2RSXA

Solution structure of isea, an inhibitor protein of dl-endopeptidases from bacillus subtilis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
GKNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEKGFKDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of IseA, an Inhibitor Protein of DL-Endopeptidases from Bacillus subtilis, Reveals a Novel Fold with a Characteristic Inhibitory Loop
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase inhibitor
molecule keywords Uncharacterized protein yoeB
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16800 Endopep_inhib IseA DL-endopeptidase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.420 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rsxA00
2RSXA
chains in the Genus database with same CATH superfamily
5KP4A 3CCM3 3O8YA 5D83A 1W01A 1UGHI 4FMAA 1YHQ3 2CH9A 4MMXB 4LEHA 1N5PA 3Q1CA 4AKZA 3KE7A 3QRDA 2B1XB 2BMQB 2WOFA 3DXOA 4HM6B 1TIJA 3FH1A 1DMQA 1LQMB 2KF4A 3MG1A 3EN8A 3MG3A 4HZ9B 3TDGA 1OGXA 1UUWB 3DGMA 2P05A 1BRGA 3FF2A 1QMAA 2W0QA 2OQEA 1IVXA 1W6CA 3CCV3 1W2ZA 3G6E3 1IYYA 2OOVA 1SIIA 4LZIA 1K734 1G96A 4JRFA 1MNLA 1X1WA 2BMRB 2GBWB 2Y73A 2Z7AA 2ZDJA 3M8CA 1AR0A 5ELJA 3MHEA 1BNSA 3L0RA 1OHOA 4EYCA 1BRKA 1Q42A 4HM4B 2QA43 4IIAA 3PCSA 3D79A 3SYUA 3N54B 4MMZB 1Q40B 3D5GA 1EKMA 3CC73 1K9M4 1YVSA 3MKIA 4XDVA 5IG0A 2C4BA 1PYLA 3KKGA 2GU1A 3PGBA 5FW5A 2ML5A 1RKYA 4AEQA 1LQGC 2KF6A 4MEIA 2JQ5A 1VZZA 1JKGA 5FGOA 2E2TA 3T8UA 1UI8A 5TGNA 1STDA 2CWTA 1WTHA 2JDIH 4KT3B 1BNFA 3OW22 4DKIA 1A90A 4HJLB 4XBYA 1JN5A 2RNTA 4J5KA 3IPTA 5KP3A 1O7PB 2CX1A 1A2VA 1SIHA 1I0XA 1RRLA 4I4KA 4BTXA 3PYJA 4PEJA 3CXC2 1Q824 1BNJA 5M18A 4L8PA 4LSOA 1EQKA 3OX9A 1RGKA 1X1XA 3G0KA 4KVHA 5BIRA 1BGSA 1K28A 2QEX3 3SVAA 5LC7A 1NB5I 4JF8A 1QAFA 4HAAA 1IV7A 4LGQA 4BU4A 1I8VA 1FGRA 3ECFA 3GSPA 1GOUA 1UUGB 1Q814 3EX9A 1NWWA 1C54A 4AKYA 2IUKA 3DH2A 2OQEC 1ROAA 1W7CA 1OHPA 1I2EA 3DGLA 1YGWA 3EHCA 4RNYA 3SXXA 1Q40A 4L8OA 4HM1B 4G1MB 2ZL8A 4EBGA 2UUGC 4K61A 1RN1A 1BIRA 3OWSA 1UW1A 4XDWA 2YFIB 3GWRA 4ZM8A 1MOLA 3LTCA 3GZRA 2CG0A 4K1UA 5G2GA 2CFGA 1PFPA 3GZYB 1JKGB 5GSPA 1DE3A 1WMPA 4HM2B 3ER7A 2BNGA 2BT3A 2GEYA 2YFLB 3FLJA 4IT7A 3LT9A 1AQZA 3X3ZA 1O7GB 4R1KA 3D4AA 3OWUA 1BSEA 1R4YA 1T3BA 4GHOA 5I97A 1GY6A 2KRTA 3FZWA 3G8ZA 3JUMA 4N6MA 1GMPA 2O3OA 1BNEA 2CFDA 2XGNA 3HK4A 3MSOA 4CDLA 1VQM3 2XH9A 3CPW2 2RBIA 4NPBA 3SOYA 1GSPA 3MG2A 2XSOB 1LVNA 2RSXA 2XFTA 1S5AA 1TTOA 2F99A 3K5TA 4FR9A 3WOEB 3D9RA 3UL6A 1VQ63 1UCKA 3OWYA 1WQLB 3EJVA 4MMYB 2B24B 1MWTA 5G1LA 1E97A 4KFEA 4HBRA 1B27A 1RTUA 1I70A 3Q90A 5HGRA 1ULIB 5LC6A 6STDA 5ELUA 1HU9A 5CXOA 2E2VA 5D81A 3STDA 3GZBA 4XB5A 8CHOA 3S27A 4RBNA 1BSBA 1SPUA 3CCL3 3URPA 2O9UX 3H51A 1LRAA 2AADA 5IW9A 2F98A 3F14A 1BRIA 1V74A 4R4KA 1O7HB 1T2HA 1RGAA 2W6JH 4I5QA 2KF5A 2CFWA 5CK6A 1VQ83 2CWUA 1IT8A 1ROVA 2GBXB 4NHFA 1BRNL 2L4VA 3DGNA 1Q7Y4 3CC43 2BU4A 4K1VA 1RN4A 2BIRA 3EF8A 1SJWA 1CEWI 4H61A 2K54A 2KF3A 3WODG 4BL3A 1B20A 2K3DA 3AHWA 1UCIA 3F7XA 3RGRA 4HZBB 2CFLA 1LOYA 3G4S3 1BU4A 2HMLB 4GSPA 2INXA 2H0GA 3CCU3 4J8TA 2D1WA 1YNVX 2WGQA 3AMOB 1K8A4 1OACA 2QIYA 3N9HA 1UUVB 2PZVA 1YIT3 5CF1A 1RGLA 1VQP3 3CME3 1I2GA 3CMA3 1ISKA 8RNTA 5DRVA 3D3LA 1RCLA 1RNTA 4N6TA 2QGUA 2IYJA 2CIUA 1US1A 1I2FA 1U5OA 3CNXA 4FCZA 5AYRB 1M9GA 3S67A 2IA7A 2GU3A 1LOWA 2IY2A 1JV2B 2SBLA 1RGEA 1IDPA 2XR8B 3HOHA 3VGNA 3X42A 1U8CB 2A15A 3UNLA 5RNTA 3KZTA 2P09A 2XFSA 3FG1A 1E3RA 3EQQB 2XF3A 1OGZA 1ZGXA 4BIRA 3CCQ3 4CPKA 1VQ43 1BSCA 1CH0A 4FCMA 3GZXB 4BTYA 5IG4A 5JBSA 1Y4KA 2F5MA 3BB9A 2HMMB 1KWIA 1FGMA 2C11A 2KCDA 1EA2A 3LTBA 4IPBA 1TJDA 3NV0B 1N5HA 1A2PA 3K9MC 4HKVB 4N6LA 3AGNA 1I0VA 3H3HA 3FCSB 4N6NB 2W03A 5D82A 1KC84 1GMQA 3DGOA 5IEPA 2W9QA 1D6ZA 1GD3A 1MWSA 4FCJA 1VQK3 5A0OB 1VQ73 4J9AA 1UCJA 1FYSA 4CCVA 1YGEA 1YJN3 3BIRA 3FG3A 1BOXA 4EV2A 1WMOA 2OWPA 4STDA 5AIIA 5EEOA 1UCLA 3GRDA 1BANA 4QWTA 1JB4A 2AAEA 3OV4A 3DMCA 1BUQA 1BNIA 1F8NA 1MGRA 2C10A 3RDEA 3X41A 1B2XA 3E99A 5M19A 1W02A 4O2HA 1WMNA 1JB5A 2XSHB 1Q864 3UJMA 3MWZA 4U13A 1IVVA 2K0MA 2OOVC 3K7CA 3SEDA 1W00A 5JPPA 1RSNA 3EBYA 3KSED 1TFOA 2YX9A 2KXGA 4R80A 2H0HA 1DYUA 3LOYA 2F56A 2W04A 2Z77A 1LOVA 2FXTA 5AIFA 1DMMA 3BNCA 1JBSA 1Q7HA 2P0MA 3S5CA 4Q53A 1ZO2A 3N8BA 2J8XB 3F9SA 5DREA 4EW5A 6GSPA 3I563 2E2UA 3BNEA 2RGQA 1EG9B 1NDOB 2LYXA 3B4PA 3CCS3 4TX4A 3LH4A 1V58A 3WA2X 3NQYA 2PNCA 3LXUX 3F8HA 1RMSA 3LYGA 4OK0A 1AVKA 5CLKA 3CCR3 2CKFB 3U1WA 3F8XA 5IF6A 3NM7A 2MF7A 1W6YA 5KP1A 3WA3A 4H3UA 3J7Yd 1FW7A 1IQXA 1L5GB 3FGYA 1T5YA 3HZPA 2W56A 2Y74A 3NM2A 2KAAA 4ILFA 3RGAA 1N9EA 3S28A 3B4OA 1BVIA 1W6GA 4XBTA 3D5IA 3K0ZA 3WR2A 2CG1A 4OUQA 2CW9A 1C7HA 1BNRA 1B2ZA 3NV0A 3HX8A 5IEOA 4HM0B 1TRPA 1RLSA 5AEWB 7GSPA 1O7NB 2UGIA 2WOHA 3KN4A 2GSPA 1NNVA 4HM5B 2CFKA 3KFQC 4KFFA 1RGFA 2F4YA 3T8NA 2ML6A 1AY7A 1GY7A 1B3SA 2XRXB 1KSIA 3DY5A 1BRJA 3LMLA 3MYTA 3Q3FA 1VQ93 2R41A 4HM8B 2H0IA 4X2HA 2Q07A 3A76A 1ULJB 1UGIA 1G02A 1JBRA 3G713 2CWVA 1SQWA 4KZ1A 9RNTA 1YJ93 5M1AA 3DZLA 4BL2A 4N3VA 1UDII 4K90B 1VQ53 4RZMA 1S723 3CC23 2GXFA 2GEXA 1M1K4 2IMJA 3BNBA 3CNMA 2CX0A 3ZG5A 3BU4A 3IJEB 3FSDA 1PY3A 1EEJA 1GS3A 7STDA 2P38A 1OF5B 3AMOA 3PCRA 4WYKA 1IK3A 1FUTA 1CYVA 1W4NA 2FNQA 5STDA 3FKAA 4LYLB 1KD14 1GOYA 3CPOA 3K63A 1QALA 3MPHA 3BLZA 1MGWA 4RNZA 1GY5A 3EN1B 3NBRA 3NXJA 1BNGA 4GB5A 4WWUC 1STFI 3FG4A 3HIGA 2P0XA 3IMAB 2MC8A 1B2SA 5IERA 1YIJ3 1FUSA 1YVBI 1DMNA 1NU3A 1HZ1A 1BRHA 4HOHA 4R9KA 1ASKA 1CYUA 1OPYA 4WP5A 2HOHA 4XBXA 3B7CA 1QVG2 3V92A 4EV5A 1PU4A 1V57A 3VF1A 1W5ZA 4LMIA 5IENA 1GD4A 1YI23 3UB1A 3LT8A 2Z76A 4WFOA 1M904 1JRQA 1E3VA 4XM4A 1BRSA 3NBBA 2WO0A 3ALAA 3Q2PA 1OCVA 1TFKA 1BSAA 3CU3A 1DETA 1BAOA 1A67A 5AI1A 1LOXA 1FZUA 5JPUA 3WOFB 3JUOA 5IG3A 1DVCA 4J5GA 4NREA 3KCHA 4O02B 4FMBA 3I553 1DVDA 1N8QA 3NBJA 3PZWA 5BXQA 1OH0A 4KFDA 2STDA 2LQVA 2OTL3 1MWUA 2RFRA 1BSDA 3NHXA 1N8R4 1UI7A 3EE1A 1TU5A 2CHCA 2OCTA 3WMDA 3B8LA 1RNBA 3ZFZA 3EB8A 2XGLA 3PS8A 1O7MB 3F40A 4N6UA 1IV9A 4HVNA 1M1XB 1TRQA 3FF0A 1Z1SA 1ZS7A 1AVLA 4BTWA 2WGOA 3F7SA 3A5EA 5AIGA 1GYBA 1AV4A 5AYSC 5IG5A 3NX0A 4WHAA 3CD63 1FGOA 1EUIC 5EVHA 1RN7A 1IQ8A 3LTAA 4N6OB 3PXMA 1QAKA 1Q9EA 4MJDA 3JUPA 3EBTA 3AGOA 1FA3A 3AHSA 1VQL3 1FGTA 7RNTA 1NJI4 2YFJB 1MWRA 4FMDA 3BNDA 3GAXA 3X3XA 1T2IA 3G16A 2SARA 2UX0A 1A2KA 2F86B 2I9WA 4RNTA 3WDGB 2W9PA 3NUVA 1HKXA 4O8SA 3SLUA 2BMOB 3U97A 5AIHA 5BVBA 3RNTA 3CCE3 1W2B2 4R9LA 1RGGA 2IUJA 3OXAA 5HOHA 3SOAA 2OTJ3 3T0UA 1G0TA 3LZAA 3KIIA 1VQO3 1YJW3 1B2MA 2BHMA 1FUWA 1RCKA 1RHLA 1GOVA 2W2CA 1RJOA 1D6YA 2HMJB 3I0YA 4OVMA 2HMNB 4N6V0 3X3YA 2D42A 1RDSA 1O7WB 1IVWA 1ZX2A 1JZDA 1JZOA 1RGHA 3JVCA 3UL5A 1KQS2 3DM8A 1B2UA 3V99A 1D6UA 3X40A 1TUHA 1VQN3 1IU7A 1B21A 3KSPA 2HMKB 1HYFA 6RNTA 5CF2A 2F5WA 4EXRA 2V1LA 1WNHA 1OF5A 1JJ22 1JNQA 1N9JA 2CC3A 4HM7B 4ORLA 4WYKB 1IQYA 1FGQA 3EC9A 1LXEA 2HMOB 5EQLA 1CQSA 1NO3A 1I3IA 4EC6A 3DGYA 3VSYA 1GMRA 3JUQA 2ZHXB 3V98A 3ROBA 1JB2A 2L1SA 2M7OA 4HYZA 5AEUB 3CCJ3 4CJNA 2XEPA 5BU4A 3HIIA 1TP6A 1LNIA 1NB3I 1SARA 1X1UA 2W56B 3WHOA 1K41A 1JBTA 1I3FA 1X1YA 2Z6BA 5G1KA 1QJGA 4O3VA 1IT7A 1LNHA 3JUNA 3S29A 2BO9B 1J2BA 1OHSA 3NQZA 3HI7A 1OUNA 2RCDA 1RRHA 1QVF2 4L7KA 2R4IA 2ZA4A 4FMCA 1BUJA 3QK9A 2CK3H 2FGTA 1R4CA 4GL6A 3LTDA 4HM3B 3SX1A 3ZG0A 4X2OA 1VQQA 1JN5B 3DUKA 1IVUA 1RGCA
chains in the Genus database with same CATH topology
5KP4A 3CCM3 3O8YA 5D83A 1W01A 4FMAA 1YHQ3 2CH9A 4MMXB 4LEHA 1N5PA 3Q1CA 4AKZA 3KE7A 3QRDA 2B1XB 2BMQB 3DXOA 2WOFA 4HM6B 1TIJA 3FH1A 1DMQA 3MG1A 3EN8A 3MG3A 4HZ9B 3TDGA 1OGXA 1UUWB 3DGMA 2P05A 3FF2A 1QMAA 2W0QA 2OQEA 1IVXA 1W6CA 3CCV3 1W2ZA 3G6E3 2OOVA 1SIIA 4LZIA 1K734 1G96A 4JRFA 1MNLA 2BMRB 2GBWB 2Y73A 2Z7AA 2ZDJA 3M8CA 1AR0A 5ELJA 3MHEA 3L0RA 1OHOA 4EYCA 1Q42A 4HM4B 2QA43 4IIAA 3PCSA 3N54B 4MMZB 1Q40B 1EKMA 3CC73 1K9M4 4XDVA 3MKIA 5IG0A 3KKGA 2GU1A 3PGBA 5FW5A 2ML5A 1RKYA 4AEQA 4MEIA 2JQ5A 1VZZA 1JKGA 5FGOA 2E2TA 3T8UA 1UI8A 5TGNA 1STDA 2CWTA 1WTHA 2JDIH 3OW22 1A90A 4HJLB 4XBYA 1JN5A 3IPTA 5KP3A 1O7PB 1A2VA 1SIHA 1RRLA 4I4KA 4BTXA 3PYJA 4PEJA 3CXC2 1Q824 4L8PA 4LSOA 1EQKA 3OX9A 4KVHA 3G0KA 2QEX3 1K28A 3SVAA 5LC7A 1NB5I 4JF8A 1QAFA 4LGQA 1IV7A 3ECFA 1FGRA 1Q814 3EX9A 1NWWA 4AKYA 2IUKA 2OQEC 1ROAA 1W7CA 1OHPA 3DGLA 3EHCA 4RNYA 3SXXA 1Q40A 4L8OA 4HM1B 4G1MB 2ZL8A 4EBGA 4K61A 3OWSA 1UW1A 4XDWA 2YFIB 3GWRA 4ZM8A 1MOLA 3LTCA 3GZRA 2CG0A 4K1UA 5G2GA 2CFGA 1PFPA 3GZYB 1JKGB 1WMPA 4HM2B 3ER7A 2BNGA 2BT3A 2GEYA 2YFLB 3FLJA 4IT7A 3LT9A 3X3ZA 1O7GB 4R1KA 3OWUA 5I97A 1GY6A 2KRTA 3FZWA 3G8ZA 3JUMA 4N6MA 2O3OA 2XGNA 4CDLA 2CFDA 3HK4A 3MSOA 1VQM3 2XH9A 3CPW2 3SOYA 3MG2A 2XSOB 1LVNA 2RSXA 2XFTA 1S5AA 3K5TA 2F99A 4FR9A 3WOEB 1W2B2 3D9RA 3UL6A 1VQ63 3OWYA 1WQLB 3EJVA 4MMYB 2B24B 1E97A 4KFEA 4HBRA 5HGRA 3Q90A 5LC6A 1ULIB 6STDA 5ELUA 1HU9A 5CXOA 2E2VA 5D81A 3STDA 3GZBA 4XB5A 8CHOA 3S27A 4RBNA 1SPUA 3CCL3 2O9UX 3H51A 5IW9A 2F98A 3F14A 1V74A 4R4KA 1O7HB 2W6JH 5CK6A 2CFWA 1VQ83 2CWUA 1IT8A 1ROVA 2GBXB 4NHFA 2L4VA 3DGNA 1Q7Y4 3CC43 4K1VA 3EF8A 1SJWA 1CEWI 4H61A 2K54A 3WODG 3F7XA 3RGRA 4HZBB 2CFLA 3G4S3 2HMLB 2INXA 3CCU3 4J8TA 2D1WA 2WGQA 3AMOB 1K8A4 1OACA 2QIYA 3N9HA 1UUVB 2PZVA 1YIT3 5CF1A 1VQP3 3CME3 3CMA3 1ISKA 5DRVA 3D3LA 4N6TA 2QGUA 2CIUA 1US1A 1U5OA 3S67A 3CNXA 4FCZA 5AYRB 1M9GA 2IA7A 2GU3A 1JV2B 2SBLA 1IDPA 2XR8B 3VGNA 3X42A 1U8CB 2A15A 3UNLA 3KZTA 2P09A 2XFSA 3FG1A 1E3RA 3EQQB 2XF3A 1OGZA 3CCQ3 1VQ43 4FCMA 5IG4A 3GZXB 4BTYA 5JBSA 1Y4KA 3BB9A 2HMMB 1KWIA 1FGMA 2C11A 2KCDA 1EA2A 3LTBA 4IPBA 3NV0B 1N5HA 3K9MC 4HKVB 4N6LA 5D82A 3H3HA 3FCSB 4N6NB 2W03A 1KC84 3DGOA 5IEPA 2W9QA 1D6ZA 1GD3A 1VQK3 4FCJA 1VQ73 5A0OB 4J9AA 4CCVA 1YGEA 1YJN3 3FG3A 4EV2A 1WMOA 2OWPA 4STDA 5AIIA 5EEOA 3GRDA 4QWTA 1JB4A 3OV4A 3DMCA 1BUQA 1F8NA 2C10A 3RDEA 3X41A 3E99A 1W02A 4O2HA 1WMNA 1JB5A 2XSHB 1Q864 3UJMA 3MWZA 4U13A 1IVVA 2OOVC 2K0MA 3K7CA 3SEDA 1W00A 5JPPA 3EBYA 3KSED 1TFOA 2YX9A 2KXGA 4R80A 1DYUA 3LOYA 2W04A 2Z77A 2FXTA 5AIFA 1DMMA 3BNCA 3S5CA 2P0MA 4Q53A 1ZO2A 3N8BA 3F9SA 5DREA 3I563 2E2UA 3BNEA 2RGQA 1EG9B 1NDOB 2LYXA 3B4PA 3CCS3 4TX4A 3LH4A 3WA2X 3NQYA 2PNCA 3LXUX 3F8HA 3LYGA 4OK0A 1AVKA 5CLKA 3CCR3 2CKFB 3U1WA 3F8XA 5IF6A 3NM7A 2MF7A 1W6YA 5KP1A 3WA3A 4H3UA 3J7Yd 1IQXA 1L5GB 3FGYA 1T5YA 3HZPA 2W56A 2Y74A 3NM2A 3RGAA 1N9EA 3S28A 3B4OA 1W6GA 4XBTA 3K0ZA 2CG1A 4OUQA 2CW9A 1C7HA 3NV0A 3HX8A 5IEOA 4HM0B 5AEWB 1O7NB 2WOHA 3KN4A 4HM5B 2CFKA 3KFQC 4KFFA 3T8NA 2ML6A 1GY7A 3DY5A 2XRXB 3LMLA 1KSIA 4XBXA 3MYTA 1VQ93 4HM8B 4X2HA 2Q07A 3A76A 1ULJB 3G713 2CWVA 1SQWA 4KZ1A 1YJ93 3DZLA 4N3VA 1VQ53 4K90B 4RZMA 1S723 3CC23 2GXFA 2GEXA 1M1K4 2IMJA 3BNBA 3CNMA 3IJEB 3FSDA 1GS3A 7STDA 2P38A 1OF5B 3AMOA 3PCRA 4WYKA 1IK3A 1CYVA 1W4NA 2FNQA 5STDA 3FKAA 1KD14 3K63A 3CPOA 1QALA 3MPHA 3BLZA 4RNZA 1GY5A 3EN1B 3NBRA 3NXJA 4GB5A 4WWUC 1STFI 3FG4A 3HIGA 2P0XA 3IMAB 2MC8A 5IERA 1YIJ3 1YVBI 1DMNA 1NU3A 1CYUA 4R9KA 1ASKA 1OPYA 4WP5A 3B7CA 1QVG2 3V92A 4EV5A 1PU4A 3VF1A 1W5ZA 4LMIA 5IENA 1GD4A 1YI23 3UB1A 3LT8A 2Z76A 4WFOA 1M904 1JRQA 1E3VA 4XM4A 3NBBA 2WO0A 3ALAA 3Q2PA 1OCVA 1TFKA 3CU3A 1A67A 5AI1A 1LOXA 5JPUA 3WOFB 3JUOA 5IG3A 1DVCA 4NREA 4O02B 4FMBA 3I553 1DVDA 1N8QA 3NBJA 3PZWA 5BXQA 1OH0A 4KFDA 2STDA 2LQVA 2OTL3 2RFRA 3NHXA 1N8R4 1UI7A 3EE1A 1TU5A 2CHCA 2OCTA 3WMDA 3B8LA 3EB8A 2XGLA 3PS8A 1O7MB 3F40A 4N6UA 1IV9A 4HVNA 1M1XB 3FF0A 1Z1SA 1AVLA 4BTWA 2WGOA 3F7SA 5AIGA 5AYSC 1GYBA 1AV4A 5IG5A 3NX0A 4WHAA 3CD63 1FGOA 5EVHA 1RN7A 1IQ8A 3LTAA 4N6OB 3PXMA 1QAKA 4MJDA 3JUPA 3EBTA 1FA3A 1VQL3 1FGTA 1NJI4 2YFJB 4FMDA 3BNDA 3GAXA 3X3XA 3G16A 3WDGB 2UX0A 1A2KA 2F86B 2I9WA 2W9PA 3NUVA 1HKXA 4O8SA 3SLUA 2BMOB 3U97A 5AIHA 5BVBA 3CCE3 4R9LA 2IUJA 2OTJ3 3OXAA 3SOAA 3T0UA 3LZAA 3KIIA 1VQO3 1YJW3 2BHMA 1FUWA 2W2CA 1RJOA 1D6YA 2HMJB 3I0YA 4OVMA 2HMNB 4N6V0 3X3YA 2D42A 1O7WB 1IVWA 1ZX2A 3JVCA 1KQS2 3UL5A 3DM8A 3V99A 1D6UA 3X40A 1TUHA 1VQN3 1IU7A 3KSPA 2HMKB 5CF2A 4EXRA 2V1LA 1WNHA 1OF5A 1JJ22 1JNQA 1N9JA 2CC3A 4HM7B 4ORLA 4WYKB 1IQYA 1FGQA 3EC9A 1LXEA 2HMOB 5EQLA 1CQSA 1NO3A 4EC6A 3VSYA 3JUQA 3V98A 3ROBA 1JB2A 2M7OA 4HYZA 5AEUB 3CCJ3 2XEPA 3HIIA 1TP6A 1NB3I 2W56B 1K41A 2Z6BA 1QJGA 4O3VA 1IT7A 1LNHA 3JUNA 3S29A 2BO9B 1J2BA 1OHSA 3NQZA 3HI7A 1OUNA 2RCDA 1RRHA 1QVF2 4L7KA 2R4IA 4FMCA 3QK9A 2CK3H 2FGTA 1R4CA 4GL6A 3LTDA 4HM3B 3SX1A 4X2OA 1JN5B 3DUKA 1IVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSX A; 
#chains in the Genus database with same CATH topology
 5KP4 A;  3CCM 3;  3O8Y A;  5D83 A;  1W01 A;  1UGH I;  4FMA A;  1YHQ 3;  2CH9 A;  4MMX B;  4LEH A;  1N5P A;  3Q1C A;  4AKZ A;  3KE7 A;  3QRD A;  2B1X B;  2BMQ B;  2WOF A;  3DXO A;  4HM6 B;  1TIJ A;  3FH1 A;  1DMQ A;  1LQM B;  2KF4 A;  3MG1 A;  3EN8 A;  3MG3 A;  4HZ9 B;  3TDG A;  1OGX A;  1UUW B;  3DGM A;  2P05 A;  1BRG A;  3FF2 A;  1QMA A;  2W0Q A;  2OQE A;  1IVX A;  1W6C A;  3CCV 3;  1W2Z A;  3G6E 3;  1IYY A;  2OOV A;  1SII A;  4LZI A;  1K73 4;  1G96 A;  4JRF A;  1MNL A;  1X1W A;  2BMR B;  2GBW B;  2Y73 A;  2Z7A A;  2ZDJ A;  3M8C A;  1AR0 A;  5ELJ A;  3MHE A;  1BNS A;  3L0R A;  1OHO A;  4EYC A;  1BRK A;  1Q42 A;  4HM4 B;  2QA4 3;  4IIA A;  3PCS A;  3D79 A;  3SYU A;  3N54 B;  4MMZ B;  1Q40 B;  3D5G A;  1EKM A;  3CC7 3;  1K9M 4;  1YVS A;  3MKI A;  4XDV A;  5IG0 A;  2C4B A;  1PYL A;  3KKG A;  2GU1 A;  3PGB A;  5FW5 A;  2ML5 A;  1RKY A;  4AEQ A;  1LQG C;  2KF6 A;  4MEI A;  2JQ5 A;  1VZZ A;  1JKG A;  5FGO A;  2E2T A;  3T8U A;  1UI8 A;  5TGN A;  1STD A;  2CWT A;  1WTH A;  2JDI H;  4KT3 B;  1BNF A;  3OW2 2;  4DKI A;  1A90 A;  4HJL B;  4XBY A;  1JN5 A;  2RNT A;  4J5K A;  3IPT A;  5KP3 A;  1O7P B;  2CX1 A;  1A2V A;  1SIH A;  1I0X A;  1RRL A;  4I4K A;  4BTX A;  3PYJ A;  4PEJ A;  3CXC 2;  1Q82 4;  1BNJ A;  5M18 A;  4L8P A;  4LSO A;  1EQK A;  3OX9 A;  1RGK A;  1X1X A;  3G0K A;  4KVH A;  5BIR A;  1BGS A;  1K28 A;  2QEX 3;  3SVA A;  5LC7 A;  1NB5 I;  4JF8 A;  1QAF A;  4HAA A;  1IV7 A;  4LGQ A;  4BU4 A;  1I8V A;  1FGR A;  3ECF A;  3GSP A;  1GOU A;  1UUG B;  1Q81 4;  3EX9 A;  1NWW A;  1C54 A;  4AKY A;  2IUK A;  3DH2 A;  2OQE C;  1ROA A;  1W7C A;  1OHP A;  1I2E A;  3DGL A;  1YGW A;  3EHC A;  4RNY A;  3SXX A;  1Q40 A;  4L8O A;  4HM1 B;  4G1M B;  2ZL8 A;  4EBG A;  2UUG C;  4K61 A;  1RN1 A;  1BIR A;  3OWS A;  1UW1 A;  4XDW A;  2YFI B;  3GWR A;  4ZM8 A;  1MOL A;  3LTC A;  3GZR A;  2CG0 A;  4K1U A;  5G2G A;  2CFG A;  1PFP A;  3GZY B;  1JKG B;  5GSP A;  1DE3 A;  1WMP A;  4HM2 B;  3ER7 A;  2BNG A;  2BT3 A;  2GEY A;  2YFL B;  3FLJ A;  4IT7 A;  3LT9 A;  1AQZ A;  3X3Z A;  1O7G B;  4R1K A;  3D4A A;  3OWU A;  1BSE A;  1R4Y A;  1T3B A;  4GHO A;  5I97 A;  1GY6 A;  2KRT A;  3FZW A;  3G8Z A;  3JUM A;  4N6M A;  1GMP A;  2O3O A;  1BNE A;  2CFD A;  2XGN A;  3HK4 A;  3MSO A;  4CDL A;  1VQM 3;  2XH9 A;  3CPW 2;  2RBI A;  4NPB A;  3SOY A;  1GSP A;  3MG2 A;  2XSO B;  1LVN A;  2RSX A;  2XFT A;  1S5A A;  1TTO A;  2F99 A;  3K5T A;  4FR9 A;  3WOE B;  3D9R A;  3UL6 A;  1VQ6 3;  1UCK A;  3OWY A;  1WQL B;  3EJV A;  4MMY B;  2B24 B;  1MWT A;  5G1L A;  1E97 A;  4KFE A;  4HBR A;  1B27 A;  1RTU A;  1I70 A;  3Q90 A;  5HGR A;  1ULI B;  5LC6 A;  6STD A;  5ELU A;  1HU9 A;  5CXO A;  2E2V A;  5D81 A;  3STD A;  3GZB A;  4XB5 A;  8CHO A;  3S27 A;  4RBN A;  1BSB A;  1SPU A;  3CCL 3;  3URP A;  2O9U X;  3H51 A;  1LRA A;  2AAD A;  5IW9 A;  2F98 A;  3F14 A;  1BRI A;  1V74 A;  4R4K A;  1O7H B;  1T2H A;  1RGA A;  2W6J H;  4I5Q A;  2KF5 A;  2CFW A;  5CK6 A;  1VQ8 3;  2CWU A;  1IT8 A;  1ROV A;  2GBX B;  4NHF A;  1BRN L;  2L4V A;  3DGN A;  1Q7Y 4;  3CC4 3;  2BU4 A;  4K1V A;  1RN4 A;  2BIR A;  3EF8 A;  1SJW A;  1CEW I;  4H61 A;  2K54 A;  2KF3 A;  3WOD G;  4BL3 A;  1B20 A;  2K3D A;  3AHW A;  1UCI A;  3F7X A;  3RGR A;  4HZB B;  2CFL A;  1LOY A;  3G4S 3;  1BU4 A;  2HML B;  4GSP A;  2INX A;  2H0G A;  3CCU 3;  4J8T A;  2D1W A;  1YNV X;  2WGQ A;  3AMO B;  1K8A 4;  1OAC A;  2QIY A;  3N9H A;  1UUV B;  2PZV A;  1YIT 3;  5CF1 A;  1RGL A;  1VQP 3;  3CME 3;  1I2G A;  3CMA 3;  1ISK A;  8RNT A;  5DRV A;  3D3L A;  1RCL A;  1RNT A;  4N6T A;  2QGU A;  2IYJ A;  2CIU A;  1US1 A;  1I2F A;  1U5O A;  3CNX A;  4FCZ A;  5AYR B;  1M9G A;  3S67 A;  2IA7 A;  2GU3 A;  1LOW A;  2IY2 A;  1JV2 B;  2SBL A;  1RGE A;  1IDP A;  2XR8 B;  3HOH A;  3VGN A;  3X42 A;  1U8C B;  2A15 A;  3UNL A;  5RNT A;  3KZT A;  2P09 A;  2XFS A;  3FG1 A;  1E3R A;  3EQQ B;  2XF3 A;  1OGZ A;  1ZGX A;  4BIR A;  3CCQ 3;  4CPK A;  1VQ4 3;  1BSC A;  1CH0 A;  4FCM A;  3GZX B;  4BTY A;  5IG4 A;  5JBS A;  1Y4K A;  2F5M A;  3BB9 A;  2HMM B;  1KWI A;  1FGM A;  2C11 A;  2KCD A;  1EA2 A;  3LTB A;  4IPB A;  1TJD A;  3NV0 B;  1N5H A;  1A2P A;  3K9M C;  4HKV B;  4N6L A;  3AGN A;  1I0V A;  3H3H A;  3FCS B;  4N6N B;  2W03 A;  5D82 A;  1KC8 4;  1GMQ A;  3DGO A;  5IEP A;  2W9Q A;  1D6Z A;  1GD3 A;  1MWS A;  4FCJ A;  1VQK 3;  5A0O B;  1VQ7 3;  4J9A A;  1UCJ A;  1FYS A;  4CCV A;  1YGE A;  1YJN 3;  3BIR A;  3FG3 A;  1BOX A;  4EV2 A;  1WMO A;  2OWP A;  4STD A;  5AII A;  5EEO A;  1UCL A;  3GRD A;  1BAN A;  4QWT A;  1JB4 A;  2AAE A;  3OV4 A;  3DMC A;  1BUQ A;  1BNI A;  1F8N A;  1MGR A;  2C10 A;  3RDE A;  3X41 A;  1B2X A;  3E99 A;  5M19 A;  1W02 A;  4O2H A;  1WMN A;  1JB5 A;  2XSH B;  1Q86 4;  3UJM A;  3MWZ A;  4U13 A;  1IVV A;  2K0M A;  2OOV C;  3K7C A;  3SED A;  1W00 A;  5JPP A;  1RSN A;  3EBY A;  3KSE D;  1TFO A;  2YX9 A;  2KXG A;  4R80 A;  2H0H A;  1DYU A;  3LOY A;  2F56 A;  2W04 A;  2Z77 A;  1LOV A;  2FXT A;  5AIF A;  1DMM A;  3BNC A;  1JBS A;  1Q7H A;  2P0M A;  3S5C A;  4Q53 A;  1ZO2 A;  3N8B A;  2J8X B;  3F9S A;  5DRE A;  4EW5 A;  6GSP A;  3I56 3;  2E2U A;  3BNE A;  2RGQ A;  1EG9 B;  1NDO B;  2LYX A;  3B4P A;  3CCS 3;  4TX4 A;  3LH4 A;  1V58 A;  3WA2 X;  3NQY A;  2PNC A;  3LXU X;  3F8H A;  1RMS A;  3LYG A;  4OK0 A;  1AVK A;  5CLK A;  3CCR 3;  2CKF B;  3U1W A;  3F8X A;  5IF6 A;  3NM7 A;  2MF7 A;  1W6Y A;  5KP1 A;  3WA3 A;  4H3U A;  3J7Y d;  1FW7 A;  1IQX A;  1L5G B;  3FGY A;  1T5Y A;  3HZP A;  2W56 A;  2Y74 A;  3NM2 A;  2KAA A;  4ILF A;  3RGA A;  1N9E A;  3S28 A;  3B4O A;  1BVI A;  1W6G A;  4XBT A;  3D5I A;  3K0Z A;  3WR2 A;  2CG1 A;  4OUQ A;  2CW9 A;  1C7H A;  1BNR A;  1B2Z A;  3NV0 A;  3HX8 A;  5IEO A;  4HM0 B;  1TRP A;  1RLS A;  5AEW B;  7GSP A;  1O7N B;  2UGI A;  2WOH A;  3KN4 A;  2GSP A;  1NNV A;  4HM5 B;  2CFK A;  3KFQ C;  4KFF A;  1RGF A;  2F4Y A;  3T8N A;  2ML6 A;  1AY7 A;  1GY7 A;  1B3S A;  2XRX B;  1KSI A;  3DY5 A;  1BRJ A;  3LML A;  3MYT A;  3Q3F A;  1VQ9 3;  2R41 A;  4HM8 B;  2H0I A;  4X2H A;  2Q07 A;  3A76 A;  1ULJ B;  1UGI A;  1G02 A;  1JBR A;  3G71 3;  2CWV A;  1SQW A;  4KZ1 A;  9RNT A;  1YJ9 3;  5M1A A;  3DZL A;  4BL2 A;  4N3V A;  1UDI I;  4K90 B;  1VQ5 3;  4RZM A;  1S72 3;  3CC2 3;  2GXF A;  2GEX A;  1M1K 4;  2IMJ A;  3BNB A;  3CNM A;  2CX0 A;  3ZG5 A;  3BU4 A;  3IJE B;  3FSD A;  1PY3 A;  1EEJ A;  1GS3 A;  7STD A;  2P38 A;  1OF5 B;  3AMO A;  3PCR A;  4WYK A;  1IK3 A;  1FUT A;  1CYV A;  1W4N A;  2FNQ A;  5STD A;  3FKA A;  4LYL B;  1KD1 4;  1GOY A;  3CPO A;  3K63 A;  1QAL A;  3MPH A;  3BLZ A;  1MGW A;  4RNZ A;  1GY5 A;  3EN1 B;  3NBR A;  3NXJ A;  1BNG A;  4GB5 A;  4WWU C;  1STF I;  3FG4 A;  3HIG A;  2P0X A;  3IMA B;  2MC8 A;  1B2S A;  5IER A;  1YIJ 3;  1FUS A;  1YVB I;  1DMN A;  1NU3 A;  1HZ1 A;  1BRH A;  4HOH A;  4R9K A;  1ASK A;  1CYU A;  1OPY A;  4WP5 A;  2HOH A;  4XBX A;  3B7C A;  1QVG 2;  3V92 A;  4EV5 A;  1PU4 A;  1V57 A;  3VF1 A;  1W5Z A;  4LMI A;  5IEN A;  1GD4 A;  1YI2 3;  3UB1 A;  3LT8 A;  2Z76 A;  4WFO A;  1M90 4;  1JRQ A;  1E3V A;  4XM4 A;  1BRS A;  3NBB A;  2WO0 A;  3ALA A;  3Q2P A;  1OCV A;  1TFK A;  1BSA A;  3CU3 A;  1DET A;  1BAO A;  1A67 A;  5AI1 A;  1LOX A;  1FZU A;  5JPU A;  3WOF B;  3JUO A;  5IG3 A;  1DVC A;  4J5G A;  4NRE A;  3KCH A;  4O02 B;  4FMB A;  3I55 3;  1DVD A;  1N8Q A;  3NBJ A;  3PZW A;  5BXQ A;  1OH0 A;  4KFD A;  2STD A;  2LQV A;  2OTL 3;  1MWU A;  2RFR A;  1BSD A;  3NHX A;  1N8R 4;  1UI7 A;  3EE1 A;  1TU5 A;  2CHC A;  2OCT A;  3WMD A;  3B8L A;  1RNB A;  3ZFZ A;  3EB8 A;  2XGL A;  3PS8 A;  1O7M B;  3F40 A;  4N6U A;  1IV9 A;  4HVN A;  1M1X B;  1TRQ A;  3FF0 A;  1Z1S A;  1ZS7 A;  1AVL A;  4BTW A;  2WGO A;  3F7S A;  3A5E A;  5AIG A;  1GYB A;  1AV4 A;  5AYS C;  5IG5 A;  3NX0 A;  4WHA A;  3CD6 3;  1FGO A;  1EUI C;  5EVH A;  1RN7 A;  1IQ8 A;  3LTA A;  4N6O B;  3PXM A;  1QAK A;  1Q9E A;  4MJD A;  3JUP A;  3EBT A;  3AGO A;  1FA3 A;  3AHS A;  1VQL 3;  1FGT A;  7RNT A;  1NJI 4;  2YFJ B;  1MWR A;  4FMD A;  3BND A;  3GAX A;  3X3X A;  1T2I A;  3G16 A;  2SAR A;  2UX0 A;  1A2K A;  2F86 B;  2I9W A;  4RNT A;  3WDG B;  2W9P A;  3NUV A;  1HKX A;  4O8S A;  3SLU A;  2BMO B;  3U97 A;  5AIH A;  5BVB A;  3RNT A;  3CCE 3;  1W2B 2;  4R9L A;  1RGG A;  2IUJ A;  3OXA A;  5HOH A;  3SOA A;  2OTJ 3;  3T0U A;  1G0T A;  3LZA A;  3KII A;  1VQO 3;  1YJW 3;  1B2M A;  2BHM A;  1FUW A;  1RCK A;  1RHL A;  1GOV A;  2W2C A;  1RJO A;  1D6Y A;  2HMJ B;  3I0Y A;  4OVM A;  2HMN B;  4N6V 0;  3X3Y A;  2D42 A;  1RDS A;  1O7W B;  1IVW A;  1ZX2 A;  1JZD A;  1JZO A;  1RGH A;  3JVC A;  3UL5 A;  1KQS 2;  3DM8 A;  1B2U A;  3V99 A;  1D6U A;  3X40 A;  1TUH A;  1VQN 3;  1IU7 A;  1B21 A;  3KSP A;  2HMK B;  1HYF A;  6RNT A;  5CF2 A;  2F5W A;  4EXR A;  2V1L A;  1WNH A;  1OF5 A;  1JJ2 2;  1JNQ A;  1N9J A;  2CC3 A;  4HM7 B;  4ORL A;  4WYK B;  1IQY A;  1FGQ A;  3EC9 A;  1LXE A;  2HMO B;  5EQL A;  1CQS A;  1NO3 A;  1I3I A;  4EC6 A;  3DGY A;  3VSY A;  1GMR A;  3JUQ A;  2ZHX B;  3V98 A;  3ROB A;  1JB2 A;  2L1S A;  2M7O A;  4HYZ A;  5AEU B;  3CCJ 3;  4CJN A;  2XEP A;  5BU4 A;  3HII A;  1TP6 A;  1LNI A;  1NB3 I;  1SAR A;  1X1U A;  2W56 B;  3WHO A;  1K41 A;  1JBT A;  1I3F A;  1X1Y A;  2Z6B A;  5G1K A;  1QJG A;  4O3V A;  1IT7 A;  1LNH A;  3JUN A;  3S29 A;  2BO9 B;  1J2B A;  1OHS A;  3NQZ A;  3HI7 A;  1OUN A;  2RCD A;  1RRH A;  1QVF 2;  4L7K A;  2R4I A;  2ZA4 A;  4FMC A;  1BUJ A;  3QK9 A;  2CK3 H;  2FGT A;  1R4C A;  4GL6 A;  3LTD A;  4HM3 B;  3SX1 A;  3ZG0 A;  4X2O A;  1VQQ A;  1JN5 B;  3DUK A;  1IVU A;  1RGC A; 
#chains in the Genus database with same CATH homology
 5KP4 A;  3CCM 3;  3O8Y A;  5D83 A;  1W01 A;  4FMA A;  1YHQ 3;  2CH9 A;  4MMX B;  4LEH A;  1N5P A;  3Q1C A;  4AKZ A;  3KE7 A;  3QRD A;  2B1X B;  2BMQ B;  3DXO A;  2WOF A;  4HM6 B;  1TIJ A;  3FH1 A;  1DMQ A;  3MG1 A;  3EN8 A;  3MG3 A;  4HZ9 B;  3TDG A;  1OGX A;  1UUW B;  3DGM A;  2P05 A;  3FF2 A;  1QMA A;  2W0Q A;  2OQE A;  1IVX A;  1W6C A;  3CCV 3;  1W2Z A;  3G6E 3;  2OOV A;  1SII A;  4LZI A;  1K73 4;  1G96 A;  4JRF A;  1MNL A;  2BMR B;  2GBW B;  2Y73 A;  2Z7A A;  2ZDJ A;  3M8C A;  1AR0 A;  5ELJ A;  3MHE A;  3L0R A;  1OHO A;  4EYC A;  1Q42 A;  4HM4 B;  2QA4 3;  4IIA A;  3PCS A;  3N54 B;  4MMZ B;  1Q40 B;  1EKM A;  3CC7 3;  1K9M 4;  4XDV A;  3MKI A;  5IG0 A;  3KKG A;  2GU1 A;  3PGB A;  5FW5 A;  2ML5 A;  1RKY A;  4AEQ A;  4MEI A;  2JQ5 A;  1VZZ A;  1JKG A;  5FGO A;  2E2T A;  3T8U A;  1UI8 A;  5TGN A;  1STD A;  2CWT A;  1WTH A;  2JDI H;  3OW2 2;  1A90 A;  4HJL B;  4XBY A;  1JN5 A;  3IPT A;  5KP3 A;  1O7P B;  1A2V A;  1SIH A;  1RRL A;  4I4K A;  4BTX A;  3PYJ A;  4PEJ A;  3CXC 2;  1Q82 4;  4L8P A;  4LSO A;  1EQK A;  3OX9 A;  4KVH A;  3G0K A;  2QEX 3;  1K28 A;  3SVA A;  5LC7 A;  1NB5 I;  4JF8 A;  1QAF A;  4LGQ A;  1IV7 A;  3ECF A;  1FGR A;  1Q81 4;  3EX9 A;  1NWW A;  4AKY A;  2IUK A;  2OQE C;  1ROA A;  1W7C A;  1OHP A;  3DGL A;  3EHC A;  4RNY A;  3SXX A;  1Q40 A;  4L8O A;  4HM1 B;  4G1M B;  2ZL8 A;  4EBG A;  4K61 A;  3OWS A;  1UW1 A;  4XDW A;  2YFI B;  3GWR A;  4ZM8 A;  1MOL A;  3LTC A;  3GZR A;  2CG0 A;  4K1U A;  5G2G A;  2CFG A;  1PFP A;  3GZY B;  1JKG B;  1WMP A;  4HM2 B;  3ER7 A;  2BNG A;  2BT3 A;  2GEY A;  2YFL B;  3FLJ A;  4IT7 A;  3LT9 A;  3X3Z A;  1O7G B;  4R1K A;  3OWU A;  5I97 A;  1GY6 A;  2KRT A;  3FZW A;  3G8Z A;  3JUM A;  4N6M A;  2O3O A;  2XGN A;  4CDL A;  2CFD A;  3HK4 A;  3MSO A;  1VQM 3;  2XH9 A;  3CPW 2;  3SOY A;  3MG2 A;  2XSO B;  1LVN A;  2RSX A;  2XFT A;  1S5A A;  3K5T A;  2F99 A;  4FR9 A;  3WOE B;  1W2B 2;  3D9R A;  3UL6 A;  1VQ6 3;  3OWY A;  1WQL B;  3EJV A;  4MMY B;  2B24 B;  1E97 A;  4KFE A;  4HBR A;  5HGR A;  3Q90 A;  5LC6 A;  1ULI B;  6STD A;  5ELU A;  1HU9 A;  5CXO A;  2E2V A;  5D81 A;  3STD A;  3GZB A;  4XB5 A;  8CHO A;  3S27 A;  4RBN A;  1SPU A;  3CCL 3;  2O9U X;  3H51 A;  5IW9 A;  2F98 A;  3F14 A;  1V74 A;  4R4K A;  1O7H B;  2W6J H;  5CK6 A;  2CFW A;  1VQ8 3;  2CWU A;  1IT8 A;  1ROV A;  2GBX B;  4NHF A;  2L4V A;  3DGN A;  1Q7Y 4;  3CC4 3;  4K1V A;  3EF8 A;  1SJW A;  1CEW I;  4H61 A;  2K54 A;  3WOD G;  3F7X A;  3RGR A;  4HZB B;  2CFL A;  3G4S 3;  2HML B;  2INX A;  3CCU 3;  4J8T A;  2D1W A;  2WGQ A;  3AMO B;  1K8A 4;  1OAC A;  2QIY A;  3N9H A;  1UUV B;  2PZV A;  1YIT 3;  5CF1 A;  1VQP 3;  3CME 3;  3CMA 3;  1ISK A;  5DRV A;  3D3L A;  4N6T A;  2QGU A;  2CIU A;  1US1 A;  1U5O A;  3S67 A;  3CNX A;  4FCZ A;  5AYR B;  1M9G A;  2IA7 A;  2GU3 A;  1JV2 B;  2SBL A;  1IDP A;  2XR8 B;  3VGN A;  3X42 A;  1U8C B;  2A15 A;  3UNL A;  3KZT A;  2P09 A;  2XFS A;  3FG1 A;  1E3R A;  3EQQ B;  2XF3 A;  1OGZ A;  3CCQ 3;  1VQ4 3;  4FCM A;  5IG4 A;  3GZX B;  4BTY A;  5JBS A;  1Y4K A;  3BB9 A;  2HMM B;  1KWI A;  1FGM A;  2C11 A;  2KCD A;  1EA2 A;  3LTB A;  4IPB A;  3NV0 B;  1N5H A;  3K9M C;  4HKV B;  4N6L A;  5D82 A;  3H3H A;  3FCS B;  4N6N B;  2W03 A;  1KC8 4;  3DGO A;  5IEP A;  2W9Q A;  1D6Z A;  1GD3 A;  1VQK 3;  4FCJ A;  1VQ7 3;  5A0O B;  4J9A A;  4CCV A;  1YGE A;  1YJN 3;  3FG3 A;  4EV2 A;  1WMO A;  2OWP A;  4STD A;  5AII A;  5EEO A;  3GRD A;  4QWT A;  1JB4 A;  3OV4 A;  3DMC A;  1BUQ A;  1F8N A;  2C10 A;  3RDE A;  3X41 A;  3E99 A;  1W02 A;  4O2H A;  1WMN A;  1JB5 A;  2XSH B;  1Q86 4;  3UJM A;  3MWZ A;  4U13 A;  1IVV A;  2OOV C;  2K0M A;  3K7C A;  3SED A;  1W00 A;  5JPP A;  3EBY A;  3KSE D;  1TFO A;  2YX9 A;  2KXG A;  4R80 A;  1DYU A;  3LOY A;  2W04 A;  2Z77 A;  2FXT A;  5AIF A;  1DMM A;  3BNC A;  3S5C A;  2P0M A;  4Q53 A;  1ZO2 A;  3N8B A;  3F9S A;  5DRE A;  3I56 3;  2E2U A;  3BNE A;  2RGQ A;  1EG9 B;  1NDO B;  2LYX A;  3B4P A;  3CCS 3;  4TX4 A;  3LH4 A;  3WA2 X;  3NQY A;  2PNC A;  3LXU X;  3F8H A;  3LYG A;  4OK0 A;  1AVK A;  5CLK A;  3CCR 3;  2CKF B;  3U1W A;  3F8X A;  5IF6 A;  3NM7 A;  2MF7 A;  1W6Y A;  5KP1 A;  3WA3 A;  4H3U A;  3J7Y d;  1IQX A;  1L5G B;  3FGY A;  1T5Y A;  3HZP A;  2W56 A;  2Y74 A;  3NM2 A;  3RGA A;  1N9E A;  3S28 A;  3B4O A;  1W6G A;  4XBT A;  3K0Z A;  2CG1 A;  4OUQ A;  2CW9 A;  1C7H A;  3NV0 A;  3HX8 A;  5IEO A;  4HM0 B;  5AEW B;  1O7N B;  2WOH A;  3KN4 A;  4HM5 B;  2CFK A;  3KFQ C;  4KFF A;  3T8N A;  2ML6 A;  1GY7 A;  3DY5 A;  2XRX B;  3LML A;  1KSI A;  4XBX A;  3MYT A;  1VQ9 3;  4HM8 B;  4X2H A;  2Q07 A;  3A76 A;  1ULJ B;  3G71 3;  2CWV A;  1SQW A;  4KZ1 A;  1YJ9 3;  3DZL A;  4N3V A;  1VQ5 3;  4K90 B;  4RZM A;  1S72 3;  3CC2 3;  2GXF A;  2GEX A;  1M1K 4;  2IMJ A;  3BNB A;  3CNM A;  3IJE B;  3FSD A;  1GS3 A;  7STD A;  2P38 A;  1OF5 B;  3AMO A;  3PCR A;  4WYK A;  1IK3 A;  1CYV A;  1W4N A;  2FNQ A;  5STD A;  3FKA A;  1KD1 4;  3K63 A;  3CPO A;  1QAL A;  3MPH A;  3BLZ A;  4RNZ A;  1GY5 A;  3EN1 B;  3NBR A;  3NXJ A;  4GB5 A;  4WWU C;  1STF I;  3FG4 A;  3HIG A;  2P0X A;  3IMA B;  2MC8 A;  5IER A;  1YIJ 3;  1YVB I;  1DMN A;  1NU3 A;  1CYU A;  4R9K A;  1ASK A;  1OPY A;  4WP5 A;  3B7C A;  1QVG 2;  3V92 A;  4EV5 A;  1PU4 A;  3VF1 A;  1W5Z A;  4LMI A;  5IEN A;  1GD4 A;  1YI2 3;  3UB1 A;  3LT8 A;  2Z76 A;  4WFO A;  1M90 4;  1JRQ A;  1E3V A;  4XM4 A;  3NBB A;  2WO0 A;  3ALA A;  3Q2P A;  1OCV A;  1TFK A;  3CU3 A;  1A67 A;  5AI1 A;  1LOX A;  5JPU A;  3WOF B;  3JUO A;  5IG3 A;  1DVC A;  4NRE A;  4O02 B;  4FMB A;  3I55 3;  1DVD A;  1N8Q A;  3NBJ A;  3PZW A;  5BXQ A;  1OH0 A;  4KFD A;  2STD A;  2LQV A;  2OTL 3;  2RFR A;  3NHX A;  1N8R 4;  1UI7 A;  3EE1 A;  1TU5 A;  2CHC A;  2OCT A;  3WMD A;  3B8L A;  3EB8 A;  2XGL A;  3PS8 A;  1O7M B;  3F40 A;  4N6U A;  1IV9 A;  4HVN A;  1M1X B;  3FF0 A;  1Z1S A;  1AVL A;  4BTW A;  2WGO A;  3F7S A;  5AIG A;  5AYS C;  1GYB A;  1AV4 A;  5IG5 A;  3NX0 A;  4WHA A;  3CD6 3;  1FGO A;  5EVH A;  1RN7 A;  1IQ8 A;  3LTA A;  4N6O B;  3PXM A;  1QAK A;  4MJD A;  3JUP A;  3EBT A;  1FA3 A;  1VQL 3;  1FGT A;  1NJI 4;  2YFJ B;  4FMD A;  3BND A;  3GAX A;  3X3X A;  3G16 A;  3WDG B;  2UX0 A;  1A2K A;  2F86 B;  2I9W A;  2W9P A;  3NUV A;  1HKX A;  4O8S A;  3SLU A;  2BMO B;  3U97 A;  5AIH A;  5BVB A;  3CCE 3;  4R9L A;  2IUJ A;  2OTJ 3;  3OXA A;  3SOA A;  3T0U A;  3LZA A;  3KII A;  1VQO 3;  1YJW 3;  2BHM A;  1FUW A;  2W2C A;  1RJO A;  1D6Y A;  2HMJ B;  3I0Y A;  4OVM A;  2HMN B;  4N6V 0;  3X3Y A;  2D42 A;  1O7W B;  1IVW A;  1ZX2 A;  3JVC A;  1KQS 2;  3UL5 A;  3DM8 A;  3V99 A;  1D6U A;  3X40 A;  1TUH A;  1VQN 3;  1IU7 A;  3KSP A;  2HMK B;  5CF2 A;  4EXR A;  2V1L A;  1WNH A;  1OF5 A;  1JJ2 2;  1JNQ A;  1N9J A;  2CC3 A;  4HM7 B;  4ORL A;  4WYK B;  1IQY A;  1FGQ A;  3EC9 A;  1LXE A;  2HMO B;  5EQL A;  1CQS A;  1NO3 A;  4EC6 A;  3VSY A;  3JUQ A;  3V98 A;  3ROB A;  1JB2 A;  2M7O A;  4HYZ A;  5AEU B;  3CCJ 3;  2XEP A;  3HII A;  1TP6 A;  1NB3 I;  2W56 B;  1K41 A;  2Z6B A;  1QJG A;  4O3V A;  1IT7 A;  1LNH A;  3JUN A;  3S29 A;  2BO9 B;  1J2B A;  1OHS A;  3NQZ A;  3HI7 A;  1OUN A;  2RCD A;  1RRH A;  1QVF 2;  4L7K A;  2R4I A;  4FMC A;  3QK9 A;  2CK3 H;  2FGT A;  1R4C A;  4GL6 A;  3LTD A;  4HM3 B;  3SX1 A;  4X2O A;  1JN5 B;  3DUK A;  1IVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...