH A;  3E99 A;  5ELJ A;  5JBS A;  4L8P A;  2P38 A;  2INX A;  2XGL A;  4FMB A;  4EW5 A;  3MKI A;  3D4A A;  1M9G A;  3UNL A;  4KFF A;  2M7O A;  3G0K A;  3EN8 A;  2RNT A;  1WQL B;  2XRX B;  3O8Y A;  3GZX B;  1WNH A;  1JRQ A;  1V58 A;  1X1X A;  1YVB I;  3D79 A;  3K9M C;  5TGN A;  1RDS A;  1W02 A;  3WOE B;  1RRH A;  1JKG B;  1RSN A;  4HM4 B;  1EQK A;  1EKM A;  3U1W A;  3SOY A;  1JBR A;  1DMM A;  2D1W A;  5I97 A;  5DRE A;  2LYX A;  5IG4 A;  3MWZ A;  1JZO A;  1TP6 A;  5AII A;  3PXM A;  1SJW A;  1GD3 A;  1VQQ A;  3DGO A;  3DGL A;  3F8H A;  4HZ9 B;  2UGI A;  4NRE A;  3S5C A;  4EXR A;  2CFK A;  1D6Z A;  2RCD A;  3MG2 A;  1JB5 A;  4HM6 B;  2CC3 A;  4AKY A;  1W2B 2;  1Q40 A;  1NDO B;  3CCR 3;  1JBT A;  1VQ4 3;  1RCK A;  1YIT 3;  1LOV A;  3SX1 A;  6RNT A;  2CKF B;  1A2P A;  5D81 A;  7GSP A;  1E97 A; 
#chains in the Genus database with same CATH homology
 5KP1 A;  4JF8 A;  3CPO A;  2P09 A;  2CWT A;  1ROA A;  4XBX A;  1VZZ A;  3CCV 3;  3JUM A;  1TUH A;  1Q40 B;  1W00 A;  3EHC A;  1O7G B;  1O7H B;  2A15 A;  2CHC A;  3LOY A;  1N9E A;  1EA2 A;  3N8B A;  4H3U A;  1QAL A;  4MEI A;  2FNQ A;  4OVM A;  4WFO A;  1CYU A;  4GL6 A;  1D6Y A;  1FUW A;  3OWY A;  5A0O B;  4MJD A;  2K54 A;  1A2K A;  3FF2 A;  2BMO B;  3G71 3;  3KFQ C;  1OUN A;  1S5A A;  2O3O A;  5BVB A;  1IT8 A;  1DVC A;  3IPT A;  4NHF A;  3LML A;  3LT9 A;  1VQK 3;  3NXJ A;  1CYV A;  5IG5 A;  1WMP A;  3LZA A;  3NV0 A;  1NO3 A;  1N8Q A;  2BMR B;  4R9L A;  3CCL 3;  4J8T A;  4KFE A;  4O3V A;  3KE7 A;  1OHS A;  3OWU A;  3KZT A;  1STD A;  1AR0 A;  1VQ8 3;  1OGZ A;  2C10 A;  3NM2 A;  1JNQ A;  2ZDJ A;  1IVU A;  1S72 3;  4L7K A;  2YFI B;  1DMN A;  3ECF A;  2QGU A;  1O7M B;  3CCQ 3;  3SOA A;  4LGQ A;  3PZW A;  1TU5 A;  3ROB A;  1N9J A;  1IQX A;  2E2T A;  3BNB A;  3PS8 A;  3B4O A;  5IER A;  4HM7 B;  1UUW B;  5LC6 A;  3M8C A;  3D3L A;  4K90 B;  3F7S A;  3FG1 A;  1PU4 A;  5AI1 A;  3DZL A;  4N3V A;  1OH0 A;  4KVH A;  3LH4 A;  1O7P B;  4HM0 B;  4N6O B;  1LXE A;  1E3V A;  4N6N B;  2ML5 A;  3CPW 2;  1AVL A;  3HX8 A;  2CG1 A;  4L8O A;  1RRL A;  1YJW 3;  4LMI A;  5CF1 A;  4RBN A;  3MG3 A;  7STD A;  1YIJ 3;  4R4K A;  4XDV A;  2HMM B;  2OQE A;  3EBY A;  5JPU A;  2XF3 A;  1ZO2 A;  3LTC A;  4XBT A;  4K1V A;  3BLZ A;  4K1U A;  1Y4K A;  3LYG A;  1V74 A;  1GS3 A;  1K73 4;  1O7W B;  1W6Y A;  3OXA A;  1OHP A;  3F8X A;  1D6U A;  4EYC A;  4G1M B;  5IEP A;  2CFD A;  4KZ1 A;  3KN4 A;  1K8A 4;  4FR9 A;  2W2C A;  1OGX A;  1DVD A;  1JB4 A;  3PGB A;  4XBY A;  4U13 A;  3EBT A;  3JUO A;  3X3Z A;  2WO0 A;  2D42 A;  2Q07 A;  1IQY A;  2CWU A;  4FCJ A;  4CDL A;  3RGA A;  3HK4 A;  2MC8 A;  2B24 B;  2XSH B;  1KWI A;  3N9H A;  4H61 A;  1DYU A;  2KXG A;  1EG9 B;  3BNC A;  1JJ2 2;  1N5H A;  3NX0 A;  1Q7Y 4;  1WMN A;  5IG0 A;  1IT7 A;  3KII A;  4Q53 A;  5IW9 A;  1DMQ A;  4FCM A;  1FA3 A;  1SPU A;  2GU3 A;  1N5P A;  2ZL8 A;  5IF6 A;  4WP5 A;  5D82 A;  5STD A;  4QWT A;  4IIA A;  1N8R 4;  2OCT A;  3T0U A;  1W6C A;  1MOL A;  2CFL A;  4IPB A;  3BND A;  1SQW A;  5IG3 A;  3LTA A;  3UJM A;  3X40 A;  3FF0 A;  3KSE D;  3BB9 A;  4FMD A;  3HI7 A;  3STD A;  2XFS A;  3CCJ 3;  2QA4 3;  2HMN B;  1FGQ A;  1VQ5 3;  2E2V A;  2E2U A;  3CC7 3;  2QEX 3;  3DGN A;  3K5T A;  5ELU A;  1NU3 A;  1UUV B;  3SLU A;  3OW2 2;  3EJV A;  3Q90 A;  2WGQ A;  3EX9 A;  3L0R A;  2OOV C;  4HM2 B;  2HML B;  4K61 A;  3CCM 3;  1OHO A;  2F99 A;  3MHE A;  1QVF 2;  3CCU 3;  1ROV A;  2CWV A;  1GD4 A;  1GY7 A;  2OTJ 3;  1IV7 A;  4O8S A;  1GY5 A;  1QMA A;  3FKA A;  3QK9 A;  3D9R A;  4HZB B;  6STD A;  3X42 A;  1C7H A;  3B8L A;  3EQQ B;  2PNC A;  3NM7 A;  3UL5 A;  4HVN A;  1YGE A;  3S29 A;  1U8C B;  3EF8 A;  2IMJ A;  5IEO A;  1A67 A;  3TDG A;  1K9M 4;  1JN5 A;  1NB5 I;  3B7C A;  1BUQ A;  2BHM A;  3H51 A;  3NQZ A;  2BO9 B;  3JVC A;  2W03 A;  4HM8 B;  4XB5 A;  2WOF A;  1LNH A;  3IMA B;  4HM1 B;  4N6U A;  5AEW B;  1JN5 B;  4HM5 B;  3RGR A;  3S67 A;  2WGO A;  3K0Z A;  3K7C A;  2GEY A;  3PCR A;  4XDW A;  3FH1 A;  4X2O A;  3FLJ A;  3U97 A;  4STD A;  2W9Q A;  3SXX A;  3T8N A;  2XH9 A;  1LVN A;  3SED A;  3PYJ A;  2CG0 A;  1YHQ 3;  2BT3 A;  1VQN 3;  2BNG A;  1Q82 4;  2XGN A;  3Q1C A;  1K28 A;  1R4C A;  1RJO A;  1JV2 B;  1UW1 A;  3MPH A;  1YI2 3;  4R80 A;  3CD6 3;  3Q2P A;  1Z1S A;  3IJE B;  3QRD A;  2OWP A;  3ER7 A;  3EB8 A;  2V1L A;  3WA2 X;  2OTL 3;  3FG3 A;  2XFT A;  2W56 A;  1VQ9 3;  1CEW I;  2KRT A;  3G8Z A;  4RNZ A;  3CC4 3;  2CIU A;  4HYZ A;  5G2G A;  3K63 A;  3NUV A;  3GZY B;  3EC9 A;  5KP3 A;  5CF2 A;  3FGY A;  3MYT A;  5AYR B;  1W2Z A;  1SII A;  1FGR A;  1VQO 3;  1G96 A;  3B4P A;  4TX4 A;  3NHX A;  4RZM A;  1ASK A;  2W56 B;  3ALA A;  5AYS C;  1IDP A;  3LTB A;  2IUJ A;  4BTW A;  5IEN A;  3BNE A;  3WOF B;  1TIJ A;  2YX9 A;  1ZX2 A;  4EV2 A;  5FW5 A;  4MMZ B;  1SIH A;  3FZW A;  2UX0 A;  1VQL 3;  3GZB A;  3X41 A;  3OX9 A;  4FCZ A;  2IA7 A;  2SBL A;  4MMY B;  4RNY A;  5AIG A;  1OPY A;  1W7C A;  1IQ8 A;  1YJ9 3;  1IU7 A;  1FGO A;  1TFO A;  1U5O A;  2W04 A;  2W9P A;  4O02 B;  2BMQ B;  1M1K 4;  3I0Y A;  5EVH A;  1ISK A;  1M90 4;  1QAK A;  1US1 A;  4WWU C;  1NWW A;  4EV5 A;  1STF I;  4EC6 A;  4FMC A;  1Q86 4;  3DMC A;  2B1X B;  2L4V A;  3CME 3;  1NB3 I;  3AMO A;  4HM3 B;  2Z77 A;  2LQV A;  1OF5 A;  1VQP 3;  1IVW A;  4WYK B;  2HMJ B;  2W0Q A;  1FGM A;  1RN7 A;  3DM8 A;  1KQS 2;  4WHA A;  1AVK A;  1IV9 A;  3H3H A;  2CH9 A;  2ML6 A;  3AMO B;  5CK6 A;  4AEQ A;  2HMK B;  4KFD A;  4AKZ A;  5BXQ A;  2CK3 H;  1OF5 B;  2Y73 A;  3I55 3;  4LEH A;  1FGT A;  3F7X A;  4R1K A;  5DRV A;  4ZM8 A;  3NBJ A;  3WA3 A;  2Z7A A;  1KC8 4;  3DY5 A;  1M1X B;  3SVA A;  4BTY A;  3DGM A;  1F8N A;  2Y74 A;  1CQS A;  5HGR A;  3VGN A;  1O7N B;  2F98 A;  5AEU B;  1ULI B;  3CC2 3;  2Z76 A;  1VQ7 3;  1KD1 4;  2JDI H;  1AV4 A;  2GU1 A;  4LZI A;  3CCS 3;  2I9W A;  3NBR A;  1UI8 A;  2GBW B;  3F9S A;  4JRF A;  2GXF A;  2OQE C;  1Q81 4;  1PFP A;  3G16 A;  5KP4 A;  2RGQ A;  2XSO B;  4PEJ A;  3X3Y A;  5D83 A;  1T5Y A;  4GB5 A;  1J2B A;  3V99 A;  4EBG A;  2O9U X;  3S28 A;  1RKY A;  3DUK A;  3JUN A;  5EQL A;  1W01 A;  4IT7 A;  3CNX A;  1VQ6 3;  3WDG B;  4N6L A;  2XR8 B;  4CCV A;  4FMA A;  1YJN 3;  3CNM A;  2PZV A;  1LOX A;  2W6J H;  1MNL A;  2F86 B;  3EN1 B;  2GBX B;  3NBB A;  3G4S 3;  5EEO A;  2R4I A;  1KSI A;  4HKV B;  3I56 3;  3CXC 2;  2MF7 A;  3KKG A;  4LSO A;  3OWS A;  4OUQ A;  1IK3 A;  3GZR A;  3WOD G;  3V98 A;  1L5G B;  3CU3 A;  2QIY A;  4N6M A;  4R9K A;  5FGO A;  3HIG A;  1A2V A;  4HJL B;  1WTH A;  4N6T A;  3N54 B;  3CCE 3;  2HMO B;  1ULJ B;  3PCS A;  3NV0 B;  1IVX A;  2FGT A;  1QVG 2;  2STD A;  1QAF A;  2JQ5 A;  3NQY A;  3VSY A;  1Q42 A;  2RSX A;  4MMX B;  8CHO A;  2C11 A;  4J9A A;  1GYB A;  4OK0 A;  3UB1 A;  2KCD A;  3F14 A;  3GAX A;  3S27 A;  3OV4 A;  3MG1 A;  1E3R A;  3MSO A;  3HZP A;  4O2H A;  2XEP A;  1JB2 A;  5CXO A;  3HII A;  1HU9 A;  3JUQ A;  1WMO A;  5LC7 A;  2P0X A;  3VF1 A;  1IVV A;  3KSP A;  1HKX A;  4ORL A;  2P05 A;  4HBR A;  4BTX A;  3LTD A;  3LXU X;  5AIH A;  3F40 A;  3JUP A;  3DXO A;  4N6V 0;  1W4N A;  3X3X A;  1NJI 4;  3J7Y d;  2GEX A;  1W5Z A;  3EE1 A;  1OCV A;  1VQM 3;  3LT8 A;  2IUK A;  3G6E 3;  1QJG A;  1W6G A;  2OOV A;  2YFL B;  5AIF A;  3UL6 A;  2K0M A;  3FCS B;  2CFW A;  2YFJ B;  3RDE A;  4I4K A;  3WOE B;  3FSD A;  5JPP A;  5CLK A;  3CMA 3;  2CFG A;  1K41 A;  1GY6 A;  4WYK A;  3T8U A;  3WMD A;  2RFR A;  4XM4 A;  2FXT A;  1A90 A;  1UI7 A;  3V92 A;  1TFK A;  2P0M A;  4X2H A;  2Z6B A;  3GRD A;  1OAC A;  3FG4 A;  2CW9 A;  3A76 A;  3GWR A;  1JKG A;  2WOH A;  3E99 A;  5ELJ A;  5JBS A;  4L8P A;  2P38 A;  2INX A;  2XGL A;  4FMB A;  3MKI A;  1M9G A;  3UNL A;  4KFF A;  2M7O A;  3G0K A;  3EN8 A;  1WQL B;  2XRX B;  3O8Y A;  3GZX B;  1WNH A;  1JRQ A;  1YVB I;  3K9M C;  5TGN A;  1W02 A;  1RRH A;  1JKG B;  4HM4 B;  1EQK A;  1EKM A;  3U1W A;  3SOY A;  1DMM A;  2D1W A;  5I97 A;  5DRE A;  2LYX A;  5IG4 A;  3MWZ A;  1TP6 A;  5AII A;  3PXM A;  1SJW A;  1GD3 A;  4HZ9 B;  3DGO A;  3DGL A;  3F8H A;  4NRE A;  3S5C A;  4EXR A;  2RCD A;  2CFK A;  1D6Z A;  3MG2 A;  1JB5 A;  4HM6 B;  2CC3 A;  4AKY A;  1W2B 2;  1Q40 A;  1NDO B;  3CCR 3;  1VQ4 3;  1YIT 3;  3SX1 A;  2CKF B;  5D81 A;  1E97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...