2RSXA

Solution structure of isea, an inhibitor protein of dl-endopeptidases from bacillus subtilis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
GKNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEKGFKDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of IseA, an Inhibitor Protein of DL-Endopeptidases from Bacillus subtilis, Reveals a Novel Fold with a Characteristic Inhibitory Loop
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase inhibitor
molecule keywords Uncharacterized protein yoeB
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16800 Endopep_inhib IseA DL-endopeptidase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.420 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rsxA00
2RSXA
chains in the Genus database with same CATH superfamily
3F8XA 4WFOA 1FUTA 3CME3 1JBSA 5BXQA 1OPYA 2E2UA 4MEIA 3GAXA 4HYZA 4Q53A 1M1K4 5IG4A 1PYLA 4BTWA 3ER7A 2RBIA 2W2CA 3HX8A 1B2XA 1MGWA 1W6YA 2KCDA 2SBLA 2W9PA 2Z77A 1LNIA 3BNBA 5A0OB 5STDA 1GY7A 1TJDA 1DVDA 2RSXA 4FR9A 4FMBA 3A76A 3LYGA 5AYRB 1CYVA 1HZ1A 3CCR3 4RBNA 5KP1A 1DMNA 4O8SA 3T8NA 4HM7B 1FA3A 1E3RA 4L8PA 4R4KA 5M19A 3FH1A 5AEWB 4K90B 3M8CA 1HYFA 2OOVA 3I553 1BNFA 1RCLA 3EE1A 1UGIA 5G1LA 2OQEC 3B4OA 3MHEA 2PNCA 1T5YA 3STDA 2C4BA 1RGFA 3UJMA 2BMRB 2YX9A 5CK6A 1STDA 5IG0A 9RNTA 3TDGA 3NXJA 4BU4A 1KWIA 1GD4A 2IA7A 4LYLB 3CD63 2W04A 4AEQA 3K63A 1V57A 2BIRA 3X41A 1I2GA 1UCKA 3G713 1Z1SA 3B7CA 3F7SA 3MWZA 2CX1A 3UL6A 1LOXA 1LOYA 4HBRA 1IT7A 1PU4A 1BNIA 1OCVA 1BNJA 3FGYA 1A2KA 3MKIA 3G16A 3S67A 1T3BA 3N54B 3Q2PA 1W7CA 1MWTA 8CHOA 3EN1B 3EHCA 4MMXB 4EYCA 2Z76A 1EEJA 1AR0A 1Q7Y4 3CMA3 1ZGXA 4AKYA 2CK3H 3JUNA 3LOYA 5FW5A 2XEPA 2OTL3 5IERA 1O7GB 2GBWB 3EF8A 4LSOA 5CXOA 1MOLA 2HMLB 4GB5A 3WHOA 2XRXB 4KVHA 4HM6B 3EBTA 1IT8A 1SPUA 1X1YA 4LEHA 1TU5A 2CIUA 1FGTA 3FF0A 1OGXA 3Q90A 5AIHA 3WDGB 2MF7A 3MPHA 1PY3A 1K28A 4AKZA 1R4CA 2HMKB 3BNDA 4XM4A 2F4YA 1UDII 1BGSA 3HIGA 3DY5A 4FCJA 5IEPA 2W6JH 5D82A 1HKXA 2K3DA 3A5EA 3LTDA 5TGNA 3CU3A 1Q864 1TP6A 3B4PA 3FLJA 4L8OA 3PCSA 3ROBA 1FGRA 1ASKA 4HZ9B 3QK9A 4DKIA 2H0IA 3V98A 1QVG2 3DGNA 1KC84 3WMDA 2M7OA 2AADA 5IW9A 4R9KA 2E2TA 1O7NB 1UI7A 4N6MA 3V99A 1BUQA 4HVNA 3DGYA 1JBRA 1B2SA 3FKAA 3CC23 4HM2B 1JKGA 1IV7A 1SQWA 2CX0A 1JBTA 1UGHI 5CLKA 3HIIA 4NPBA 2OCTA 1VQ63 2BNGA 4EV5A 3QRDA 2L4VA 3RGRA 1GY6A 3Q1CA 1VZZA 2CWTA 3MSOA 3NQZA 4EV2A 1N9EA 3MG3A 2CFDA 3CCS3 1MWRA 1YVBI 3JUMA 1BOXA 1AQZA 1PFPA 3ALAA 1B21A 2IY2A 1IYYA 1DYUA 1M1XB 1RLSA 5D81A 3FZWA 1RJOA 3WR2A 1S723 5AEUB 3DGOA 5HOHA 1B2ZA 1JZOA 4X2HA 3D79A 2ML6A 1KSIA 2O9UX 5AI1A 3F14A 1NB5I 1D6YA 3CC73 1JN5A 1JKGB 1RNTA 1I2FA 1N5PA 3IJEB 3KSED 1NDOB 1RCKA 3LTBA 1UUVB 3PCRA 3V92A 3NBBA 5AIFA 1RNBA 2B24B 5KP4A 3GWRA 1RMSA 3KZTA 3OWUA 4MMZB 3I0YA 4U13A 1NB3I 1WNHA 5GSPA 3GRDA 1N9JA 3DH2A 3HK4A 4WP5A 4NREA 1L5GB 3SEDA 4J5GA 3FCSB 1YHQ3 1RKYA 1K9M4 1BSEA 4BTYA 4CCVA 4RNZA 1BRGA 1ULJB 1YIT3 1GY5A 1BIRA 1VQO3 5G2GA 4N6LA 4KFFA 3LMLA 1U5OA 3BU4A 3S5CA 3T0UA 3OXAA 1UCIA 3CCL3 1IVXA 3HI7A 1QAFA 2WGOA 3BIRA 4N6UA 4G1MB 3RGAA 2ML5A 2CC3A 4JF8A 4GL6A 1BNEA 2F5MA 1VQ43 1R4YA 2XR8B 1WMPA 3AHWA 2CH9A 3FG3A 2O3OA 3KIIA 4RZMA 1GOUA 2WOFA 3PS8A 2Y73A 2STDA 3PXMA 8RNTA 5EEOA 1RSNA 2CG1A 4ILFA 1QJGA 1TUHA 1GMPA 2HMMB 4EW5A 3MYTA 4OUQA 4K61A 2V1LA 3OV4A 2BHMA 4LZIA 1YJW3 4O3VA 2RCDA 1TRPA 3X3ZA 4X2OA 3NBJA 1X1XA 5IENA 2KF4A 2PZVA 3I563 1KD14 2IMJA 3AGOA 3JUQA 1BUJA 1M904 1ROVA 3CCE3 1QVF2 4OK0A 1Y4KA 1AVKA 2E2VA 2GEXA 2R4IA 2W56A 3B8LA 4WWUC 5BVBA 1I8VA 3KE7A 3DGMA 1UCJA 3DMCA 4HM4B 1MWSA 1Q824 3U1WA 1X1WA 4K1VA 1SJWA 2UUGC 1E97A 3BNEA 3WA3A 4CDLA 5FGOA 1VQ73 1W00A 3D9RA 1BAOA 1V74A 4RNYA 5ELJA 5RNTA 2YFIB 4H61A 1SARA 1SIIA 6RNTA 1RHLA 1N5HA 4R80A 3X3XA 2IUKA 1LOVA 3G0KA 4FCMA 1T2HA 1W6CA 1LQMB 3K9MC 3GSPA 1NU3A 1TRQA 5AYSC 1N8QA 1IDPA 2UX0A 1SIHA 2F98A 3URPA 1IV9A 2UGIA 1RGLA 1IVWA 1BRJA 1EUIC 1I70A 4WYKB 5JPPA 1IK3A 1YJN3 1I0VA 1NWWA 2KRTA 1ROAA 1KQS2 2C10A 3E99A 2ZL8A 2INXA 2XFTA 4J9AA 2CWVA 2HMJB 3WOEB 1RGKA 4N6TA 4CJNA 1CYUA 5AIIA 1YI23 2KXGA 3CPW2 1CH0A 1EG9B 3GZBA 3IMAB 1N8R4 1J2BA 1BRSA 2Y74A 1FUWA 1O7WB 1ULIB 3JUPA 1DETA 1TIJA 2XGLA 1O7PB 3DUKA 7RNTA 1F8NA 2CFGA 4HKVB 4RNTA 1WMNA 4JRFA 3VF1A 2WOHA 1DMQA 3Q3FA 4MMYB 1ZX2A 1JNQA 3EN8A 1OHOA 1DVCA 2GU1A 3L0RA 3NUVA 1VQ83 2JDIH 2JQ5A 1I3FA 4N6V0 1BNSA 1W02A 1CEWI 2QA43 1B20A 2BO9B 2OOVC 2YFJB 3CPOA 5CF1A 1JB5A 1QALA 1LNHA 4HAAA 3S27A 2CKFB 3RNTA 3SVAA 1OHSA 3SLUA 3DM8A 3JUOA 3GZXB 3NX0A 1RN7A 2D42A 2GXFA 2CW9A 1I0XA 3F8HA 3G6E3 4HJLB 3LTAA 4J5KA 3RDEA 2ZA4A 1YJ93 1FGOA 1BSDA 1BVIA 1CQSA 1D6UA 1OGZA 1V58A 2OQEA 3CCQ3 1JN5B 1GMQA 1JRQA 4HM1B 3CNMA 1X1UA 4IPBA 4H3UA 1JV2B 3LZAA 1VQP3 1OHPA 2LYXA 3UL5A 3KFQC 2CFWA 4N6OB 3SXXA 3EBYA 3D5GA 3SYUA 4CPKA 1W2B2 1W6GA 2BMQB 1S5AA 4N6NB 2I9WA 4GSPA 3S29A 2J8XB 3JVCA 1RGCA 4O2HA 1EQKA 1GYBA 4XDWA 1GMRA 1Q40B 2FXTA 3J7Yd 1IU7A 1NO3A 2QIYA 1YGEA 1RGAA 1ZS7A 3AHSA 1OH0A 1ZO2A 1RN4A 4HZBB 3O8YA 1HU9A 3WA2X 2BT3A 1VQN3 3HOHA 2CFKA 3KKGA 4O02B 1G0TA 5JPUA 3AGNA 1IQXA 2YFLB 3G8ZA 1E3VA 3AMOB 1DMMA 3SOYA 3SX1A 2KF6A 3EB8A 1AV4A 2QGUA 3T8UA 1A2PA 2Q07A 1VQQA 3OWYA 5D83A 5EVHA 3NBRA 1NNVA 4R9LA 5BIRA 2QEX3 1LRAA 1BNGA 1Q814 1BRKA 4J8TA 1MWUA 4EXRA 4FCZA 3ECFA 1VQ53 1YIJ3 1JB4A 3PGBA 2K54A 1YGWA 1VQK3 2OWPA 2Z6BA 3N9HA 3LH4A 2P38A 2LQVA 1YVSA 1BSBA 4MJDA 5DREA 5M1AA 1RRHA 3NM2A 3LT8A 1AVLA 1FYSA 1MNLA 1B3SA 3KN4A 3FG1A 3PYJA 5ELUA 3CC43 4GHOA 1D6ZA 3DXOA 3LT9A 3KSPA 6STDA 4BL3A 3FG4A 1OUNA 2BMOB 3CNXA 2F5WA 2GBXB 5JBSA 2GSPA 5IG5A 3F9SA 4L7KA 2W56B 4ZM8A 3AMOA 3EX9A 3CCJ3 1A67A 1RRLA 2HOHA 1W5ZA 2GEYA 1BU4A 3G4S3 3CXC2 1K8A4 5LC7A 5G1KA 1WTHA 1UUGB 1BSCA 1FGMA 2K0MA 1RDSA 4LMIA 1IVUA 4NHFA 3H51A 5LC6A 3F40A 4HM3B 1LVNA 1US1A 2CHCA 2SARA 2RNTA 2FNQA 3BNCA 1BANA 1QAKA 4BIRA 3NHXA 1ISKA 1RGEA 4HOHA 1B2MA 2HMOB 1STFI 2MC8A 1GSPA 3DZLA 2CFLA 2P05A 3CCM3 2CWUA 4QWTA 4XBYA 4FMCA 1B27A 2W03A 1UCLA 4K1UA 2RGQA 3K5TA 2H0HA 3EQQB 3VGNA 3N8BA 1NJI4 3K0ZA 4WHAA 3HZPA 5DRVA 4HM0B 3UNLA 5KP3A 1JB2A 3MG2A 4ORLA 3NQYA 4EC6A 1UUWB 2P09A 2KF3A 2RFRA 3ZFZA 1K734 1W2ZA 3MG1A 4WYKA 4IIAA 3S28A 3WOFB 6GSPA 1OF5B 2AAEA 1YNVX 1TFKA 3DGLA 3K7CA 3KCHA 1C7HA 3BLZA 2F99A 4BL2A 1A90A 3UB1A 1O7HB 3ZG5A 3H3HA 2WO0A 1OACA 1JZDA 4FMDA 3OX9A 2ZHXB 1FGQA 2D1WA 3D3LA 1W01A 1C54A 5HGRA 4IT7A 1RGGA 1TTOA 3OW22 1A2VA 2KAAA 3LXUX 2FGTA 5IG3A 7STDA 1GOYA 2A15A 2XF3A 2XFSA 5IF6A 3EC9A 1BRIA 2XH9A 1Q7HA 3GZYB 4STDA 1O7MB 3F7XA 3OWSA 2CG0A 3D4AA 1OF5A 1UI8A 3FSDA 4I5QA 1FZUA 1G96A 3U97A 3ZG0A 5BU4A 3WODG 5M18A 1QMAA 2OTJ3 5EQLA 1IVVA 4KZ1A 1FW7A 3CCV3 1EKMA 1T2IA 4HM8B 4I4KA 5AIGA 7GSPA 1BRNL 1I2EA 3D5IA 5IEOA 1AY7A 2HMNB 1UW1A 3NV0B 4XB5A 2B1XB 1IQYA 3X40A 1LQGC 1TFOA 2P0MA 3GZRA 1MGRA 1WQLB 4EBGA 1BSAA 1IQ8A 1EA2A 2W0QA 1DE3A 4KFEA 4R1KA 2KF5A 1G02A 4KFDA 2P0XA 2F86B 5CF2A 1FUSA 4XBXA 3X42A 3SOAA 3LTCA 2H0GA 1LOWA 2XSOB 3EJVA 1BNRA 3BB9A 2XGNA 1RTUA 1K41A 1JJ22 1VQ93 1WMOA 1Q40A 2L1SA 3IPTA 1Q42A 3NM7A 4N3VA 4XDVA 2XSHB 1Q9EA 1U8CB 4BTXA 2IUJA 3CCU3 1VQM3 2BU4A 4TX4A 3NV0A 1GOVA 2F56A 1LXEA 2W9QA 4HM5B 1I3IA 2ZDJA 4PEJA 2C11A 2GU3A 4KT3B 3VSYA 3X3YA 5I97A 1VQL3 1BRHA 1B2UA 1M9GA 1GD3A 2IYJA 3FF2A 4FMAA 4XBTA 1GS3A 1RGHA 1RN1A 2Z7AA 1W4NA 2R41A 2WGQA 3PZWA 4OVMA 4LGQA
chains in the Genus database with same CATH topology
3F8XA 4WFOA 3CME3 5BXQA 1OPYA 2E2UA 4MEIA 3GAXA 4HYZA 4Q53A 1M1K4 5IG4A 4BTWA 3ER7A 2W2CA 3HX8A 2KCDA 2SBLA 1W6YA 2Z77A 2W9PA 3BNBA 5A0OB 5STDA 1GY7A 1DVDA 2RSXA 4FR9A 4FMBA 3A76A 3LYGA 5AYRB 1CYVA 3CCR3 4RBNA 5KP1A 1DMNA 4O8SA 3T8NA 4HM7B 1FA3A 1E3RA 4L8PA 4R4KA 3FH1A 5AEWB 4K90B 3M8CA 2OOVA 3I553 3EE1A 2OQEC 3B4OA 3MHEA 2PNCA 1T5YA 3STDA 3UJMA 2BMRB 2YX9A 5CK6A 1STDA 5IG0A 3TDGA 3NXJA 1KWIA 1GD4A 2IA7A 3CD63 2W04A 4AEQA 3K63A 3X41A 3G713 1Z1SA 3B7CA 3F7SA 3MWZA 3UL6A 1LOXA 4HBRA 1IT7A 1PU4A 1OCVA 3FGYA 1A2KA 3MKIA 3G16A 3S67A 3Q2PA 3N54B 8CHOA 1W7CA 3EN1B 3EHCA 4MMXB 4EYCA 2Z76A 1Q7Y4 1AR0A 3CMA3 4AKYA 2CK3H 3JUNA 3LOYA 5FW5A 2XEPA 2OTL3 5IERA 1O7GB 2GBWB 3EF8A 4LSOA 5CXOA 1MOLA 2HMLB 4GB5A 2XRXB 4KVHA 4HM6B 3EBTA 1IT8A 1SPUA 4LEHA 1TU5A 2CIUA 1FGTA 3FF0A 1OGXA 3Q90A 5AIHA 3WDGB 2MF7A 3MPHA 1K28A 4AKZA 1R4CA 2HMKB 3BNDA 4XM4A 3HIGA 3DY5A 4FCJA 5IEPA 2W6JH 5D82A 1HKXA 3LTDA 5TGNA 3CU3A 1Q864 1TP6A 3B4PA 3FLJA 4L8OA 3PCSA 3ROBA 1FGRA 1ASKA 4HZ9B 3QK9A 1QVG2 3V98A 1KC84 3DGNA 3WMDA 2M7OA 5IW9A 4R9KA 1UI7A 1O7NB 2E2TA 4N6MA 3V99A 1BUQA 4HVNA 3CC23 3FKAA 4HM2B 1JKGA 1IV7A 1SQWA 5CLKA 3HIIA 2OCTA 1VQ63 2BNGA 4EV5A 3QRDA 2L4VA 3RGRA 1GY6A 3Q1CA 1VZZA 2CWTA 3MSOA 3NQZA 4EV2A 1N9EA 3MG3A 2CFDA 3CCS3 1YVBI 3JUMA 1PFPA 3ALAA 1DYUA 1M1XB 5D81A 3FZWA 1RJOA 1S723 5AEUB 3DGOA 4X2HA 2ML6A 1KSIA 2O9UX 5AI1A 3F14A 1NB5I 1D6YA 3CC73 1JN5A 1JKGB 1N5PA 3IJEB 3KSED 1NDOB 3LTBA 1UUVB 3PCRA 3V92A 3NBBA 5AIFA 2B24B 5KP4A 3GWRA 3KZTA 3OWUA 4MMZB 3I0YA 4U13A 1NB3I 1WNHA 3GRDA 1N9JA 3HK4A 4WP5A 1L5GB 4NREA 3SEDA 1YHQ3 3FCSB 1K9M4 1RKYA 4BTYA 4CCVA 4RNZA 1ULJB 1YIT3 1GY5A 1VQO3 5G2GA 4N6LA 4KFFA 3LMLA 1U5OA 3S5CA 3T0UA 3CCL3 3OXAA 1IVXA 3HI7A 1QAFA 2WGOA 4N6UA 4G1MB 3RGAA 2ML5A 2CC3A 4JF8A 4GL6A 1VQ43 2XR8B 1WMPA 2CH9A 3FG3A 2O3OA 3KIIA 4RZMA 2WOFA 3PS8A 2Y73A 2STDA 3PXMA 5EEOA 2CG1A 1QJGA 1TUHA 2HMMB 3MYTA 4OUQA 4K61A 2V1LA 3OV4A 2BHMA 4LZIA 1YJW3 4O3VA 2RCDA 3X3ZA 4X2OA 3NBJA 5IENA 2PZVA 3I563 1KD14 2IMJA 3JUQA 1M904 1ROVA 3CCE3 1QVF2 4OK0A 1Y4KA 1AVKA 2E2VA 2GEXA 2R4IA 2W56A 3B8LA 4WWUC 5BVBA 3KE7A 3DGMA 3DMCA 4HM4B 1Q824 3U1WA 4K1VA 1SJWA 1E97A 3BNEA 3WA3A 4CDLA 5FGOA 1VQ73 1W00A 3D9RA 5ELJA 1V74A 4RNYA 2YFIB 4H61A 1SIIA 1N5HA 4R80A 3X3XA 2IUKA 3G0KA 4FCMA 1W6CA 3K9MC 1NU3A 5AYSC 1N8QA 1IDPA 2UX0A 1SIHA 2F98A 1IV9A 1IVWA 5JPPA 4WYKB 1IK3A 1YJN3 1KQS2 1NWWA 2KRTA 1ROAA 2C10A 3E99A 2ZL8A 2INXA 2XFTA 4J9AA 2CWVA 2HMJB 3WOEB 1CYUA 4N6TA 5AIIA 1YI23 2KXGA 3CPW2 1EG9B 3IMAB 3GZBA 1N8R4 1J2BA 1FUWA 2Y74A 1O7WB 1ULIB 3JUPA 1TIJA 2XGLA 1O7PB 3DUKA 1F8NA 2CFGA 4HKVB 1WMNA 4JRFA 3VF1A 2WOHA 1DMQA 4MMYB 1ZX2A 1JNQA 3EN8A 1OHOA 1DVCA 2GU1A 3L0RA 3NUVA 1VQ83 2JDIH 2JQ5A 4N6V0 1W02A 1CEWI 2QA43 2BO9B 2OOVC 2YFJB 3CPOA 5CF1A 1JB5A 1QALA 1LNHA 2CKFB 3SVAA 1OHSA 3SLUA 3DM8A 3JUOA 3GZXB 3NX0A 1RN7A 2D42A 2GXFA 2CW9A 3F8HA 3G6E3 4HJLB 3LTAA 3RDEA 1YJ93 1FGOA 1D6UA 1CQSA 1OGZA 2OQEA 3CCQ3 1JN5B 1JRQA 4HM1B 3CNMA 4IPBA 4H3UA 1JV2B 3LZAA 1VQP3 1OHPA 2LYXA 3UL5A 3KFQC 2CFWA 4N6OB 3SXXA 3EBYA 1W2B2 1W6GA 2BMQB 1S5AA 4N6NB 2I9WA 3S29A 3JVCA 4O2HA 1EQKA 1GYBA 4XDWA 1Q40B 2FXTA 3J7Yd 1IU7A 1NO3A 2QIYA 1YGEA 4HZBB 3S27A 1OH0A 1ZO2A 3O8YA 1HU9A 3WA2X 2BT3A 1VQN3 3KKGA 2CFKA 4O02B 5JPUA 2YFLB 1IQXA 3G8ZA 1E3VA 3AMOB 1DMMA 3SOYA 3SX1A 3EB8A 1AV4A 2QGUA 3T8UA 2Q07A 5D83A 3OWYA 5EVHA 3NBRA 4R9LA 2QEX3 1Q814 4J8TA 4EXRA 1VQ53 4FCZA 3ECFA 1YIJ3 1JB4A 3PGBA 2K54A 1VQK3 2OWPA 2Z6BA 3N9HA 3LH4A 2P38A 2LQVA 4MJDA 5DREA 1RRHA 3NM2A 3LT8A 1AVLA 3KN4A 1MNLA 3FG1A 3PYJA 5ELUA 3CC43 1D6ZA 3DXOA 3LT9A 3KSPA 6STDA 3FG4A 1OUNA 2BMOB 3CNXA 2GBXB 5JBSA 5IG5A 3F9SA 4L7KA 2W56B 4ZM8A 3AMOA 3EX9A 3CCJ3 1A67A 1RRLA 1W5ZA 2GEYA 3G4S3 3CXC2 1K8A4 5LC7A 1WTHA 1FGMA 2K0MA 4LMIA 1IVUA 4NHFA 3H51A 5LC6A 3F40A 4HM3B 1LVNA 1US1A 2CHCA 3BNCA 2FNQA 1QAKA 1ISKA 3NHXA 2HMOB 1STFI 2MC8A 3DZLA 2CFLA 2P05A 3CCM3 2CWUA 4QWTA 4XBYA 4FMCA 2W03A 4K1UA 2RGQA 3K5TA 3EQQB 3VGNA 3N8BA 1NJI4 3K0ZA 4WHAA 3HZPA 5DRVA 4HM0B 3UNLA 5KP3A 1JB2A 3MG2A 4ORLA 3NQYA 4EC6A 1UUWB 2P09A 2RFRA 1K734 1W2ZA 3MG1A 4WYKA 4IIAA 3S28A 3WOFB 1OF5B 1TFKA 3DGLA 3K7CA 1C7HA 3BLZA 2F99A 1A90A 3UB1A 1O7HB 3H3HA 2WO0A 1OACA 4FMDA 3OX9A 1FGQA 2D1WA 3D3LA 1W01A 5HGRA 4IT7A 3OW22 1A2VA 3LXUX 5IG3A 2FGTA 7STDA 2A15A 2XF3A 2XFSA 5IF6A 3EC9A 2XH9A 3GZYB 4STDA 1O7MB 3F7XA 3OWSA 2CG0A 1OF5A 1UI8A 3FSDA 3U97A 1G96A 3WODG 1QMAA 2OTJ3 5EQLA 1IVVA 4KZ1A 3CCV3 1EKMA 4HM8B 4I4KA 5AIGA 5IEOA 2HMNB 1UW1A 3NV0B 4XB5A 2B1XB 1IQYA 3X40A 1TFOA 2P0MA 3GZRA 1WQLB 4EBGA 1IQ8A 1EA2A 2W0QA 4KFEA 4R1KA 4KFDA 2P0XA 2F86B 5CF2A 4XBXA 3X42A 3SOAA 3LTCA 2XSOB 3EJVA 3BB9A 2XGNA 1K41A 1JJ22 1VQ93 1WMOA 1Q40A 3IPTA 3NM7A 1Q42A 4N3VA 4XDVA 4BTXA 2XSHB 1U8CB 2IUJA 3CCU3 1VQM3 4TX4A 3NV0A 1LXEA 2W9QA 4HM5B 2ZDJA 4PEJA 2C11A 2GU3A 3VSYA 3X3YA 5I97A 1VQL3 1M9GA 1GD3A 3FF2A 4FMAA 4XBTA 1GS3A 2Z7AA 1W4NA 2WGQA 3PZWA 4OVMA 4LGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSX A; 
#chains in the Genus database with same CATH topology
 3F8X A;  4WFO A;  1FUT A;  3CME 3;  1JBS A;  5BXQ A;  1OPY A;  2E2U A;  4MEI A;  3GAX A;  4HYZ A;  4Q53 A;  1M1K 4;  5IG4 A;  1PYL A;  4BTW A;  3ER7 A;  2RBI A;  2W2C A;  3HX8 A;  1B2X A;  1MGW A;  1W6Y A;  2KCD A;  2SBL A;  2W9P A;  2Z77 A;  1LNI A;  3BNB A;  5A0O B;  5STD A;  1GY7 A;  1TJD A;  1DVD A;  2RSX A;  4FR9 A;  4FMB A;  3A76 A;  3LYG A;  5AYR B;  1CYV A;  1HZ1 A;  3CCR 3;  4RBN A;  5KP1 A;  1DMN A;  4O8S A;  3T8N A;  4HM7 B;  1FA3 A;  1E3R A;  4L8P A;  4R4K A;  5M19 A;  3FH1 A;  5AEW B;  4K90 B;  3M8C A;  1HYF A;  2OOV A;  3I55 3;  1BNF A;  1RCL A;  3EE1 A;  1UGI A;  5G1L A;  2OQE C;  3B4O A;  3MHE A;  2PNC A;  1T5Y A;  3STD A;  2C4B A;  1RGF A;  3UJM A;  2BMR B;  2YX9 A;  5CK6 A;  1STD A;  5IG0 A;  9RNT A;  3TDG A;  3NXJ A;  4BU4 A;  1KWI A;  1GD4 A;  2IA7 A;  4LYL B;  3CD6 3;  2W04 A;  4AEQ A;  3K63 A;  1V57 A;  2BIR A;  3X41 A;  1I2G A;  1UCK A;  3G71 3;  1Z1S A;  3B7C A;  3F7S A;  3MWZ A;  2CX1 A;  3UL6 A;  1LOX A;  1LOY A;  4HBR A;  1IT7 A;  1PU4 A;  1BNI A;  1OCV A;  1BNJ A;  3FGY A;  1A2K A;  3MKI A;  3G16 A;  3S67 A;  1T3B A;  3N54 B;  3Q2P A;  1W7C A;  1MWT A;  8CHO A;  3EN1 B;  3EHC A;  4MMX B;  4EYC A;  2Z76 A;  1EEJ A;  1AR0 A;  1Q7Y 4;  3CMA 3;  1ZGX A;  4AKY A;  2CK3 H;  3JUN A;  3LOY A;  5FW5 A;  2XEP A;  2OTL 3;  5IER A;  1O7G B;  2GBW B;  3EF8 A;  4LSO A;  5CXO A;  1MOL A;  2HML B;  4GB5 A;  3WHO A;  2XRX B;  4KVH A;  4HM6 B;  3EBT A;  1IT8 A;  1SPU A;  1X1Y A;  4LEH A;  1TU5 A;  2CIU A;  1FGT A;  3FF0 A;  1OGX A;  3Q90 A;  5AIH A;  3WDG B;  2MF7 A;  3MPH A;  1PY3 A;  1K28 A;  4AKZ A;  1R4C A;  2HMK B;  3BND A;  4XM4 A;  2F4Y A;  1UDI I;  1BGS A;  3HIG A;  3DY5 A;  4FCJ A;  5IEP A;  2W6J H;  5D82 A;  1HKX A;  2K3D A;  3A5E A;  3LTD A;  5TGN A;  3CU3 A;  1Q86 4;  1TP6 A;  3B4P A;  3FLJ A;  4L8O A;  3PCS A;  3ROB A;  1FGR A;  1ASK A;  4HZ9 B;  3QK9 A;  4DKI A;  2H0I A;  3V98 A;  1QVG 2;  3DGN A;  1KC8 4;  3WMD A;  2M7O A;  2AAD A;  5IW9 A;  4R9K A;  2E2T A;  1O7N B;  1UI7 A;  4N6M A;  3V99 A;  1BUQ A;  4HVN A;  3DGY A;  1JBR A;  1B2S A;  3FKA A;  3CC2 3;  4HM2 B;  1JKG A;  1IV7 A;  1SQW A;  2CX0 A;  1JBT A;  1UGH I;  5CLK A;  3HII A;  4NPB A;  2OCT A;  1VQ6 3;  2BNG A;  4EV5 A;  3QRD A;  2L4V A;  3RGR A;  1GY6 A;  3Q1C A;  1VZZ A;  2CWT A;  3MSO A;  3NQZ A;  4EV2 A;  1N9E A;  3MG3 A;  2CFD A;  3CCS 3;  1MWR A;  1YVB I;  3JUM A;  1BOX A;  1AQZ A;  1PFP A;  3ALA A;  1B21 A;  2IY2 A;  1IYY A;  1DYU A;  1M1X B;  1RLS A;  5D81 A;  3FZW A;  1RJO A;  3WR2 A;  1S72 3;  5AEU B;  3DGO A;  5HOH A;  1B2Z A;  1JZO A;  4X2H A;  3D79 A;  2ML6 A;  1KSI A;  2O9U X;  5AI1 A;  3F14 A;  1NB5 I;  1D6Y A;  3CC7 3;  1JN5 A;  1JKG B;  1RNT A;  1I2F A;  1N5P A;  3IJE B;  3KSE D;  1NDO B;  1RCK A;  3LTB A;  1UUV B;  3PCR A;  3V92 A;  3NBB A;  5AIF A;  1RNB A;  2B24 B;  5KP4 A;  3GWR A;  1RMS A;  3KZT A;  3OWU A;  4MMZ B;  3I0Y A;  4U13 A;  1NB3 I;  1WNH A;  5GSP A;  3GRD A;  1N9J A;  3DH2 A;  3HK4 A;  4WP5 A;  4NRE A;  1L5G B;  3SED A;  4J5G A;  3FCS B;  1YHQ 3;  1RKY A;  1K9M 4;  1BSE A;  4BTY A;  4CCV A;  4RNZ A;  1BRG A;  1ULJ B;  1YIT 3;  1GY5 A;  1BIR A;  1VQO 3;  5G2G A;  4N6L A;  4KFF A;  3LML A;  1U5O A;  3BU4 A;  3S5C A;  3T0U A;  3OXA A;  1UCI A;  3CCL 3;  1IVX A;  3HI7 A;  1QAF A;  2WGO A;  3BIR A;  4N6U A;  4G1M B;  3RGA A;  2ML5 A;  2CC3 A;  4JF8 A;  4GL6 A;  1BNE A;  2F5M A;  1VQ4 3;  1R4Y A;  2XR8 B;  1WMP A;  3AHW A;  2CH9 A;  3FG3 A;  2O3O A;  3KII A;  4RZM A;  1GOU A;  2WOF A;  3PS8 A;  2Y73 A;  2STD A;  3PXM A;  8RNT A;  5EEO A;  1RSN A;  2CG1 A;  4ILF A;  1QJG A;  1TUH A;  1GMP A;  2HMM B;  4EW5 A;  3MYT A;  4OUQ A;  4K61 A;  2V1L A;  3OV4 A;  2BHM A;  4LZI A;  1YJW 3;  4O3V A;  2RCD A;  1TRP A;  3X3Z A;  4X2O A;  3NBJ A;  1X1X A;  5IEN A;  2KF4 A;  2PZV A;  3I56 3;  1KD1 4;  2IMJ A;  3AGO A;  3JUQ A;  1BUJ A;  1M90 4;  1ROV A;  3CCE 3;  1QVF 2;  4OK0 A;  1Y4K A;  1AVK A;  2E2V A;  2GEX A;  2R4I A;  2W56 A;  3B8L A;  4WWU C;  5BVB A;  1I8V A;  3KE7 A;  3DGM A;  1UCJ A;  3DMC A;  4HM4 B;  1MWS A;  1Q82 4;  3U1W A;  1X1W A;  4K1V A;  1SJW A;  2UUG C;  1E97 A;  3BNE A;  3WA3 A;  4CDL A;  5FGO A;  1VQ7 3;  1W00 A;  3D9R A;  1BAO A;  1V74 A;  4RNY A;  5ELJ A;  5RNT A;  2YFI B;  4H61 A;  1SAR A;  1SII A;  6RNT A;  1RHL A;  1N5H A;  4R80 A;  3X3X A;  2IUK A;  1LOV A;  3G0K A;  4FCM A;  1T2H A;  1W6C A;  1LQM B;  3K9M C;  3GSP A;  1NU3 A;  1TRQ A;  5AYS C;  1N8Q A;  1IDP A;  2UX0 A;  1SIH A;  2F98 A;  3URP A;  1IV9 A;  2UGI A;  1RGL A;  1IVW A;  1BRJ A;  1EUI C;  1I70 A;  4WYK B;  5JPP A;  1IK3 A;  1YJN 3;  1I0V A;  1NWW A;  2KRT A;  1ROA A;  1KQS 2;  2C10 A;  3E99 A;  2ZL8 A;  2INX A;  2XFT A;  4J9A A;  2CWV A;  2HMJ B;  3WOE B;  1RGK A;  4N6T A;  4CJN A;  1CYU A;  5AII A;  1YI2 3;  2KXG A;  3CPW 2;  1CH0 A;  1EG9 B;  3GZB A;  3IMA B;  1N8R 4;  1J2B A;  1BRS A;  2Y74 A;  1FUW A;  1O7W B;  1ULI B;  3JUP A;  1DET A;  1TIJ A;  2XGL A;  1O7P B;  3DUK A;  7RNT A;  1F8N A;  2CFG A;  4HKV B;  4RNT A;  1WMN A;  4JRF A;  3VF1 A;  2WOH A;  1DMQ A;  3Q3F A;  4MMY B;  1ZX2 A;  1JNQ A;  3EN8 A;  1OHO A;  1DVC A;  2GU1 A;  3L0R A;  3NUV A;  1VQ8 3;  2JDI H;  2JQ5 A;  1I3F A;  4N6V 0;  1BNS A;  1W02 A;  1CEW I;  2QA4 3;  1B20 A;  2BO9 B;  2OOV C;  2YFJ B;  3CPO A;  5CF1 A;  1JB5 A;  1QAL A;  1LNH A;  4HAA A;  3S27 A;  2CKF B;  3RNT A;  3SVA A;  1OHS A;  3SLU A;  3DM8 A;  3JUO A;  3GZX B;  3NX0 A;  1RN7 A;  2D42 A;  2GXF A;  2CW9 A;  1I0X A;  3F8H A;  3G6E 3;  4HJL B;  3LTA A;  4J5K A;  3RDE A;  2ZA4 A;  1YJ9 3;  1FGO A;  1BSD A;  1BVI A;  1CQS A;  1D6U A;  1OGZ A;  1V58 A;  2OQE A;  3CCQ 3;  1JN5 B;  1GMQ A;  1JRQ A;  4HM1 B;  3CNM A;  1X1U A;  4IPB A;  4H3U A;  1JV2 B;  3LZA A;  1VQP 3;  1OHP A;  2LYX A;  3UL5 A;  3KFQ C;  2CFW A;  4N6O B;  3SXX A;  3EBY A;  3D5G A;  3SYU A;  4CPK A;  1W2B 2;  1W6G A;  2BMQ B;  1S5A A;  4N6N B;  2I9W A;  4GSP A;  3S29 A;  2J8X B;  3JVC A;  1RGC A;  4O2H A;  1EQK A;  1GYB A;  4XDW A;  1GMR A;  1Q40 B;  2FXT A;  3J7Y d;  1IU7 A;  1NO3 A;  2QIY A;  1YGE A;  1RGA A;  1ZS7 A;  3AHS A;  1OH0 A;  1ZO2 A;  1RN4 A;  4HZB B;  3O8Y A;  1HU9 A;  3WA2 X;  2BT3 A;  1VQN 3;  3HOH A;  2CFK A;  3KKG A;  4O02 B;  1G0T A;  5JPU A;  3AGN A;  1IQX A;  2YFL B;  3G8Z A;  1E3V A;  3AMO B;  1DMM A;  3SOY A;  3SX1 A;  2KF6 A;  3EB8 A;  1AV4 A;  2QGU A;  3T8U A;  1A2P A;  2Q07 A;  1VQQ A;  3OWY A;  5D83 A;  5EVH A;  3NBR A;  1NNV A;  4R9L A;  5BIR A;  2QEX 3;  1LRA A;  1BNG A;  1Q81 4;  1BRK A;  4J8T A;  1MWU A;  4EXR A;  4FCZ A;  3ECF A;  1VQ5 3;  1YIJ 3;  1JB4 A;  3PGB A;  2K54 A;  1YGW A;  1VQK 3;  2OWP A;  2Z6B A;  3N9H A;  3LH4 A;  2P38 A;  2LQV A;  1YVS A;  1BSB A;  4MJD A;  5DRE A;  5M1A A;  1RRH A;  3NM2 A;  3LT8 A;  1AVL A;  1FYS A;  1MNL A;  1B3S A;  3KN4 A;  3FG1 A;  3PYJ A;  5ELU A;  3CC4 3;  4GHO A;  1D6Z A;  3DXO A;  3LT9 A;  3KSP A;  6STD A;  4BL3 A;  3FG4 A;  1OUN A;  2BMO B;  3CNX A;  2F5W A;  2GBX B;  5JBS A;  2GSP A;  5IG5 A;  3F9S A;  4L7K A;  2W56 B;  4ZM8 A;  3AMO A;  3EX9 A;  3CCJ 3;  1A67 A;  1RRL A;  2HOH A;  1W5Z A;  2GEY A;  1BU4 A;  3G4S 3;  3CXC 2;  1K8A 4;  5LC7 A;  5G1K A;  1WTH A;  1UUG B;  1BSC A;  1FGM A;  2K0M A;  1RDS A;  4LMI A;  1IVU A;  4NHF A;  3H51 A;  5LC6 A;  3F40 A;  4HM3 B;  1LVN A;  1US1 A;  2CHC A;  2SAR A;  2RNT A;  2FNQ A;  3BNC A;  1BAN A;  1QAK A;  4BIR A;  3NHX A;  1ISK A;  1RGE A;  4HOH A;  1B2M A;  2HMO B;  1STF I;  2MC8 A;  1GSP A;  3DZL A;  2CFL A;  2P05 A;  3CCM 3;  2CWU A;  4QWT A;  4XBY A;  4FMC A;  1B27 A;  2W03 A;  1UCL A;  4K1U A;  2RGQ A;  3K5T A;  2H0H A;  3EQQ B;  3VGN A;  3N8B A;  1NJI 4;  3K0Z A;  4WHA A;  3HZP A;  5DRV A;  4HM0 B;  3UNL A;  5KP3 A;  1JB2 A;  3MG2 A;  4ORL A;  3NQY A;  4EC6 A;  1UUW B;  2P09 A;  2KF3 A;  2RFR A;  3ZFZ A;  1K73 4;  1W2Z A;  3MG1 A;  4WYK A;  4IIA A;  3S28 A;  3WOF B;  6GSP A;  1OF5 B;  2AAE A;  1YNV X;  1TFK A;  3DGL A;  3K7C A;  3KCH A;  1C7H A;  3BLZ A;  2F99 A;  4BL2 A;  1A90 A;  3UB1 A;  1O7H B;  3ZG5 A;  3H3H A;  2WO0 A;  1OAC A;  1JZD A;  4FMD A;  3OX9 A;  2ZHX B;  1FGQ A;  2D1W A;  3D3L A;  1W01 A;  1C54 A;  5HGR A;  4IT7 A;  1RGG A;  1TTO A;  3OW2 2;  1A2V A;  2KAA A;  3LXU X;  2FGT A;  5IG3 A;  7STD A;  1GOY A;  2A15 A;  2XF3 A;  2XFS A;  5IF6 A;  3EC9 A;  1BRI A;  2XH9 A;  1Q7H A;  3GZY B;  4STD A;  1O7M B;  3F7X A;  3OWS A;  2CG0 A;  3D4A A;  1OF5 A;  1UI8 A;  3FSD A;  4I5Q A;  1FZU A;  1G96 A;  3U97 A;  3ZG0 A;  5BU4 A;  3WOD G;  5M18 A;  1QMA A;  2OTJ 3;  5EQL A;  1IVV A;  4KZ1 A;  1FW7 A;  3CCV 3;  1EKM A;  1T2I A;  4HM8 B;  4I4K A;  5AIG A;  7GSP A;  1BRN L;  1I2E A;  3D5I A;  5IEO A;  1AY7 A;  2HMN B;  1UW1 A;  3NV0 B;  4XB5 A;  2B1X B;  1IQY A;  3X40 A;  1LQG C;  1TFO A;  2P0M A;  3GZR A;  1MGR A;  1WQL B;  4EBG A;  1BSA A;  1IQ8 A;  1EA2 A;  2W0Q A;  1DE3 A;  4KFE A;  4R1K A;  2KF5 A;  1G02 A;  4KFD A;  2P0X A;  2F86 B;  5CF2 A;  1FUS A;  4XBX A;  3X42 A;  3SOA A;  3LTC A;  2H0G A;  1LOW A;  2XSO B;  3EJV A;  1BNR A;  3BB9 A;  2XGN A;  1RTU A;  1K41 A;  1JJ2 2;  1VQ9 3;  1WMO A;  1Q40 A;  2L1S A;  3IPT A;  1Q42 A;  3NM7 A;  4N3V A;  4XDV A;  2XSH B;  1Q9E A;  1U8C B;  4BTX A;  2IUJ A;  3CCU 3;  1VQM 3;  2BU4 A;  4TX4 A;  3NV0 A;  1GOV A;  2F56 A;  1LXE A;  2W9Q A;  4HM5 B;  1I3I A;  2ZDJ A;  4PEJ A;  2C11 A;  2GU3 A;  4KT3 B;  3VSY A;  3X3Y A;  5I97 A;  1VQL 3;  1BRH A;  1B2U A;  1M9G A;  1GD3 A;  2IYJ A;  3FF2 A;  4FMA A;  4XBT A;  1GS3 A;  1RGH A;  1RN1 A;  2Z7A A;  1W4N A;  2R41 A;  2WGQ A;  3PZW A;  4OVM A;  4LGQ A; 
#chains in the Genus database with same CATH homology
 3F8X A;  4WFO A;  3CME 3;  5BXQ A;  1OPY A;  2E2U A;  4MEI A;  3GAX A;  4HYZ A;  4Q53 A;  1M1K 4;  5IG4 A;  4BTW A;  3ER7 A;  2W2C A;  3HX8 A;  2KCD A;  2SBL A;  1W6Y A;  2Z77 A;  2W9P A;  3BNB A;  5A0O B;  5STD A;  1GY7 A;  1DVD A;  2RSX A;  4FR9 A;  4FMB A;  3A76 A;  3LYG A;  5AYR B;  1CYV A;  3CCR 3;  4RBN A;  5KP1 A;  1DMN A;  4O8S A;  3T8N A;  4HM7 B;  1FA3 A;  1E3R A;  4L8P A;  4R4K A;  3FH1 A;  5AEW B;  4K90 B;  3M8C A;  2OOV A;  3I55 3;  3EE1 A;  2OQE C;  3B4O A;  3MHE A;  2PNC A;  1T5Y A;  3STD A;  3UJM A;  2BMR B;  2YX9 A;  5CK6 A;  1STD A;  5IG0 A;  3TDG A;  3NXJ A;  1KWI A;  1GD4 A;  2IA7 A;  3CD6 3;  2W04 A;  4AEQ A;  3K63 A;  3X41 A;  3G71 3;  1Z1S A;  3B7C A;  3F7S A;  3MWZ A;  3UL6 A;  1LOX A;  4HBR A;  1IT7 A;  1PU4 A;  1OCV A;  3FGY A;  1A2K A;  3MKI A;  3G16 A;  3S67 A;  3Q2P A;  3N54 B;  8CHO A;  1W7C A;  3EN1 B;  3EHC A;  4MMX B;  4EYC A;  2Z76 A;  1Q7Y 4;  1AR0 A;  3CMA 3;  4AKY A;  2CK3 H;  3JUN A;  3LOY A;  5FW5 A;  2XEP A;  2OTL 3;  5IER A;  1O7G B;  2GBW B;  3EF8 A;  4LSO A;  5CXO A;  1MOL A;  2HML B;  4GB5 A;  2XRX B;  4KVH A;  4HM6 B;  3EBT A;  1IT8 A;  1SPU A;  4LEH A;  1TU5 A;  2CIU A;  1FGT A;  3FF0 A;  1OGX A;  3Q90 A;  5AIH A;  3WDG B;  2MF7 A;  3MPH A;  1K28 A;  4AKZ A;  1R4C A;  2HMK B;  3BND A;  4XM4 A;  3HIG A;  3DY5 A;  4FCJ A;  5IEP A;  2W6J H;  5D82 A;  1HKX A;  3LTD A;  5TGN A;  3CU3 A;  1Q86 4;  1TP6 A;  3B4P A;  3FLJ A;  4L8O A;  3PCS A;  3ROB A;  1FGR A;  1ASK A;  4HZ9 B;  3QK9 A;  1QVG 2;  3V98 A;  1KC8 4;  3DGN A;  3WMD A;  2M7O A;  5IW9 A;  4R9K A;  1UI7 A;  1O7N B;  2E2T A;  4N6M A;  3V99 A;  1BUQ A;  4HVN A;  3CC2 3;  3FKA A;  4HM2 B;  1JKG A;  1IV7 A;  1SQW A;  5CLK A;  3HII A;  2OCT A;  1VQ6 3;  2BNG A;  4EV5 A;  3QRD A;  2L4V A;  3RGR A;  1GY6 A;  3Q1C A;  1VZZ A;  2CWT A;  3MSO A;  3NQZ A;  4EV2 A;  1N9E A;  3MG3 A;  2CFD A;  3CCS 3;  1YVB I;  3JUM A;  1PFP A;  3ALA A;  1DYU A;  1M1X B;  5D81 A;  3FZW A;  1RJO A;  1S72 3;  5AEU B;  3DGO A;  4X2H A;  2ML6 A;  1KSI A;  2O9U X;  5AI1 A;  3F14 A;  1NB5 I;  1D6Y A;  3CC7 3;  1JN5 A;  1JKG B;  1N5P A;  3IJE B;  3KSE D;  1NDO B;  3LTB A;  1UUV B;  3PCR A;  3V92 A;  3NBB A;  5AIF A;  2B24 B;  5KP4 A;  3GWR A;  3KZT A;  3OWU A;  4MMZ B;  3I0Y A;  4U13 A;  1NB3 I;  1WNH A;  3GRD A;  1N9J A;  3HK4 A;  4WP5 A;  1L5G B;  4NRE A;  3SED A;  1YHQ 3;  3FCS B;  1K9M 4;  1RKY A;  4BTY A;  4CCV A;  4RNZ A;  1ULJ B;  1YIT 3;  1GY5 A;  1VQO 3;  5G2G A;  4N6L A;  4KFF A;  3LML A;  1U5O A;  3S5C A;  3T0U A;  3CCL 3;  3OXA A;  1IVX A;  3HI7 A;  1QAF A;  2WGO A;  4N6U A;  4G1M B;  3RGA A;  2ML5 A;  2CC3 A;  4JF8 A;  4GL6 A;  1VQ4 3;  2XR8 B;  1WMP A;  2CH9 A;  3FG3 A;  2O3O A;  3KII A;  4RZM A;  2WOF A;  3PS8 A;  2Y73 A;  2STD A;  3PXM A;  5EEO A;  2CG1 A;  1QJG A;  1TUH A;  2HMM B;  3MYT A;  4OUQ A;  4K61 A;  2V1L A;  3OV4 A;  2BHM A;  4LZI A;  1YJW 3;  4O3V A;  2RCD A;  3X3Z A;  4X2O A;  3NBJ A;  5IEN A;  2PZV A;  3I56 3;  1KD1 4;  2IMJ A;  3JUQ A;  1M90 4;  1ROV A;  3CCE 3;  1QVF 2;  4OK0 A;  1Y4K A;  1AVK A;  2E2V A;  2GEX A;  2R4I A;  2W56 A;  3B8L A;  4WWU C;  5BVB A;  3KE7 A;  3DGM A;  3DMC A;  4HM4 B;  1Q82 4;  3U1W A;  4K1V A;  1SJW A;  1E97 A;  3BNE A;  3WA3 A;  4CDL A;  5FGO A;  1VQ7 3;  1W00 A;  3D9R A;  5ELJ A;  1V74 A;  4RNY A;  2YFI B;  4H61 A;  1SII A;  1N5H A;  4R80 A;  3X3X A;  2IUK A;  3G0K A;  4FCM A;  1W6C A;  3K9M C;  1NU3 A;  5AYS C;  1N8Q A;  1IDP A;  2UX0 A;  1SIH A;  2F98 A;  1IV9 A;  1IVW A;  5JPP A;  4WYK B;  1IK3 A;  1YJN 3;  1KQS 2;  1NWW A;  2KRT A;  1ROA A;  2C10 A;  3E99 A;  2ZL8 A;  2INX A;  2XFT A;  4J9A A;  2CWV A;  2HMJ B;  3WOE B;  1CYU A;  4N6T A;  5AII A;  1YI2 3;  2KXG A;  3CPW 2;  1EG9 B;  3IMA B;  3GZB A;  1N8R 4;  1J2B A;  1FUW A;  2Y74 A;  1O7W B;  1ULI B;  3JUP A;  1TIJ A;  2XGL A;  1O7P B;  3DUK A;  1F8N A;  2CFG A;  4HKV B;  1WMN A;  4JRF A;  3VF1 A;  2WOH A;  1DMQ A;  4MMY B;  1ZX2 A;  1JNQ A;  3EN8 A;  1OHO A;  1DVC A;  2GU1 A;  3L0R A;  3NUV A;  1VQ8 3;  2JDI H;  2JQ5 A;  4N6V 0;  1W02 A;  1CEW I;  2QA4 3;  2BO9 B;  2OOV C;  2YFJ B;  3CPO A;  5CF1 A;  1JB5 A;  1QAL A;  1LNH A;  2CKF B;  3SVA A;  1OHS A;  3SLU A;  3DM8 A;  3JUO A;  3GZX B;  3NX0 A;  1RN7 A;  2D42 A;  2GXF A;  2CW9 A;  3F8H A;  3G6E 3;  4HJL B;  3LTA A;  3RDE A;  1YJ9 3;  1FGO A;  1D6U A;  1CQS A;  1OGZ A;  2OQE A;  3CCQ 3;  1JN5 B;  1JRQ A;  4HM1 B;  3CNM A;  4IPB A;  4H3U A;  1JV2 B;  3LZA A;  1VQP 3;  1OHP A;  2LYX A;  3UL5 A;  3KFQ C;  2CFW A;  4N6O B;  3SXX A;  3EBY A;  1W2B 2;  1W6G A;  2BMQ B;  1S5A A;  4N6N B;  2I9W A;  3S29 A;  3JVC A;  4O2H A;  1EQK A;  1GYB A;  4XDW A;  1Q40 B;  2FXT A;  3J7Y d;  1IU7 A;  1NO3 A;  2QIY A;  1YGE A;  4HZB B;  3S27 A;  1OH0 A;  1ZO2 A;  3O8Y A;  1HU9 A;  3WA2 X;  2BT3 A;  1VQN 3;  3KKG A;  2CFK A;  4O02 B;  5JPU A;  2YFL B;  1IQX A;  3G8Z A;  1E3V A;  3AMO B;  1DMM A;  3SOY A;  3SX1 A;  3EB8 A;  1AV4 A;  2QGU A;  3T8U A;  2Q07 A;  5D83 A;  3OWY A;  5EVH A;  3NBR A;  4R9L A;  2QEX 3;  1Q81 4;  4J8T A;  4EXR A;  1VQ5 3;  4FCZ A;  3ECF A;  1YIJ 3;  1JB4 A;  3PGB A;  2K54 A;  1VQK 3;  2OWP A;  2Z6B A;  3N9H A;  3LH4 A;  2P38 A;  2LQV A;  4MJD A;  5DRE A;  1RRH A;  3NM2 A;  3LT8 A;  1AVL A;  3KN4 A;  1MNL A;  3FG1 A;  3PYJ A;  5ELU A;  3CC4 3;  1D6Z A;  3DXO A;  3LT9 A;  3KSP A;  6STD A;  3FG4 A;  1OUN A;  2BMO B;  3CNX A;  2GBX B;  5JBS A;  5IG5 A;  3F9S A;  4L7K A;  2W56 B;  4ZM8 A;  3AMO A;  3EX9 A;  3CCJ 3;  1A67 A;  1RRL A;  1W5Z A;  2GEY A;  3G4S 3;  3CXC 2;  1K8A 4;  5LC7 A;  1WTH A;  1FGM A;  2K0M A;  4LMI A;  1IVU A;  4NHF A;  3H51 A;  5LC6 A;  3F40 A;  4HM3 B;  1LVN A;  1US1 A;  2CHC A;  3BNC A;  2FNQ A;  1QAK A;  1ISK A;  3NHX A;  2HMO B;  1STF I;  2MC8 A;  3DZL A;  2CFL A;  2P05 A;  3CCM 3;  2CWU A;  4QWT A;  4XBY A;  4FMC A;  2W03 A;  4K1U A;  2RGQ A;  3K5T A;  3EQQ B;  3VGN A;  3N8B A;  1NJI 4;  3K0Z A;  4WHA A;  3HZP A;  5DRV A;  4HM0 B;  3UNL A;  5KP3 A;  1JB2 A;  3MG2 A;  4ORL A;  3NQY A;  4EC6 A;  1UUW B;  2P09 A;  2RFR A;  1K73 4;  1W2Z A;  3MG1 A;  4WYK A;  4IIA A;  3S28 A;  3WOF B;  1OF5 B;  1TFK A;  3DGL A;  3K7C A;  1C7H A;  3BLZ A;  2F99 A;  1A90 A;  3UB1 A;  1O7H B;  3H3H A;  2WO0 A;  1OAC A;  4FMD A;  3OX9 A;  1FGQ A;  2D1W A;  3D3L A;  1W01 A;  5HGR A;  4IT7 A;  3OW2 2;  1A2V A;  3LXU X;  5IG3 A;  2FGT A;  7STD A;  2A15 A;  2XF3 A;  2XFS A;  5IF6 A;  3EC9 A;  2XH9 A;  3GZY B;  4STD A;  1O7M B;  3F7X A;  3OWS A;  2CG0 A;  1OF5 A;  1UI8 A;  3FSD A;  3U97 A;  1G96 A;  3WOD G;  1QMA A;  2OTJ 3;  5EQL A;  1IVV A;  4KZ1 A;  3CCV 3;  1EKM A;  4HM8 B;  4I4K A;  5AIG A;  5IEO A;  2HMN B;  1UW1 A;  3NV0 B;  4XB5 A;  2B1X B;  1IQY A;  3X40 A;  1TFO A;  2P0M A;  3GZR A;  1WQL B;  4EBG A;  1IQ8 A;  1EA2 A;  2W0Q A;  4KFE A;  4R1K A;  4KFD A;  2P0X A;  2F86 B;  5CF2 A;  4XBX A;  3X42 A;  3SOA A;  3LTC A;  2XSO B;  3EJV A;  3BB9 A;  2XGN A;  1K41 A;  1JJ2 2;  1VQ9 3;  1WMO A;  1Q40 A;  3IPT A;  3NM7 A;  1Q42 A;  4N3V A;  4XDV A;  4BTX A;  2XSH B;  1U8C B;  2IUJ A;  3CCU 3;  1VQM 3;  4TX4 A;  3NV0 A;  1LXE A;  2W9Q A;  4HM5 B;  2ZDJ A;  4PEJ A;  2C11 A;  2GU3 A;  3VSY A;  3X3Y A;  5I97 A;  1VQL 3;  1M9G A;  1GD3 A;  3FF2 A;  4FMA A;  4XBT A;  1GS3 A;  2Z7A A;  1W4N A;  2WGQ A;  3PZW A;  4OVM A;  4LGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...