3LTDA

X-ray structure of a non-biological atp binding protein determined at 2.8 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltdA00
3LT9A 3LT8A 2P09A 3LTBA 3LTCA 2P05A 3LTAA 1UW1A 2P0XA 3DGNA 3DGOA 3DGMA 3LTDA 3DGLA
chains in the Genus database with same CATH superfamily
3S5CA 3CCJ3 4J9AA 3G8ZA 1M904 1A2KA 1PFPA 3HIGA 1VQO3 2CHCA 1UI7A 5IEPA 4XDVA 3UL5A 2IYJA 4BIRA 3LT8A 4LMIA 5CF1A 3VGNA 4WP5A 1JN5A 1OH0A 3HI7A 1CYVA 3F8HA 4GSPA 1V74A 5FGOA 4HM2B 3CNMA 3VF1A 3B4OA 2OQEA 1RKYA 4R1KA 4K1UA 2W56B 3I0YA 3RNTA 2ZA4A 1QVG2 1IVUA 1KSIA 1J2BA 1VQ53 1IVVA 1RN1A 3CD63 2W9PA 4OUQA 2LQVA 3WMDA 1BGSA 1N8QA 1RN7A 1I3IA 1O7HB 2CH9A 3EB8A 6GSPA 1DETA 3G16A 2B1XB 3D79A 1LRAA 2CWUA 4HKVB 1B2MA 3EC9A 1SARA 1JB5A 1LQMB 1WTHA 3F9SA 1BSDA 1BSEA 2F5WA 2ZDJA 4RBNA 3RGRA 3F7XA 1GSPA 2K54A 3CCV3 1JJ22 2KF3A 2LYXA 4GL6A 4HM3B 1YJ93 2RBIA 4N6LA 1DYUA 1I0XA 3ZFZA 1UGIA 1E3RA 2KXGA 3MWZA 5G2GA 1D6YA 3EX9A 1FUTA 4GB5A 4BL3A 1FGMA 1PYLA 3BNEA 1BNRA 1E97A 1GD3A 2KF6A 1BNEA 1JB2A 1UCIA 3X42A 1OHPA 4MMZB 3SLUA 1CYUA 3AMOB 5D82A 1VQ63 3LH4A 1V57A 3AGOA 3V92A 1WMPA 2XH9A 3GZXB 1IQYA 3H3HA 3CCL3 3OX9A 1W6GA 1MWTA 4EW5A 2W56A 2OOVA 1UUGB 2OQEC 1W7CA 2CC3A 4RNZA 1UUWB 5AI1A 2IMJA 2IUKA 3CCE3 1RSNA 3S28A 1QAKA 1M1XB 3KE7A 4ORLA 3FG3A 5AYRB 3WODG 1I2FA 3NX0A 3J7Yd 1VQK3 1AQZA 3K9MC 5AYSC 1BNSA 5AEWB 3ZG0A 3CC43 2F98A 2UGIA 4L7KA 1IVXA 7RNTA 1YJW3 1JBSA 4X2OA 3EJVA 1JZOA 4MEIA 7GSPA 1PU4A 1VQ83 2BMQB 1M1K4 3IMAB 3CPOA 3GAXA 3ALAA 1K9M4 3FSDA 3KZTA 1GS3A 4HZ9B 1Y4KA 3UNLA 3Q90A 2R41A 2P38A 3NBRA 2W9QA 3G0KA 3X3XA 1DVDA 1DMMA 1K28A 2BMOB 5AIHA 3AMOA 4MMYB 1RGAA 4EV2A 2D1WA 2GXFA 1BU4A 1CEWI 4HAAA 2UX0A 5AEUB 3SXXA 1QMAA 2BMRB 1BSCA 1NWWA 3BLZA 1Q40B 3G4S3 1NU3A 3OWUA 1JNQA 4NHFA 2OWPA 4FMDA 4R80A 2WOFA 2Z76A 3GRDA 3DGMA 1IV9A 3FGYA 1JZDA 2WGOA 1D6UA 4K1VA 3GZYB 3MPHA 2CWTA 1W6CA 1ZX2A 3BIRA 1TIJA 3CCR3 1YJN3 3HX8A 2W2CA 1B2SA 3FCSB 3NQZA 2E2UA 3UL6A 1W2B2 1ULJB 1SQWA 3K7CA 3KSPA 4LSOA 2XRXB 4R4KA 3NM7A 2CG1A 1Q9EA 2HMKB 1KQS2 5DRVA 4FCJA 3BU4A 3NQYA 1I2EA 1CH0A 3PCSA 4L8PA 3NXJA 2CX1A 1VQM3 1BSAA 6STDA 3DMCA 3QRDA 2P09A 3CNXA 3ROBA 5HGRA 5RNTA 1BRIA 3Q2PA 4R9LA 1A2PA 2F99A 2H0IA 2GU3A 2L1SA 3OXAA 4LYLB 2K0MA 3IJEB 1IDPA 1A67A 1FGTA 1FGQA 1YVSA 2CFWA 5IG4A 1Q40A 4RNYA 1UGHI 3LT9A 1GOYA 4RNTA 1RGKA 3CPW2 1DE3A 1DVCA 2CFGA 1IQXA 1IYYA 4H3UA 4KFDA 1G96A 3DGOA 2HMMB 3DGLA 1GOVA 3Q1CA 1Q864 2AADA 4XM4A 1IV7A 4J5GA 1RNTA 2QIYA 3M8CA 3T0UA 3A5EA 2XSOB 1O7PB 3PGBA 4JRFA 1BNJA 3F40A 1W00A 2OTL3 2BO9B 1VQN3 1FZUA 2F56A 1AY7A 3FG1A 1BNIA 1T5YA 4QWTA 4WFOA 1YGEA 3FZWA 1B3SA 2BU4A 4HBRA 1LOWA 1G02A 1OCVA 5IG3A 3DZLA 1Q824 4O3VA 5BVBA 3N54B 4EV5A 2F86B 3X41A 5BU4A 1K8A4 1FGOA 2CIUA 4K90B 1RGFA 1GYBA 3V98A 3X3ZA 1A90A 5AIGA 1O7WB 2GEYA 1Z1SA 2L4VA 4IIAA 6RNTA 7STDA 2SBLA 5D81A 4R9KA 4WWUC 2F5MA 1W5ZA 3FKAA 5M1AA 1IU7A 1DMQA 3MG2A 3D5IA 1BIRA 1D6ZA 1STDA 5A0OB 5IENA 1GMPA 3PS8A 3HZPA 1O7MB 2IUJA 2HMJB 1VQ73 1YNVX 3GWRA 2B24B 3D9RA 1OHOA 5KP3A 1LQGC 1BANA 3EBYA 5G1KA 3F8XA 2JDIH 3OV4A 5LC6A 1R4CA 2P05A 2XEPA 4HM5B 3B8LA 2XFSA 1LNHA 1V58A 1G0TA 3GZBA 3HIIA 2WOHA 3BNBA 3EBTA 3JVCA 1I70A 4HM0B 2QA43 2BHMA 1VQQA 2W04A 3MKIA 4N6UA 2Q07A 2C10A 3EHCA 2YX9A 1TU5A 1FYSA 1HZ1A 3KN4A 2GEXA 3QK9A 1IQ8A 1ROVA 3X3YA 3NBBA 1TP6A 3LTBA 1STFI 3U97A 1OUNA 2YFIB 1N5HA 1RGHA 3G713 4G1MB 1BAOA 1LVNA 2CFKA 3B7CA 1EEJA 1GY7A 4IT7A 4XB5A 4MJDA 5LC7A 1KD14 4U13A 2C11A 5GSPA 1TFKA 1FGRA 3ECFA 4O8SA 3WA3A 8CHOA 3DY5A 4IPBA 5IG5A 1AR0A 4EXRA 3CME3 1NJI4 3NBJA 1BRGA 4N6MA 1UCJA 1WNHA 4BL2A 3FF2A 1Q814 1OPYA 1U5OA 1KWIA 1JB4A 1W02A 3EQQB 1RN4A 5FW5A 3UB1A 1GY6A 3A76A 1RGGA 1N9EA 1NB5I 1S723 3EF8A 3FF0A 3WR2A 4GHOA 4AKYA 5ELUA 2KF5A 1ISKA 1RNBA 2I9WA 1HKXA 1M9GA 2CX0A 4J8TA 4AKZA 4KZ1A 3OW22 3NHXA 1OF5B 1BRJA 1O7NB 1Q42A 3JUPA 2OOVC 4O02B 1UCKA 2F4YA 3K5TA 4HZBB 3WOEB 1BRSA 1ZGXA 1T2IA 3D5GA 1GMQA 1NNVA 3Q3FA 1WQLB 1GD4A 5EEOA 2HOHA 1BSBA 1LXEA 1WMOA 4KVHA 2Z7AA 2ML5A 1UI8A 3SOYA 3S27A 2RNTA 3NUVA 3SYUA 3DM8A 3WOFB 3X40A 1S5AA 4WHAA 3TDGA 2INXA 1YVBI 2OTJ3 3SVAA 4EYCA 3BB9A 3N8BA 1GY5A 4CJNA 4ILFA 1IVWA 5ELJA 1BUQA 2XSHB 2ML6A 3JUQA 1JV2B 2O3OA 2XGNA 1EQKA 2O9UX 8RNTA 1C54A 1OHSA 1HYFA 1TFOA 2OCTA 1ASKA 1I2GA 2HMLB 3LYGA 5STDA 3URPA 4N3VA 2Z77A 3KFQC 9RNTA 3SEDA 5I97A 5JBSA 3FG4A 5M18A 3NM2A 2CG0A 2FXTA 1NB3I 5CK6A 3DXOA 1OF5A 1RMSA 3DGYA 1RJOA 4LEHA 3JUOA 4BTXA 1F8NA 1AV4A 1A2VA 4FR9A 3O8YA 4CDLA 2P0MA 2XGLA 1OACA 5CLKA 1NDOB 3DH2A 1FUSA 3BNDA 1BRHA 3GZRA 1FUWA 4CPKA 1UDII 4CCVA 4HOHA 4LGQA 3H51A 3RDEA 1BRNL 3LZAA 5KP4A 4BTYA 2WO0A 4WYKB 1W2ZA 2XF3A 1RGCA 1MNLA 4K61A 1DMNA 1MWRA 4I4KA 4AEQA 1B21A 1W4NA 2GBXB 2PZVA 3STDA 1EKMA 3KSED 3N9HA 3I553 1NO3A 2KF4A 2D42A 3T8NA 1JKGB 3LTCA 1U8CB 3HOHA 4HM6B 4L8OA 1YI23 5JPPA 1ULIB 4BTWA 2IY2A 3FH1A 3U1WA 5IG0A 4NREA 1B2XA 1AVKA 1MWUA 1RCKA 1SIHA 3OWSA 3OWYA 1K734 1B2UA 1I0VA 1MGRA 2P0XA 4KT3B 4HVNA 1PY3A 2ZHXB 4KFFA 5AIIA 2AAEA 3CCU3 5EQLA 2KRTA 4N6OB 3CXC2 3KIIA 3S67A 1I8VA 4HJLB 1UW1A 1ZS7A 1TJDA 4EC6A 2YFLB 1FW7A 1LOYA 1UCLA 1RTUA 1E3VA 1T3BA 3MG1A 1X1WA 3WDGB 3CMA3 2XFTA 5G1LA 2YFJB 3JUMA 1B2ZA 1QJGA 4EBGA 1LOXA 4HM1B 1VQL3 4FCZA 2W0QA 4STDA 1N9JA 1EA2A 3V99A 4WYKA 1K41A 4MMXB 5JPUA 1L5GB 4N6TA 2JQ5A 3G6E3 1YIJ3 1T2HA 1BRKA 1X1UA 2E2VA 2UUGC 4J5KA 3VSYA 3AHSA 1Q7Y4 1TTOA 2Y73A 1GMRA 1JKGA 2FNQA 5D83A 2M7OA 1X1YA 3CU3A 4OVMA 4ZM8A 5CF2A 2CFLA 3LMLA 3MHEA 1RGEA 2H0HA 3DUKA 4X2HA 5BIRA 1IK3A 1GOUA 1B27A 1YGWA 4XBXA 1BNFA 2SARA 1OGZA 3K0ZA 2XR8B 1AVLA 5HOHA 1RDSA 5EVHA 3F7SA 1RLSA 3HK4A 2J8XB 3LXUX 1VQP3 1FA3A 1VZZA 3NV0B 2KCDA 3KCHA 3PXMA 2GBWB 1BUJA 4XDWA 3S29A 1JRQA 1UUVB 3IPTA 3ER7A 4I5QA 1HU9A 3ZG5A 1VQ43 4O2HA 4FMCA 4TX4A 3CCQ3 3D3LA 1B20A 1TUHA 1W6YA 2CFDA 2W03A 4XBTA 3WHOA 2E2TA 5CXOA 2BIRA 4LZIA 3CC23 1JBTA 2RGQA 2RSXA 4HM8B 4N6NB 1X1XA 2PNCA 2R4IA 2K3DA 2WGQA 3FLJA 1BOXA 1R4YA 3PZWA 5BXQA 2RFRA 2ZL8A 1QVF2 5IERA 2GU1A 1EG9B 3PCRA 4XBYA 1YHQ3 1Q7HA 1QALA 3CCS3 2CK3H 2V1LA 4JF8A 3LTDA 3T8UA 1JBRA 2CKFB 3L0RA 3PYJA 5AIFA 3AHWA 5DREA 1IT8A 3KKGA 5KP1A 3NV0A 1TRPA 4NPBA 2QEX3 4PEJA 5TGNA 4HM7B 5IEOA 4DKIA 2A15A 1IT7A 3GSPA 3K63A 4FMBA 3BNCA 4H61A 1US1A 3EN8A 1MOLA 1OGXA 5M19A 2MF7A 2RCDA 4N6V0 1RHLA 4RZMA 1TRQA 2BT3A 3EE1A 4FCMA 1RCLA 3CC73 1WMNA 1N8R4 3MSOA 1EUIC 3AGNA 4HYZA 2FGTA 3F14A 2H0GA 4BU4A 2CWVA 1JN5B 1MWSA 4FMAA 3CCM3 1MGWA 4KFEA 2Y74A 3MG3A 3SX1A 4OK0A 1BNGA 3SOAA 1W01A 1C7HA 3LTAA 3DGNA 3UJMA 2KAAA 5IF6A 5IW9A 3E99A 1BVIA 1QAFA 1RRHA 1SIIA 2GSPA 2HMNB 2HMOB 2Z6BA 1LOVA 1CQSA 1RRLA 2STDA 3JUNA 3WA2X 1VQ93 1I3FA 2MC8A 3EN1B 2C4BA 2QGUA 1KC84 1SJWA 3I563 3MYTA 3RGAA 2CW9A 1ROAA 4Q53A 4HM4B 3LOYA 1YIT3 1N5PA 1ZO2A 2W6JH 3D4AA 1SPUA 2IA7A 3B4PA 1RGLA 1O7GB 2BNGA 1LNIA
chains in the Genus database with same CATH topology
3S5CA 3CCJ3 4J9AA 3G8ZA 1M904 1A2KA 1PFPA 3HIGA 1VQO3 2CHCA 1UI7A 5IEPA 4XDVA 3UL5A 3LT8A 4LMIA 5CF1A 3VGNA 4WP5A 1JN5A 1OH0A 3HI7A 1CYVA 3F8HA 1V74A 5FGOA 4HM2B 3CNMA 3VF1A 3B4OA 2OQEA 1RKYA 4R1KA 4K1UA 2W56B 3I0YA 1J2BA 1QVG2 1IVUA 1KSIA 1VQ53 1IVVA 3CD63 2W9PA 4OUQA 2LQVA 3WMDA 1RN7A 1N8QA 2CH9A 1O7HB 3EB8A 3G16A 2B1XB 2CWUA 4HKVB 3EC9A 1JB5A 1WTHA 3F9SA 2ZDJA 4RBNA 3RGRA 3F7XA 2K54A 1JJ22 3CCV3 2LYXA 4GL6A 4HM3B 1YJ93 4N6LA 1DYUA 2KXGA 1E3RA 3MWZA 5G2GA 1D6YA 3EX9A 4GB5A 1FGMA 3BNEA 1E97A 1GD3A 1JB2A 3X42A 1OHPA 4MMZB 3SLUA 1CYUA 3AMOB 5D82A 1VQ63 3LH4A 3V92A 1WMPA 2XH9A 3GZXB 1IQYA 3H3HA 3CCL3 3OX9A 1W6GA 2W56A 2OOVA 2OQEC 1W7CA 2CC3A 4RNZA 1UUWB 5AI1A 2IMJA 2IUKA 3CCE3 3S28A 1QAKA 1M1XB 3KE7A 4ORLA 3FG3A 5AYRB 3WODG 3NX0A 1VQK3 3J7Yd 3K9MC 5AYSC 5AEWB 3CC43 2F98A 4L7KA 1IVXA 1YJW3 4X2OA 3EJVA 4MEIA 1PU4A 1VQ83 2BMQB 1M1K4 3IMAB 3CPOA 3GAXA 3ALAA 1K9M4 3FSDA 3KZTA 1GS3A 4HZ9B 1Y4KA 3UNLA 3Q90A 2P38A 3NBRA 2W9QA 3G0KA 3X3XA 1DVDA 1DMMA 1K28A 2BMOB 5AIHA 3AMOA 4MMYB 4EV2A 2D1WA 2GXFA 1CEWI 2UX0A 5AEUB 3SXXA 1QMAA 2BMRB 1NWWA 3BLZA 1Q40B 3G4S3 1NU3A 3OWUA 1JNQA 4NHFA 2OWPA 4FMDA 4R80A 2WOFA 2Z76A 3GRDA 3DGMA 1IV9A 3FGYA 2WGOA 1D6UA 4K1VA 3GZYB 3MPHA 2CWTA 1W6CA 1ZX2A 1YJN3 1TIJA 3HX8A 2W2CA 3FCSB 3NQZA 2E2UA 3UL6A 1W2B2 1ULJB 1SQWA 3K7CA 3KSPA 4LSOA 2XRXB 4R4KA 3NM7A 2CG1A 2HMKB 1KQS2 5DRVA 4FCJA 3NQYA 4L8PA 3PCSA 3NXJA 1VQM3 6STDA 3DMCA 3QRDA 2P09A 3CNXA 3ROBA 5HGRA 3Q2PA 4R9LA 2F99A 2GU3A 3OXAA 2K0MA 3IJEB 1IDPA 1A67A 1FGTA 1FGQA 2CFWA 5IG4A 1Q40A 4RNYA 3LT9A 3CPW2 1DVCA 2CFGA 1IQXA 4H3UA 4KFDA 1G96A 3DGOA 2HMMB 3DGLA 3Q1CA 1Q864 4XM4A 1IV7A 3M8CA 2QIYA 3T0UA 2XSOB 1O7PB 3PGBA 4JRFA 3F40A 1W00A 2OTL3 2BO9B 1VQN3 3FG1A 4QWTA 1T5YA 4WFOA 1YGEA 3FZWA 4HBRA 1OCVA 5IG3A 3DZLA 1Q824 4O3VA 5BVBA 3N54B 4EV5A 2F86B 3X41A 1K8A4 1FGOA 2CIUA 4K90B 1GYBA 3V98A 3X3ZA 1A90A 5AIGA 1O7WB 2GEYA 1Z1SA 2L4VA 4IIAA 7STDA 2SBLA 5D81A 4R9KA 4WWUC 1W5ZA 3FKAA 1IU7A 1DMQA 3MG2A 1D6ZA 1STDA 5A0OB 5IENA 3PS8A 3HZPA 1O7MB 2IUJA 2HMJB 1VQ73 3GWRA 2B24B 3D9RA 1OHOA 5KP3A 3EBYA 3F8XA 2JDIH 3OV4A 5LC6A 1R4CA 2P05A 2XEPA 4HM5B 3B8LA 2XFSA 1LNHA 3GZBA 3HIIA 2WOHA 3BNBA 3EBTA 3JVCA 4HM0B 2QA43 2BHMA 2W04A 3MKIA 4N6UA 2Q07A 2C10A 3EHCA 2YX9A 1TU5A 3KN4A 2GEXA 3QK9A 1IQ8A 1ROVA 3X3YA 3NBBA 1TP6A 3LTBA 1STFI 3U97A 1OUNA 2YFIB 1N5HA 3G713 4G1MB 1LVNA 2CFKA 3B7CA 1KD14 1GY7A 4IT7A 4XB5A 4MJDA 5LC7A 4U13A 2C11A 1TFKA 1FGRA 3ECFA 4O8SA 3WA3A 8CHOA 3DY5A 4IPBA 5IG5A 1AR0A 4EXRA 3CME3 1NJI4 3NBJA 4N6MA 1WNHA 3FF2A 1Q814 1OPYA 1U5OA 1KWIA 1JB4A 1W02A 3EQQB 5FW5A 3UB1A 1GY6A 3A76A 1NB5I 1N9EA 1S723 3EF8A 3FF0A 4AKYA 5ELUA 1ISKA 2I9WA 1HKXA 1M9GA 4AKZA 4J8TA 4KZ1A 3OW22 3NHXA 1OF5B 1O7NB 3JUPA 1Q42A 4O02B 2OOVC 3K5TA 4HZBB 3WOEB 1WQLB 1GD4A 5EEOA 1LXEA 1WMOA 4KVHA 2Z7AA 2ML5A 1UI8A 3SOYA 3S27A 3NUVA 3DM8A 3WOFB 3X40A 1S5AA 4WHAA 3TDGA 2INXA 1YVBI 2OTJ3 3SVAA 4EYCA 3BB9A 3N8BA 1GY5A 1IVWA 5ELJA 1BUQA 2XSHB 2ML6A 3JUQA 1JV2B 2O3OA 2XGNA 1EQKA 2O9UX 1OHSA 3LYGA 1TFOA 2OCTA 1ASKA 3CCR3 2HMLB 5STDA 5I97A 4N3VA 2Z77A 3KFQC 3SEDA 5JBSA 3FG4A 3NM2A 2CG0A 2FXTA 1NB3I 5CK6A 3DXOA 1OF5A 4LEHA 1RJOA 3JUOA 4BTXA 1F8NA 1AV4A 1A2VA 4FR9A 3O8YA 4CDLA 2P0MA 2XGLA 1OACA 5CLKA 1NDOB 3BNDA 3GZRA 1FUWA 4CCVA 4LGQA 3H51A 3RDEA 3LZAA 5KP4A 4BTYA 2WO0A 4WYKB 1W2ZA 2XF3A 1MNLA 4K61A 1DMNA 4AEQA 4I4KA 1W4NA 2GBXB 2PZVA 3STDA 1EKMA 3KSED 3N9HA 3I553 1NO3A 2D42A 3T8NA 1JKGB 3LTCA 1U8CB 4HM6B 4L8OA 1YI23 5JPPA 1ULIB 4BTWA 3FH1A 3U1WA 5IG0A 4NREA 1AVKA 1SIHA 3OWSA 3OWYA 1K734 2P0XA 4HVNA 4KFFA 5AIIA 3CCU3 5EQLA 2KRTA 4N6OB 3CXC2 3KIIA 3S67A 4HJLB 1UW1A 4EC6A 2YFLB 1E3VA 3MG1A 3CMA3 3WDGB 2XFTA 2YFJB 3JUMA 1QJGA 4EBGA 1LOXA 4HM1B 1VQL3 4FCZA 2W0QA 4STDA 1N9JA 1EA2A 3V99A 4WYKA 1K41A 4MMXB 5JPUA 1L5GB 4N6TA 2JQ5A 3G6E3 1YIJ3 2E2VA 3VSYA 1Q7Y4 2Y73A 1JKGA 2FNQA 5D83A 2M7OA 3CU3A 4OVMA 4ZM8A 5CF2A 2CFLA 3LMLA 3MHEA 4X2HA 3DUKA 1IK3A 4XBXA 1OGZA 3K0ZA 2XR8B 1AVLA 5EVHA 3F7SA 3HK4A 3LXUX 1VQP3 1FA3A 1VZZA 3NV0B 2KCDA 3PXMA 2GBWB 4XDWA 3S29A 1JRQA 1UUVB 3IPTA 3ER7A 1HU9A 1VQ43 4O2HA 4FMCA 4TX4A 3CCQ3 3D3LA 1TUHA 1W6YA 2CFDA 2W03A 4XBTA 2E2TA 5CXOA 4LZIA 3CC23 2RGQA 2RSXA 4HM8B 4N6NB 2PNCA 2R4IA 2WGQA 3FLJA 3PZWA 5BXQA 2RFRA 2ZL8A 1QVF2 5IERA 2GU1A 1EG9B 3PCRA 4XBYA 1YHQ3 1QALA 3CCS3 2CK3H 2V1LA 4JF8A 3LTDA 3T8UA 2CKFB 3L0RA 3PYJA 5AIFA 5DREA 1IT8A 3KKGA 5KP1A 3NV0A 2QEX3 4PEJA 5TGNA 4HM7B 5IEOA 2A15A 1IT7A 3K63A 4FMBA 3BNCA 4H61A 1US1A 3EN8A 1MOLA 1OGXA 2MF7A 2RCDA 4N6V0 4RZMA 2BT3A 3EE1A 4FCMA 3CC73 1WMNA 1N8R4 3MSOA 4HYZA 2FGTA 3F14A 2CWVA 1JN5B 4FMAA 3CCM3 4KFEA 2Y74A 3MG3A 3SX1A 4OK0A 3SOAA 1W01A 1C7HA 3LTAA 3DGNA 3UJMA 5IW9A 5IF6A 3E99A 1QAFA 1RRHA 1SIIA 2HMNB 2HMOB 2Z6BA 1CQSA 1RRLA 2STDA 3JUNA 3WA2X 1VQ93 2MC8A 3EN1B 2QGUA 1KC84 1SJWA 3I563 3MYTA 3RGAA 2CW9A 1ROAA 4Q53A 4HM4B 3LOYA 1YIT3 1N5PA 1ZO2A 2W6JH 1SPUA 2IA7A 3B4PA 1O7GB 2BNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LT9 A;  3LT8 A;  2P09 A;  3LTB A;  3LTC A;  2P05 A;  3LTA A;  1UW1 A;  2P0X A;  3DGN A;  3DGO A;  3DGM A;  3LTD A;  3DGL A; 
#chains in the Genus database with same CATH topology
 3S5C A;  3CCJ 3;  4J9A A;  3G8Z A;  1M90 4;  1A2K A;  1PFP A;  3HIG A;  1VQO 3;  2CHC A;  1UI7 A;  5IEP A;  4XDV A;  3UL5 A;  2IYJ A;  4BIR A;  3LT8 A;  4LMI A;  5CF1 A;  3VGN A;  4WP5 A;  1JN5 A;  1OH0 A;  3HI7 A;  1CYV A;  3F8H A;  4GSP A;  1V74 A;  5FGO A;  4HM2 B;  3CNM A;  3VF1 A;  3B4O A;  2OQE A;  1RKY A;  4R1K A;  4K1U A;  2W56 B;  3I0Y A;  3RNT A;  2ZA4 A;  1QVG 2;  1IVU A;  1KSI A;  1J2B A;  1VQ5 3;  1IVV A;  1RN1 A;  3CD6 3;  2W9P A;  4OUQ A;  2LQV A;  3WMD A;  1BGS A;  1N8Q A;  1RN7 A;  1I3I A;  1O7H B;  2CH9 A;  3EB8 A;  6GSP A;  1DET A;  3G16 A;  2B1X B;  3D79 A;  1LRA A;  2CWU A;  4HKV B;  1B2M A;  3EC9 A;  1SAR A;  1JB5 A;  1LQM B;  1WTH A;  3F9S A;  1BSD A;  1BSE A;  2F5W A;  2ZDJ A;  4RBN A;  3RGR A;  3F7X A;  1GSP A;  2K54 A;  3CCV 3;  1JJ2 2;  2KF3 A;  2LYX A;  4GL6 A;  4HM3 B;  1YJ9 3;  2RBI A;  4N6L A;  1DYU A;  1I0X A;  3ZFZ A;  1UGI A;  1E3R A;  2KXG A;  3MWZ A;  5G2G A;  1D6Y A;  3EX9 A;  1FUT A;  4GB5 A;  4BL3 A;  1FGM A;  1PYL A;  3BNE A;  1BNR A;  1E97 A;  1GD3 A;  2KF6 A;  1BNE A;  1JB2 A;  1UCI A;  3X42 A;  1OHP A;  4MMZ B;  3SLU A;  1CYU A;  3AMO B;  5D82 A;  1VQ6 3;  3LH4 A;  1V57 A;  3AGO A;  3V92 A;  1WMP A;  2XH9 A;  3GZX B;  1IQY A;  3H3H A;  3CCL 3;  3OX9 A;  1W6G A;  1MWT A;  4EW5 A;  2W56 A;  2OOV A;  1UUG B;  2OQE C;  1W7C A;  2CC3 A;  4RNZ A;  1UUW B;  5AI1 A;  2IMJ A;  2IUK A;  3CCE 3;  1RSN A;  3S28 A;  1QAK A;  1M1X B;  3KE7 A;  4ORL A;  3FG3 A;  5AYR B;  3WOD G;  1I2F A;  3NX0 A;  3J7Y d;  1VQK 3;  1AQZ A;  3K9M C;  5AYS C;  1BNS A;  5AEW B;  3ZG0 A;  3CC4 3;  2F98 A;  2UGI A;  4L7K A;  1IVX A;  7RNT A;  1YJW 3;  1JBS A;  4X2O A;  3EJV A;  1JZO A;  4MEI A;  7GSP A;  1PU4 A;  1VQ8 3;  2BMQ B;  1M1K 4;  3IMA B;  3CPO A;  3GAX A;  3ALA A;  1K9M 4;  3FSD A;  3KZT A;  1GS3 A;  4HZ9 B;  1Y4K A;  3UNL A;  3Q90 A;  2R41 A;  2P38 A;  3NBR A;  2W9Q A;  3G0K A;  3X3X A;  1DVD A;  1DMM A;  1K28 A;  2BMO B;  5AIH A;  3AMO A;  4MMY B;  1RGA A;  4EV2 A;  2D1W A;  2GXF A;  1BU4 A;  1CEW I;  4HAA A;  2UX0 A;  5AEU B;  3SXX A;  1QMA A;  2BMR B;  1BSC A;  1NWW A;  3BLZ A;  1Q40 B;  3G4S 3;  1NU3 A;  3OWU A;  1JNQ A;  4NHF A;  2OWP A;  4FMD A;  4R80 A;  2WOF A;  2Z76 A;  3GRD A;  3DGM A;  1IV9 A;  3FGY A;  1JZD A;  2WGO A;  1D6U A;  4K1V A;  3GZY B;  3MPH A;  2CWT A;  1W6C A;  1ZX2 A;  3BIR A;  1TIJ A;  3CCR 3;  1YJN 3;  3HX8 A;  2W2C A;  1B2S A;  3FCS B;  3NQZ A;  2E2U A;  3UL6 A;  1W2B 2;  1ULJ B;  1SQW A;  3K7C A;  3KSP A;  4LSO A;  2XRX B;  4R4K A;  3NM7 A;  2CG1 A;  1Q9E A;  2HMK B;  1KQS 2;  5DRV A;  4FCJ A;  3BU4 A;  3NQY A;  1I2E A;  1CH0 A;  3PCS A;  4L8P A;  3NXJ A;  2CX1 A;  1VQM 3;  1BSA A;  6STD A;  3DMC A;  3QRD A;  2P09 A;  3CNX A;  3ROB A;  5HGR A;  5RNT A;  1BRI A;  3Q2P A;  4R9L A;  1A2P A;  2F99 A;  2H0I A;  2GU3 A;  2L1S A;  3OXA A;  4LYL B;  2K0M A;  3IJE B;  1IDP A;  1A67 A;  1FGT A;  1FGQ A;  1YVS A;  2CFW A;  5IG4 A;  1Q40 A;  4RNY A;  1UGH I;  3LT9 A;  1GOY A;  4RNT A;  1RGK A;  3CPW 2;  1DE3 A;  1DVC A;  2CFG A;  1IQX A;  1IYY A;  4H3U A;  4KFD A;  1G96 A;  3DGO A;  2HMM B;  3DGL A;  1GOV A;  3Q1C A;  1Q86 4;  2AAD A;  4XM4 A;  1IV7 A;  4J5G A;  1RNT A;  2QIY A;  3M8C A;  3T0U A;  3A5E A;  2XSO B;  1O7P B;  3PGB A;  4JRF A;  1BNJ A;  3F40 A;  1W00 A;  2OTL 3;  2BO9 B;  1VQN 3;  1FZU A;  2F56 A;  1AY7 A;  3FG1 A;  1BNI A;  1T5Y A;  4QWT A;  4WFO A;  1YGE A;  3FZW A;  1B3S A;  2BU4 A;  4HBR A;  1LOW A;  1G02 A;  1OCV A;  5IG3 A;  3DZL A;  1Q82 4;  4O3V A;  5BVB A;  3N54 B;  4EV5 A;  2F86 B;  3X41 A;  5BU4 A;  1K8A 4;  1FGO A;  2CIU A;  4K90 B;  1RGF A;  1GYB A;  3V98 A;  3X3Z A;  1A90 A;  5AIG A;  1O7W B;  2GEY A;  1Z1S A;  2L4V A;  4IIA A;  6RNT A;  7STD A;  2SBL A;  5D81 A;  4R9K A;  4WWU C;  2F5M A;  1W5Z A;  3FKA A;  5M1A A;  1IU7 A;  1DMQ A;  3MG2 A;  3D5I A;  1BIR A;  1D6Z A;  1STD A;  5A0O B;  5IEN A;  1GMP A;  3PS8 A;  3HZP A;  1O7M B;  2IUJ A;  2HMJ B;  1VQ7 3;  1YNV X;  3GWR A;  2B24 B;  3D9R A;  1OHO A;  5KP3 A;  1LQG C;  1BAN A;  3EBY A;  5G1K A;  3F8X A;  2JDI H;  3OV4 A;  5LC6 A;  1R4C A;  2P05 A;  2XEP A;  4HM5 B;  3B8L A;  2XFS A;  1LNH A;  1V58 A;  1G0T A;  3GZB A;  3HII A;  2WOH A;  3BNB A;  3EBT A;  3JVC A;  1I70 A;  4HM0 B;  2QA4 3;  2BHM A;  1VQQ A;  2W04 A;  3MKI A;  4N6U A;  2Q07 A;  2C10 A;  3EHC A;  2YX9 A;  1TU5 A;  1FYS A;  1HZ1 A;  3KN4 A;  2GEX A;  3QK9 A;  1IQ8 A;  1ROV A;  3X3Y A;  3NBB A;  1TP6 A;  3LTB A;  1STF I;  3U97 A;  1OUN A;  2YFI B;  1N5H A;  1RGH A;  3G71 3;  4G1M B;  1BAO A;  1LVN A;  2CFK A;  3B7C A;  1EEJ A;  1GY7 A;  4IT7 A;  4XB5 A;  4MJD A;  5LC7 A;  1KD1 4;  4U13 A;  2C11 A;  5GSP A;  1TFK A;  1FGR A;  3ECF A;  4O8S A;  3WA3 A;  8CHO A;  3DY5 A;  4IPB A;  5IG5 A;  1AR0 A;  4EXR A;  3CME 3;  1NJI 4;  3NBJ A;  1BRG A;  4N6M A;  1UCJ A;  1WNH A;  4BL2 A;  3FF2 A;  1Q81 4;  1OPY A;  1U5O A;  1KWI A;  1JB4 A;  1W02 A;  3EQQ B;  1RN4 A;  5FW5 A;  3UB1 A;  1GY6 A;  3A76 A;  1RGG A;  1N9E A;  1NB5 I;  1S72 3;  3EF8 A;  3FF0 A;  3WR2 A;  4GHO A;  4AKY A;  5ELU A;  2KF5 A;  1ISK A;  1RNB A;  2I9W A;  1HKX A;  1M9G A;  2CX0 A;  4J8T A;  4AKZ A;  4KZ1 A;  3OW2 2;  3NHX A;  1OF5 B;  1BRJ A;  1O7N B;  1Q42 A;  3JUP A;  2OOV C;  4O02 B;  1UCK A;  2F4Y A;  3K5T A;  4HZB B;  3WOE B;  1BRS A;  1ZGX A;  1T2I A;  3D5G A;  1GMQ A;  1NNV A;  3Q3F A;  1WQL B;  1GD4 A;  5EEO A;  2HOH A;  1BSB A;  1LXE A;  1WMO A;  4KVH A;  2Z7A A;  2ML5 A;  1UI8 A;  3SOY A;  3S27 A;  2RNT A;  3NUV A;  3SYU A;  3DM8 A;  3WOF B;  3X40 A;  1S5A A;  4WHA A;  3TDG A;  2INX A;  1YVB I;  2OTJ 3;  3SVA A;  4EYC A;  3BB9 A;  3N8B A;  1GY5 A;  4CJN A;  4ILF A;  1IVW A;  5ELJ A;  1BUQ A;  2XSH B;  2ML6 A;  3JUQ A;  1JV2 B;  2O3O A;  2XGN A;  1EQK A;  2O9U X;  8RNT A;  1C54 A;  1OHS A;  1HYF A;  1TFO A;  2OCT A;  1ASK A;  1I2G A;  2HML B;  3LYG A;  5STD A;  3URP A;  4N3V A;  2Z77 A;  3KFQ C;  9RNT A;  3SED A;  5I97 A;  5JBS A;  3FG4 A;  5M18 A;  3NM2 A;  2CG0 A;  2FXT A;  1NB3 I;  5CK6 A;  3DXO A;  1OF5 A;  1RMS A;  3DGY A;  1RJO A;  4LEH A;  3JUO A;  4BTX A;  1F8N A;  1AV4 A;  1A2V A;  4FR9 A;  3O8Y A;  4CDL A;  2P0M A;  2XGL A;  1OAC A;  5CLK A;  1NDO B;  3DH2 A;  1FUS A;  3BND A;  1BRH A;  3GZR A;  1FUW A;  4CPK A;  1UDI I;  4CCV A;  4HOH A;  4LGQ A;  3H51 A;  3RDE A;  1BRN L;  3LZA A;  5KP4 A;  4BTY A;  2WO0 A;  4WYK B;  1W2Z A;  2XF3 A;  1RGC A;  1MNL A;  4K61 A;  1DMN A;  1MWR A;  4I4K A;  4AEQ A;  1B21 A;  1W4N A;  2GBX B;  2PZV A;  3STD A;  1EKM A;  3KSE D;  3N9H A;  3I55 3;  1NO3 A;  2KF4 A;  2D42 A;  3T8N A;  1JKG B;  3LTC A;  1U8C B;  3HOH A;  4HM6 B;  4L8O A;  1YI2 3;  5JPP A;  1ULI B;  4BTW A;  2IY2 A;  3FH1 A;  3U1W A;  5IG0 A;  4NRE A;  1B2X A;  1AVK A;  1MWU A;  1RCK A;  1SIH A;  3OWS A;  3OWY A;  1K73 4;  1B2U A;  1I0V A;  1MGR A;  2P0X A;  4KT3 B;  4HVN A;  1PY3 A;  2ZHX B;  4KFF A;  5AII A;  2AAE A;  3CCU 3;  5EQL A;  2KRT A;  4N6O B;  3CXC 2;  3KII A;  3S67 A;  1I8V A;  4HJL B;  1UW1 A;  1ZS7 A;  1TJD A;  4EC6 A;  2YFL B;  1FW7 A;  1LOY A;  1UCL A;  1RTU A;  1E3V A;  1T3B A;  3MG1 A;  1X1W A;  3WDG B;  3CMA 3;  2XFT A;  5G1L A;  2YFJ B;  3JUM A;  1B2Z A;  1QJG A;  4EBG A;  1LOX A;  4HM1 B;  1VQL 3;  4FCZ A;  2W0Q A;  4STD A;  1N9J A;  1EA2 A;  3V99 A;  4WYK A;  1K41 A;  4MMX B;  5JPU A;  1L5G B;  4N6T A;  2JQ5 A;  3G6E 3;  1YIJ 3;  1T2H A;  1BRK A;  1X1U A;  2E2V A;  2UUG C;  4J5K A;  3VSY A;  3AHS A;  1Q7Y 4;  1TTO A;  2Y73 A;  1GMR A;  1JKG A;  2FNQ A;  5D83 A;  2M7O A;  1X1Y A;  3CU3 A;  4OVM A;  4ZM8 A;  5CF2 A;  2CFL A;  3LML A;  3MHE A;  1RGE A;  2H0H A;  3DUK A;  4X2H A;  5BIR A;  1IK3 A;  1GOU A;  1B27 A;  1YGW A;  4XBX A;  1BNF A;  2SAR A;  1OGZ A;  3K0Z A;  2XR8 B;  1AVL A;  5HOH A;  1RDS A;  5EVH A;  3F7S A;  1RLS A;  3HK4 A;  2J8X B;  3LXU X;  1VQP 3;  1FA3 A;  1VZZ A;  3NV0 B;  2KCD A;  3KCH A;  3PXM A;  2GBW B;  1BUJ A;  4XDW A;  3S29 A;  1JRQ A;  1UUV B;  3IPT A;  3ER7 A;  4I5Q A;  1HU9 A;  3ZG5 A;  1VQ4 3;  4O2H A;  4FMC A;  4TX4 A;  3CCQ 3;  3D3L A;  1B20 A;  1TUH A;  1W6Y A;  2CFD A;  2W03 A;  4XBT A;  3WHO A;  2E2T A;  5CXO A;  2BIR A;  4LZI A;  3CC2 3;  1JBT A;  2RGQ A;  2RSX A;  4HM8 B;  4N6N B;  1X1X A;  2PNC A;  2R4I A;  2K3D A;  2WGQ A;  3FLJ A;  1BOX A;  1R4Y A;  3PZW A;  5BXQ A;  2RFR A;  2ZL8 A;  1QVF 2;  5IER A;  2GU1 A;  1EG9 B;  3PCR A;  4XBY A;  1YHQ 3;  1Q7H A;  1QAL A;  3CCS 3;  2CK3 H;  2V1L A;  4JF8 A;  3LTD A;  3T8U A;  1JBR A;  2CKF B;  3L0R A;  3PYJ A;  5AIF A;  3AHW A;  5DRE A;  1IT8 A;  3KKG A;  5KP1 A;  3NV0 A;  1TRP A;  4NPB A;  2QEX 3;  4PEJ A;  5TGN A;  4HM7 B;  5IEO A;  4DKI A;  2A15 A;  1IT7 A;  3GSP A;  3K63 A;  4FMB A;  3BNC A;  4H61 A;  1US1 A;  3EN8 A;  1MOL A;  1OGX A;  5M19 A;  2MF7 A;  2RCD A;  4N6V 0;  1RHL A;  4RZM A;  1TRQ A;  2BT3 A;  3EE1 A;  4FCM A;  1RCL A;  3CC7 3;  1WMN A;  1N8R 4;  3MSO A;  1EUI C;  3AGN A;  4HYZ A;  2FGT A;  3F14 A;  2H0G A;  4BU4 A;  2CWV A;  1JN5 B;  1MWS A;  4FMA A;  3CCM 3;  1MGW A;  4KFE A;  2Y74 A;  3MG3 A;  3SX1 A;  4OK0 A;  1BNG A;  3SOA A;  1W01 A;  1C7H A;  3LTA A;  3DGN A;  3UJM A;  2KAA A;  5IF6 A;  5IW9 A;  3E99 A;  1BVI A;  1QAF A;  1RRH A;  1SII A;  2GSP A;  2HMN B;  2HMO B;  2Z6B A;  1LOV A;  1CQS A;  1RRL A;  2STD A;  3JUN A;  3WA2 X;  1VQ9 3;  1I3F A;  2MC8 A;  3EN1 B;  2C4B A;  2QGU A;  1KC8 4;  1SJW A;  3I56 3;  3MYT A;  3RGA A;  2CW9 A;  1ROA A;  4Q53 A;  4HM4 B;  3LOY A;  1YIT 3;  1N5P A;  1ZO2 A;  2W6J H;  3D4A A;  1SPU A;  2IA7 A;  3B4P A;  1RGL A;  1O7G B;  2BNG A;  1LNI A; 
#chains in the Genus database with same CATH homology
 3S5C A;  3CCJ 3;  4J9A A;  3G8Z A;  1M90 4;  1A2K A;  1PFP A;  3HIG A;  1VQO 3;  2CHC A;  1UI7 A;  5IEP A;  4XDV A;  3UL5 A;  3LT8 A;  4LMI A;  5CF1 A;  3VGN A;  4WP5 A;  1JN5 A;  1OH0 A;  3HI7 A;  1CYV A;  3F8H A;  1V74 A;  5FGO A;  4HM2 B;  3CNM A;  3VF1 A;  3B4O A;  2OQE A;  1RKY A;  4R1K A;  4K1U A;  2W56 B;  3I0Y A;  1J2B A;  1QVG 2;  1IVU A;  1KSI A;  1VQ5 3;  1IVV A;  3CD6 3;  2W9P A;  4OUQ A;  2LQV A;  3WMD A;  1RN7 A;  1N8Q A;  2CH9 A;  1O7H B;  3EB8 A;  3G16 A;  2B1X B;  2CWU A;  4HKV B;  3EC9 A;  1JB5 A;  1WTH A;  3F9S A;  2ZDJ A;  4RBN A;  3RGR A;  3F7X A;  2K54 A;  1JJ2 2;  3CCV 3;  2LYX A;  4GL6 A;  4HM3 B;  1YJ9 3;  4N6L A;  1DYU A;  2KXG A;  1E3R A;  3MWZ A;  5G2G A;  1D6Y A;  3EX9 A;  4GB5 A;  1FGM A;  3BNE A;  1E97 A;  1GD3 A;  1JB2 A;  3X42 A;  1OHP A;  4MMZ B;  3SLU A;  1CYU A;  3AMO B;  5D82 A;  1VQ6 3;  3LH4 A;  3V92 A;  1WMP A;  2XH9 A;  3GZX B;  1IQY A;  3H3H A;  3CCL 3;  3OX9 A;  1W6G A;  2W56 A;  2OOV A;  2OQE C;  1W7C A;  2CC3 A;  4RNZ A;  1UUW B;  5AI1 A;  2IMJ A;  2IUK A;  3CCE 3;  3S28 A;  1QAK A;  1M1X B;  3KE7 A;  4ORL A;  3FG3 A;  5AYR B;  3WOD G;  3NX0 A;  1VQK 3;  3J7Y d;  3K9M C;  5AYS C;  5AEW B;  3CC4 3;  2F98 A;  4L7K A;  1IVX A;  1YJW 3;  4X2O A;  3EJV A;  4MEI A;  1PU4 A;  1VQ8 3;  2BMQ B;  1M1K 4;  3IMA B;  3CPO A;  3GAX A;  3ALA A;  1K9M 4;  3FSD A;  3KZT A;  1GS3 A;  4HZ9 B;  1Y4K A;  3UNL A;  3Q90 A;  2P38 A;  3NBR A;  2W9Q A;  3G0K A;  3X3X A;  1DVD A;  1DMM A;  1K28 A;  2BMO B;  5AIH A;  3AMO A;  4MMY B;  4EV2 A;  2D1W A;  2GXF A;  1CEW I;  2UX0 A;  5AEU B;  3SXX A;  1QMA A;  2BMR B;  1NWW A;  3BLZ A;  1Q40 B;  3G4S 3;  1NU3 A;  3OWU A;  1JNQ A;  4NHF A;  2OWP A;  4FMD A;  4R80 A;  2WOF A;  2Z76 A;  3GRD A;  3DGM A;  1IV9 A;  3FGY A;  2WGO A;  1D6U A;  4K1V A;  3GZY B;  3MPH A;  2CWT A;  1W6C A;  1ZX2 A;  1YJN 3;  1TIJ A;  3HX8 A;  2W2C A;  3FCS B;  3NQZ A;  2E2U A;  3UL6 A;  1W2B 2;  1ULJ B;  1SQW A;  3K7C A;  3KSP A;  4LSO A;  2XRX B;  4R4K A;  3NM7 A;  2CG1 A;  2HMK B;  1KQS 2;  5DRV A;  4FCJ A;  3NQY A;  4L8P A;  3PCS A;  3NXJ A;  1VQM 3;  6STD A;  3DMC A;  3QRD A;  2P09 A;  3CNX A;  3ROB A;  5HGR A;  3Q2P A;  4R9L A;  2F99 A;  2GU3 A;  3OXA A;  2K0M A;  3IJE B;  1IDP A;  1A67 A;  1FGT A;  1FGQ A;  2CFW A;  5IG4 A;  1Q40 A;  4RNY A;  3LT9 A;  3CPW 2;  1DVC A;  2CFG A;  1IQX A;  4H3U A;  4KFD A;  1G96 A;  3DGO A;  2HMM B;  3DGL A;  3Q1C A;  1Q86 4;  4XM4 A;  1IV7 A;  3M8C A;  2QIY A;  3T0U A;  2XSO B;  1O7P B;  3PGB A;  4JRF A;  3F40 A;  1W00 A;  2OTL 3;  2BO9 B;  1VQN 3;  3FG1 A;  4QWT A;  1T5Y A;  4WFO A;  1YGE A;  3FZW A;  4HBR A;  1OCV A;  5IG3 A;  3DZL A;  1Q82 4;  4O3V A;  5BVB A;  3N54 B;  4EV5 A;  2F86 B;  3X41 A;  1K8A 4;  1FGO A;  2CIU A;  4K90 B;  1GYB A;  3V98 A;  3X3Z A;  1A90 A;  5AIG A;  1O7W B;  2GEY A;  1Z1S A;  2L4V A;  4IIA A;  7STD A;  2SBL A;  5D81 A;  4R9K A;  4WWU C;  1W5Z A;  3FKA A;  1IU7 A;  1DMQ A;  3MG2 A;  1D6Z A;  1STD A;  5A0O B;  5IEN A;  3PS8 A;  3HZP A;  1O7M B;  2IUJ A;  2HMJ B;  1VQ7 3;  3GWR A;  2B24 B;  3D9R A;  1OHO A;  5KP3 A;  3EBY A;  3F8X A;  2JDI H;  3OV4 A;  5LC6 A;  1R4C A;  2P05 A;  2XEP A;  4HM5 B;  3B8L A;  2XFS A;  1LNH A;  3GZB A;  3HII A;  2WOH A;  3BNB A;  3EBT A;  3JVC A;  4HM0 B;  2QA4 3;  2BHM A;  2W04 A;  3MKI A;  4N6U A;  2Q07 A;  2C10 A;  3EHC A;  2YX9 A;  1TU5 A;  3KN4 A;  2GEX A;  3QK9 A;  1IQ8 A;  1ROV A;  3X3Y A;  3NBB A;  1TP6 A;  3LTB A;  1STF I;  3U97 A;  1OUN A;  2YFI B;  1N5H A;  3G71 3;  4G1M B;  1LVN A;  2CFK A;  3B7C A;  1KD1 4;  1GY7 A;  4IT7 A;  4XB5 A;  4MJD A;  5LC7 A;  4U13 A;  2C11 A;  1TFK A;  1FGR A;  3ECF A;  4O8S A;  3WA3 A;  8CHO A;  3DY5 A;  4IPB A;  5IG5 A;  1AR0 A;  4EXR A;  3CME 3;  1NJI 4;  3NBJ A;  4N6M A;  1WNH A;  3FF2 A;  1Q81 4;  1OPY A;  1U5O A;  1KWI A;  1JB4 A;  1W02 A;  3EQQ B;  5FW5 A;  3UB1 A;  1GY6 A;  3A76 A;  1NB5 I;  1N9E A;  1S72 3;  3EF8 A;  3FF0 A;  4AKY A;  5ELU A;  1ISK A;  2I9W A;  1HKX A;  1M9G A;  4AKZ A;  4J8T A;  4KZ1 A;  3OW2 2;  3NHX A;  1OF5 B;  1O7N B;  3JUP A;  1Q42 A;  4O02 B;  2OOV C;  3K5T A;  4HZB B;  3WOE B;  1WQL B;  1GD4 A;  5EEO A;  1LXE A;  1WMO A;  4KVH A;  2Z7A A;  2ML5 A;  1UI8 A;  3SOY A;  3S27 A;  3NUV A;  3DM8 A;  3WOF B;  3X40 A;  1S5A A;  4WHA A;  3TDG A;  2INX A;  1YVB I;  2OTJ 3;  3SVA A;  4EYC A;  3BB9 A;  3N8B A;  1GY5 A;  1IVW A;  5ELJ A;  1BUQ A;  2XSH B;  2ML6 A;  3JUQ A;  1JV2 B;  2O3O A;  2XGN A;  1EQK A;  2O9U X;  1OHS A;  3LYG A;  1TFO A;  2OCT A;  1ASK A;  3CCR 3;  2HML B;  5STD A;  5I97 A;  4N3V A;  2Z77 A;  3KFQ C;  3SED A;  5JBS A;  3FG4 A;  3NM2 A;  2CG0 A;  2FXT A;  1NB3 I;  5CK6 A;  3DXO A;  1OF5 A;  4LEH A;  1RJO A;  3JUO A;  4BTX A;  1F8N A;  1AV4 A;  1A2V A;  4FR9 A;  3O8Y A;  4CDL A;  2P0M A;  2XGL A;  1OAC A;  5CLK A;  1NDO B;  3BND A;  3GZR A;  1FUW A;  4CCV A;  4LGQ A;  3H51 A;  3RDE A;  3LZA A;  5KP4 A;  4BTY A;  2WO0 A;  4WYK B;  1W2Z A;  2XF3 A;  1MNL A;  4K61 A;  1DMN A;  4AEQ A;  4I4K A;  1W4N A;  2GBX B;  2PZV A;  3STD A;  1EKM A;  3KSE D;  3N9H A;  3I55 3;  1NO3 A;  2D42 A;  3T8N A;  1JKG B;  3LTC A;  1U8C B;  4HM6 B;  4L8O A;  1YI2 3;  5JPP A;  1ULI B;  4BTW A;  3FH1 A;  3U1W A;  5IG0 A;  4NRE A;  1AVK A;  1SIH A;  3OWS A;  3OWY A;  1K73 4;  2P0X A;  4HVN A;  4KFF A;  5AII A;  3CCU 3;  5EQL A;  2KRT A;  4N6O B;  3CXC 2;  3KII A;  3S67 A;  4HJL B;  1UW1 A;  4EC6 A;  2YFL B;  1E3V A;  3MG1 A;  3CMA 3;  3WDG B;  2XFT A;  2YFJ B;  3JUM A;  1QJG A;  4EBG A;  1LOX A;  4HM1 B;  1VQL 3;  4FCZ A;  2W0Q A;  4STD A;  1N9J A;  1EA2 A;  3V99 A;  4WYK A;  1K41 A;  4MMX B;  5JPU A;  1L5G B;  4N6T A;  2JQ5 A;  3G6E 3;  1YIJ 3;  2E2V A;  3VSY A;  1Q7Y 4;  2Y73 A;  1JKG A;  2FNQ A;  5D83 A;  2M7O A;  3CU3 A;  4OVM A;  4ZM8 A;  5CF2 A;  2CFL A;  3LML A;  3MHE A;  4X2H A;  3DUK A;  1IK3 A;  4XBX A;  1OGZ A;  3K0Z A;  2XR8 B;  1AVL A;  5EVH A;  3F7S A;  3HK4 A;  3LXU X;  1VQP 3;  1FA3 A;  1VZZ A;  3NV0 B;  2KCD A;  3PXM A;  2GBW B;  4XDW A;  3S29 A;  1JRQ A;  1UUV B;  3IPT A;  3ER7 A;  1HU9 A;  1VQ4 3;  4O2H A;  4FMC A;  4TX4 A;  3CCQ 3;  3D3L A;  1TUH A;  1W6Y A;  2CFD A;  2W03 A;  4XBT A;  2E2T A;  5CXO A;  4LZI A;  3CC2 3;  2RGQ A;  2RSX A;  4HM8 B;  4N6N B;  2PNC A;  2R4I A;  2WGQ A;  3FLJ A;  3PZW A;  5BXQ A;  2RFR A;  2ZL8 A;  1QVF 2;  5IER A;  2GU1 A;  1EG9 B;  3PCR A;  4XBY A;  1YHQ 3;  1QAL A;  3CCS 3;  2CK3 H;  2V1L A;  4JF8 A;  3LTD A;  3T8U A;  2CKF B;  3L0R A;  3PYJ A;  5AIF A;  5DRE A;  1IT8 A;  3KKG A;  5KP1 A;  3NV0 A;  2QEX 3;  4PEJ A;  5TGN A;  4HM7 B;  5IEO A;  2A15 A;  1IT7 A;  3K63 A;  4FMB A;  3BNC A;  4H61 A;  1US1 A;  3EN8 A;  1MOL A;  1OGX A;  2MF7 A;  2RCD A;  4N6V 0;  4RZM A;  2BT3 A;  3EE1 A;  4FCM A;  3CC7 3;  1WMN A;  1N8R 4;  3MSO A;  4HYZ A;  2FGT A;  3F14 A;  2CWV A;  1JN5 B;  4FMA A;  3CCM 3;  4KFE A;  2Y74 A;  3MG3 A;  3SX1 A;  4OK0 A;  3SOA A;  1W01 A;  1C7H A;  3LTA A;  3DGN A;  3UJM A;  5IW9 A;  5IF6 A;  3E99 A;  1QAF A;  1RRH A;  1SII A;  2HMN B;  2HMO B;  2Z6B A;  1CQS A;  1RRL A;  2STD A;  3JUN A;  3WA2 X;  1VQ9 3;  2MC8 A;  3EN1 B;  2QGU A;  1KC8 4;  1SJW A;  3I56 3;  3MYT A;  3RGA A;  2CW9 A;  1ROA A;  4Q53 A;  4HM4 B;  3LOY A;  1YIT 3;  1N5P A;  1ZO2 A;  2W6J H;  1SPU A;  2IA7 A;  3B4P A;  1O7G B;  2BNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...