3LTDA

X-ray structure of a non-biological atp binding protein determined at 2.8 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltdA00
2P05A 2P0XA 3LTBA 3LT9A 3LTAA 2P09A 3DGNA 3LTCA 3LTDA 1UW1A 3DGOA 3DGMA 3DGLA 3LT8A
chains in the Genus database with same CATH superfamily
1D6UA 3X3YA 4HM8B 1EG9B 1NO3A 1IVWA 1UUVB 2H0HA 3QK9A 2CHCA 4XDVA 1OHPA 2HMMB 1B2UA 4KZ1A 3UNLA 1BNGA 1X1YA 4EC6A 3S29A 2QEX3 2E2TA 2RGQA 3OXAA 4N6OB 1UGIA 2IY2A 2WGQA 3CNXA 1AQZA 1EKMA 4RBNA 1B2ZA 4BL2A 5BU4A 1I0XA 5AIFA 1S723 3BLZA 3EN8A 4LYLB 3K7CA 1NWWA 2CFWA 2KF4A 2R41A 2BU4A 3DGLA 4N6MA 4BIRA 3BB9A 1ZO2A 5CF1A 2F56A 3KKGA 4L7KA 5AEWB 1AR0A 1LNHA 4QWTA 4HM6B 1QAKA 5M18A 5AIIA 5HOHA 3HI7A 4XBTA 1V74A 1WMNA 2RBIA 1EUIC 1BANA 4N6TA 2JQ5A 1X1UA 3PZWA 4FCMA 1RGGA 1RGLA 4XB5A 1R4YA 3Q3FA 1Q814 1Q824 4O02B 3MWZA 2LYXA 4LSOA 2CG1A 1RN1A 1GD3A 1RGEA 1A2VA 4K1UA 1OF5B 4J9AA 4LEHA 5EEOA 1JB2A 2FGTA 2RNTA 4OVMA 5AIHA 4K1VA 1VQ93 1ULIB 4TX4A 1I2FA 2P05A 3AHSA 1WTHA 4KFEA 5G1KA 2CK3H 1LQMB 3M8CA 1QALA 3EF8A 3HZPA 5KP3A 2ML6A 1MWRA 1HKXA 3DGYA 3X3ZA 1RSNA 3DXOA 2WOHA 1D6ZA 2XFSA 1GYBA 1MWUA 1JJ22 3IMAB 4J5KA 1OPYA 3FKAA 4HZBB 2F98A 4O2HA 2K3DA 4MEIA 5EVHA 3LT8A 2W03A 2XFTA 2AAEA 3NM7A 1KD14 5RNTA 2OOVA 1B2SA 5IG3A 4FMCA 3N54B 5CF2A 3G0KA 1AV4A 1ZS7A 1SJWA 2F5MA 2GBWB 5KP4A 1BSDA 2IMJA 4J8TA 8CHOA 1UCJA 1DMMA 5D83A 1N9JA 2XF3A 4EYCA 1MOLA 1VQQA 3X40A 1FUTA 3MG1A 3Q1CA 3S67A 1RGFA 3Q90A 5FW5A 3G4S3 1Q7Y4 3NV0B 1W6GA 1BIRA 4XM4A 1VQ83 2BMQB 1G0TA 2CWVA 3BU4A 3FGYA 1M1XB 4HJLB 1W2ZA 1JBSA 3SVAA 1M904 3ECFA 3F40A 2KRTA 1BNJA 1NDOB 2A15A 4IPBA 2P38A 2UX0A 4DKIA 1HU9A 1NNVA 1HZ1A 1SIHA 3B4PA 3B8LA 5EQLA 3MSOA 3DGNA 3WA2X 1TRQA 2WGOA 6GSPA 3H51A 4ZM8A 3S28A 3RNTA 1RCLA 2CFKA 1YJ93 2GSPA 3NQYA 3H3HA 3D79A 3CME3 5IG0A 1JB5A 4RZMA 1GMPA 3UB1A 1O7NB 1KWIA 1YVSA 1W5ZA 1UCLA 2L4VA 3DM8A 4NREA 3BNBA 3SX1A 4EV2A 4HAAA 1VQM3 3LXUX 1LOVA 1BUJA 3DGMA 3HIIA 1OACA 1M9GA 3WDGB 3G8ZA 4J5GA 4WP5A 3U1WA 1RNTA 1B2MA 3LZAA 2ZA4A 1YIJ3 2H0GA 3CC43 2CFDA 4KFFA 4LGQA 5JPUA 2C10A 2JDIH 7RNTA 3CCR3 1PFPA 1Y4KA 4FR9A 3RGRA 1WQLB 3SOYA 5FGOA 1BRJA 2W9PA 1GMRA 4GHOA 3CCE3 4RNTA 1DE3A 2H0IA 5JPPA 2WOFA 4MMZB 4CJNA 3PYJA 4R80A 3FF2A 1IYYA 1VQ73 1IQXA 5KP1A 3I563 1GMQA 1Q7HA 4R9KA 3EHCA 1GOUA 1QAFA 3CXC2 1WNHA 1WMPA 1DMQA 1BSEA 1X1WA 2F99A 2HMLB 5TGNA 4HZ9B 3ZG0A 3EBTA 2UUGC 4HBRA 2XR8B 5IEOA 1TIJA 2INXA 3LT9A 1BRGA 2GU3A 1CYVA 2XGLA 2HMKB 1ROAA 3NQZA 3F7SA 1T3BA 3G6E3 1FGRA 2CWUA 3FCSB 2XH9A 2Y73A 1W01A 3AGOA 2IUKA 3EB8A 2OTJ3 1TJDA 3CNMA 1DYUA 1VQK3 4HM5B 3DGOA 4KFDA 1IVVA 1T2IA 1LNIA 2ZHXB 3CC73 3KZTA 3NUVA 3JUQA 3SXXA 1K8A4 4N6V0 2GXFA 3X42A 2C4BA 3CPW2 3MPHA 1ZX2A 2P0XA 3ALAA 3GWRA 3V92A 2ZL8A 1K734 1TFOA 2BIRA 5A0OB 2PZVA 1N5PA 1K28A 1OH0A 2CX1A 2FNQA 4GSPA 1NU3A 4R4KA 3SOAA 1CQSA 3CCJ3 3BNEA 2W0QA 1IDPA 3PGBA 3NV0A 2BHMA 2YFIB 3IJEB 2CX0A 2F5WA 4Q53A 2W6JH 3AMOB 4JRFA 4EXRA 1BRSA 1V57A 1RGKA 4BTYA 5IW9A 2RCDA 2P09A 4N6NB 1JRQA 1STDA 3FF0A 2O3OA 4HVNA 1RCKA 1G02A 3S5CA 1JN5A 2XGNA 2Z7AA 1JBTA 1ASKA 1G96A 1RLSA 3KSED 1RDSA 1A2PA 1QMAA 1RKYA 1K41A 1DETA 3MKIA 1BNEA 1RMSA 1NB5I 5D82A 3FZWA 1N9EA 3T8UA 4N3VA 4HOHA 3J7Yd 3GRDA 3S27A 2KAAA 3V99A 1FA3A 1LOXA 1IT7A 2KXGA 1PY3A 3BNDA 2SBLA 1VQP3 3GZRA 1JNQA 3QRDA 4AEQA 1RRLA 3KCHA 3ER7A 2KF3A 5IG4A 3VSYA 1TRPA 1W00A 1D6YA 4CCVA 3EBYA 3PCRA 3HK4A 2GBXB 1BNSA 1VQL3 2LQVA 1OUNA 2UGIA 3JUMA 3K5TA 4HKVB 5ELUA 3DUKA 5BIRA 5I97A 1ISKA 3D5GA 1B20A 1I2GA 4WYKA 1E3VA 2K54A 3LYGA 5ELJA 1BSCA 3WOEB 4PEJA 1JN5B 2KF5A 1RN4A 4MMXB 5IG5A 1OGZA 1YI23 2OTL3 3MG3A 1BRIA 1UUGB 3OV4A 4KT3B 1SPUA 3JUOA 1A2KA 5CLKA 1OGXA 1TP6A 1KSIA 1CYUA 5D81A 1DVDA 3WOFB 2AADA 4WWUC 2CIUA 3F7XA 3EE1A 1BSBA 4FMAA 2B24B 3EQQB 3OW22 2J8XB 1LQGC 2P0MA 2OCTA 1N5HA 3IPTA 1BGSA 2GEXA 4H61A 4ORLA 2CG0A 5CXOA 2D42A 2RFRA 1MGWA 1A67A 1N8QA 1VZZA 4NPBA 3TDGA 1JB4A 1HYFA 1UW1A 1Q40B 2E2VA 2GU1A 3CCV3 4R9LA 5LC6A 1SQWA 2L1SA 3F9SA 1Q864 3A76A 3BNCA 2Z77A 3NBBA 4I4KA 4U13A 5AI1A 3SEDA 3VF1A 3I0YA 1FGOA 4BTWA 1OHOA 3KN4A 2CC3A 3D4AA 5STDA 1O7GB 1UCKA 2YFJB 3CCL3 3GZBA 2SARA 1RGHA 3KIIA 3F8HA 4WYKB 4XBYA 1T2HA 2K0MA 5AIGA 1EEJA 4GL6A 1VQ43 1I3IA 1W4NA 4BU4A 1BVIA 3NBRA 1IV9A 1VQ63 1QVG2 2OQEC 1PYLA 5M1AA 1FUSA 5BVBA 3AMOA 3MYTA 1LVNA 1LXEA 3GZXB 3T0UA 4AKZA 3WODG 1QVF2 3BIRA 3VGNA 2CFGA 1LOYA 1UUWB 1FGMA 2BNGA 2HMNB 1LRAA 1U8CB 3F14A 3FG4A 3PS8A 4WHAA 1I8VA 1C7HA 1Q42A 7GSPA 1VQ53 1BNFA 4RNZA 2PNCA 1JV2B 5AEUB 4HM0B 5GSPA 2HOHA 1MWTA 2BMRB 3NXJA 1B21A 2CFLA 3CCU3 3ROBA 5JBSA 1IK3A 3JUPA 1GOVA 1W7CA 2CW9A 1ROVA 2W9QA 1SARA 2MF7A 1NB3I 5M19A 3LTCA 5G2GA 2CWTA 3HIGA 3GAXA 1RNBA 3GSPA 4XDWA 2F4YA 3ZG5A 1IQ8A 1BRKA 1O7MB 1RJOA 3OX9A 1KQS2 4H3UA 3N8BA 1PU4A 3G713 3EX9A 3STDA 2C11A 3HX8A 1BU4A 3LOYA 2RSXA 2KF6A 3FLJA 2GEYA 3K0ZA 4I5QA 4HM2B 4K61A 2R4IA 3V98A 3CD63 3DZLA 3WHOA 1S5AA 3CU3A 3OWSA 1OHSA 2IUJA 6RNTA 4O3VA 1NJI4 3RDEA 1I2EA 4K90B 1BUQA 3O8YA 5DREA 3FH1A 3LTDA 4OUQA 1F8NA 5AYRB 1B3SA 1RGAA 4EBGA 3NM2A 3WMDA 2M7OA 1W6CA 4MJDA 5AYSC 5IEPA 1CH0A 4JF8A 4R1KA 3UL6A 3SLUA 4FMBA 5IF6A 1GSPA 1YNVX 1IQYA 4WFOA 1JBRA 3LTBA 1JKGA 1BNRA 1IVXA 2Y74A 3OWYA 3WA3A 2W56B 3GZYB 1JZOA 1L5GB 1B2XA 4CDLA 1ULJB 3L0RA 1TFKA 4FCJA 3KE7A 2XRXB 1STFI 1VQN3 1RRHA 4HM4B 4O8SA 1TU5A 2BMOB 3HOHA 1MGRA 1O7PB 1UGHI 1UCIA 1YVBI 2ZDJA 4HM7B 4N6UA 3JVCA 3PCSA 3DY5A 4IT7A 4FMDA 3RGAA 3EN1B 1RTUA 1MNLA 2YX9A 1DVCA 1Q40A 3CC23 2O9UX 2STDA 2XSOB 2Z6BA 3B7CA 3K9MC 3CMA3 1T5YA 1I0VA 1UI7A 3CPOA 5G1LA 4FCZA 4BTXA 4X2OA 3FG3A 1YIT3 1YGEA 2CKFB 2HMOB 5IENA 3B4OA 1I70A 3E99A 1EA2A 1W02A 3FG1A 3D9RA 3K63A 3NX0A 2OOVC 2WO0A 3AGNA 3D5IA 3A5EA 1BSAA 1BNIA 4N6LA 3SYUA 3U97A 3UL5A 1ZGXA 5LC7A 4CPKA 2IYJA 3D3LA 1B27A 1JKGB 1IU7A 3PXMA 1GY5A 4STDA 1BOXA 2Q07A 1IVUA 4HM1B 1FGQA 4LMIA 1BAOA 3LMLA 4X2HA 3CCS3 1YJW3 2BO9B 2B1XB 1SIIA 7STDA 1AVLA 4AKYA 1DMNA 1GY6A 2OWPA 3AHWA 4HM3B 4GB5A 1TUHA 3KSPA 1RN7A 1FW7A 3N9HA 3CCM3 9RNTA 4ILFA 1BRNL 3EJVA 2ML5A 4LZIA 3NHXA 1V58A 1FUWA 2I9WA 3MHEA 3OWUA 4L8OA 2MC8A 1I3FA 1Z1SA 4RNYA 1UI8A 1W6YA 4G1MB 5IERA 3CCQ3 2QA43 1GY7A 5CK6A 2E2UA 2QGUA 1YJN3 2IA7A 1K9M4 1IT8A 3G16A 1FZUA 1IV7A 1WMOA 4IIAA 4NHFA 3KFQC 3LH4A 2W2CA 1TTOA 2W04A 1FYSA 1Q9EA 1GOYA 1LOWA 2HMJB 3NBJA 1N8R4 1EQKA 1E97A 1UDII 3X3XA 1O7WB 1J2BA 1CEWI 1O7HB 3ZFZA 1A90A 3WR2A 1KC84 3DMCA 2XSHB 4MMYB 1RHLA 3UJMA 2D1WA 1W2B2 4XBXA 2V1LA 3LTAA 2XEPA 2OQEA 2KCDA 1US1A 5DRVA 3EC9A 8RNTA 4OK0A 3F8XA 4KVHA 1YHQ3 3Q2PA 1E3RA 1FGTA 4EW5A 1AVKA 1GS3A 3T8NA 6STDA 1RGCA 1MWSA 2Z76A 4EV5A 1M1K4 1JZDA 1BRHA 2FXTA 2QIYA 1U5OA 1YGWA 1GD4A 2CH9A 3X41A 2F86B 4HYZA 5BXQA 3I553 4BL3A 1QJGA 1R4CA 2W56A 1X1XA 2BT3A 3DH2A 2YFLB 3FSDA 3URPA 3JUNA 1VQO3 1C54A 1AY7A 3MG2A 4L8PA 1OCVA 1OF5A 5HGRA
chains in the Genus database with same CATH topology
1D6UA 3X3YA 4HM8B 1EG9B 1NO3A 1IVWA 1UUVB 3QK9A 2CHCA 4XDVA 1OHPA 2HMMB 4KZ1A 3UNLA 4EC6A 2QEX3 3S29A 2E2TA 2RGQA 3OXAA 4N6OB 2WGQA 3CNXA 4RBNA 1EKMA 1S723 5AIFA 3BLZA 3EN8A 3K7CA 1NWWA 2CFWA 3DGLA 4N6MA 3BB9A 1ZO2A 5CF1A 4L7KA 3KKGA 5AEWB 1AR0A 1LNHA 4QWTA 4HM6B 1QAKA 5AIIA 3HI7A 4XBTA 1V74A 1WMNA 4N6TA 2JQ5A 4FCMA 3PZWA 4XB5A 1Q814 1Q824 4O02B 3MWZA 2LYXA 4LSOA 2CG1A 3CME3 1GD3A 4K1UA 1A2VA 4LEHA 1OF5B 4J9AA 5EEOA 1JB2A 2FGTA 4OVMA 5AIHA 4K1VA 1VQ93 1ULIB 4TX4A 2P05A 1WTHA 4KFEA 2CK3H 3M8CA 1QALA 3EF8A 3HZPA 5KP3A 2ML6A 1HKXA 3X3ZA 3DXOA 2WOHA 1D6ZA 2XFSA 1GYBA 1JJ22 3IMAB 1OPYA 3FKAA 4HZBB 2F98A 4O2HA 5EVHA 4MEIA 3LT8A 2W03A 2XFTA 3NM7A 1KD14 2OOVA 5IG3A 4FMCA 3N54B 5CF2A 3G0KA 1AV4A 2GBWB 1SJWA 5KP4A 2IMJA 4J8TA 8CHOA 1DMMA 5D83A 1N9JA 2XF3A 4EYCA 1MOLA 3X40A 3MG1A 3Q1CA 3S67A 1Q7Y4 5FW5A 3Q90A 3G4S3 3NV0B 1W6GA 4XM4A 1VQ83 2BMQB 2CWVA 4HJLB 3FGYA 1M1XB 1W2ZA 3SVAA 1M904 3ECFA 3F40A 2KRTA 1NDOB 2A15A 4IPBA 2P38A 2UX0A 1HU9A 1SIHA 3B4PA 3B8LA 5EQLA 3MSOA 3DGNA 3WA2X 2WGOA 3H51A 4ZM8A 3S28A 1YJ93 2CFKA 3NQYA 3H3HA 5IG0A 1JB5A 4RZMA 3UB1A 1O7NB 1KWIA 3DM8A 1W5ZA 4NREA 2L4VA 3SX1A 4EV2A 3BNBA 1VQM3 3LXUX 3DGMA 3HIIA 1OACA 1M9GA 3WDGB 3G8ZA 4WP5A 3U1WA 3LZAA 1YIJ3 3CC43 2CFDA 4KFFA 4LGQA 5JPUA 2C10A 2JDIH 3CCR3 1PFPA 1Y4KA 4FR9A 3RGRA 1WQLB 3SOYA 5FGOA 2W9PA 3CCE3 5JPPA 2WOFA 4MMZB 3PYJA 4R80A 3FF2A 1VQ73 1IQXA 5KP1A 3I563 4R9KA 3EHCA 1QAFA 3CXC2 1WNHA 1WMPA 1DMQA 2F99A 2HMLB 5TGNA 4HZ9B 3EBTA 4HBRA 2XR8B 5IEOA 1TIJA 2INXA 3LT9A 2GU3A 1CYVA 2XGLA 2HMKB 1ROAA 3NQZA 3F7SA 3G6E3 1FGRA 2CWUA 3FCSB 2XH9A 2Y73A 1W01A 3EB8A 2IUKA 3CNMA 1DYUA 1VQK3 4HM5B 3DGOA 4KFDA 1IVVA 3CC73 3KZTA 3NUVA 3JUQA 3SXXA 1K8A4 4N6V0 2GXFA 3X42A 3CPW2 3MPHA 1ZX2A 2P0XA 3ALAA 3GWRA 3V92A 2ZL8A 1K734 1TFOA 5A0OB 2PZVA 1N5PA 1K28A 1OH0A 2FNQA 4R4KA 1NU3A 3SOAA 1CQSA 3CCJ3 3BNEA 2W0QA 1IDPA 3PGBA 3NV0A 2BHMA 2YFIB 3IJEB 4Q53A 2W6JH 3AMOB 4JRFA 4EXRA 4BTYA 5IW9A 2RCDA 2P09A 4N6NB 1JRQA 1STDA 3FF0A 2O3OA 4HVNA 3S5CA 1JN5A 2XGNA 2Z7AA 1ASKA 1G96A 3KSED 1QMAA 1RKYA 1K41A 3MKIA 1NB5I 5D82A 3FZWA 1N9EA 3T8UA 4N3VA 3J7Yd 3GRDA 3S27A 3V99A 1FA3A 1LOXA 1IT7A 2KXGA 3BNDA 2SBLA 1VQP3 3GZRA 1JNQA 3QRDA 4AEQA 1RRLA 3ER7A 5IG4A 3VSYA 1W00A 1D6YA 4CCVA 3EBYA 3PCRA 3HK4A 2GBXB 1VQL3 2LQVA 1OUNA 3K5TA 3JUMA 5ELUA 4HKVB 5I97A 3DUKA 1ISKA 4WYKA 1E3VA 2K54A 3LYGA 5ELJA 3WOEB 4PEJA 1JN5B 4MMXB 5IG5A 1OGZA 1YI23 2OTL3 3MG3A 3OV4A 1SPUA 3JUOA 1A2KA 5CLKA 1OGXA 1TP6A 1KSIA 1CYUA 5D81A 1DVDA 3WOFB 4WWUC 2CIUA 3F7XA 3EE1A 4FMAA 2B24B 3EQQB 3OW22 2P0MA 2OCTA 1N5HA 3IPTA 4ORLA 2GEXA 4H61A 2CG0A 5CXOA 2D42A 2RFRA 1A67A 1N8QA 1VZZA 3TDGA 1JB4A 1UW1A 1Q40B 2E2VA 2GU1A 3CCV3 4R9LA 5LC6A 1SQWA 3F9SA 1Q864 3A76A 3BNCA 2Z77A 3NBBA 4I4KA 4U13A 5AI1A 3SEDA 3VF1A 3I0YA 1FGOA 4BTWA 1OHOA 3KN4A 2CC3A 5STDA 1O7GB 2YFJB 3CCL3 3GZBA 3KIIA 3F8HA 4WYKB 4XBYA 5AIGA 2K0MA 4GL6A 1VQ43 1W4NA 3NBRA 1IV9A 1VQ63 1QVG2 2OQEC 5BVBA 3AMOA 3MYTA 1LVNA 1LXEA 3GZXB 3T0UA 4AKZA 3WODG 1QVF2 3VGNA 2CFGA 1UUWB 1FGMA 2BNGA 2HMNB 1U8CB 3F14A 3FG4A 3PS8A 4WHAA 1C7HA 1Q42A 1VQ53 4RNZA 2PNCA 1JV2B 5AEUB 4HM0B 2BMRB 3NXJA 2CFLA 3CCU3 3ROBA 5JBSA 1IK3A 3JUPA 1W7CA 2CW9A 1ROVA 2W9QA 2MF7A 1NB3I 3LTCA 5G2GA 2CWTA 3HIGA 3GAXA 4XDWA 1IQ8A 1O7MB 1RJOA 3OX9A 1KQS2 4H3UA 3N8BA 1PU4A 3G713 3EX9A 3STDA 2C11A 3HX8A 3LOYA 4K61A 2RSXA 3FLJA 3K0ZA 2GEYA 3V98A 2OTJ3 4HM2B 3CD63 2R4IA 3DZLA 1S5AA 3CU3A 3OWSA 1OHSA 2IUJA 4O3VA 1NJI4 3RDEA 4K90B 1BUQA 3O8YA 5DREA 3FH1A 3LTDA 4OUQA 1F8NA 5AYRB 4EBGA 3NM2A 3WMDA 2M7OA 1W6CA 4MJDA 5AYSC 5IEPA 4JF8A 4R1KA 3UL6A 3SLUA 4FMBA 5IF6A 4WFOA 1IQYA 3LTBA 1JKGA 1IVXA 2Y74A 3OWYA 3WA3A 2W56B 3GZYB 1L5GB 4CDLA 1ULJB 3L0RA 1TFKA 4FCJA 3KE7A 2XRXB 1STFI 1VQN3 1RRHA 4HM4B 4O8SA 1TU5A 2BMOB 1O7PB 1YVBI 2ZDJA 4HM7B 4N6UA 3JVCA 3PCSA 3DY5A 4IT7A 4FMDA 3RGAA 3EN1B 1MNLA 2YX9A 1DVCA 1Q40A 3CC23 2O9UX 2STDA 2Z6BA 2XSOB 3B7CA 3K9MC 3CMA3 1T5YA 1UI7A 3CPOA 4FCZA 4BTXA 4X2OA 3FG3A 1YIT3 1YGEA 2CKFB 2HMOB 5IENA 3B4OA 3E99A 3K63A 1EA2A 1W02A 3FG1A 3D9RA 3NX0A 2OOVC 2WO0A 4N6LA 3U97A 3UL5A 5LC7A 3D3LA 1JKGB 1IU7A 3PXMA 1GY5A 4STDA 2Q07A 1IVUA 4HM1B 1FGQA 4LMIA 3CCS3 3LMLA 4X2HA 1YJW3 2BO9B 2B1XB 1SIIA 7STDA 1AVLA 4AKYA 1DMNA 1GY6A 2OWPA 4HM3B 4GB5A 1TUHA 3KSPA 1RN7A 3N9HA 3CCM3 3EJVA 2ML5A 4LZIA 3NHXA 1FUWA 2I9WA 3MHEA 3OWUA 4L8OA 2MC8A 2QA43 1Z1SA 4RNYA 1UI8A 1W6YA 4G1MB 5IERA 3CCQ3 1GY7A 5CK6A 2E2UA 2QGUA 1YJN3 2IA7A 1K9M4 1IT8A 3G16A 1IV7A 1WMOA 4IIAA 4NHFA 3KFQC 3LH4A 2W2CA 2W04A 3NBJA 2HMJB 1N8R4 1EQKA 1E97A 3X3XA 1O7WB 1J2BA 1CEWI 1O7HB 1A90A 1KC84 3DMCA 2XSHB 4MMYB 1W2B2 3UJMA 2D1WA 4XBXA 2V1LA 3LTAA 2XEPA 2OQEA 2KCDA 1US1A 5DRVA 3EC9A 4OK0A 3F8XA 4KVHA 1YHQ3 3Q2PA 1E3RA 1FGTA 1AVKA 1GS3A 3T8NA 6STDA 2Z76A 4EV5A 1M1K4 2FXTA 2QIYA 1U5OA 3X41A 1GD4A 2CH9A 2F86B 4HYZA 5BXQA 3I553 1QJGA 1R4CA 2W56A 2BT3A 2YFLB 3FSDA 1VQO3 3JUNA 3MG2A 4L8PA 1OCVA 1OF5A 5HGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P05 A;  2P0X A;  3LTB A;  3LT9 A;  3LTA A;  2P09 A;  3DGN A;  3LTC A;  3LTD A;  1UW1 A;  3DGO A;  3DGM A;  3DGL A;  3LT8 A; 
#chains in the Genus database with same CATH topology
 1D6U A;  3X3Y A;  4HM8 B;  1EG9 B;  1NO3 A;  1IVW A;  1UUV B;  2H0H A;  3QK9 A;  2CHC A;  4XDV A;  1OHP A;  2HMM B;  1B2U A;  4KZ1 A;  3UNL A;  1BNG A;  1X1Y A;  4EC6 A;  3S29 A;  2QEX 3;  2E2T A;  2RGQ A;  3OXA A;  4N6O B;  1UGI A;  2IY2 A;  2WGQ A;  3CNX A;  1AQZ A;  1EKM A;  4RBN A;  1B2Z A;  4BL2 A;  5BU4 A;  1I0X A;  5AIF A;  1S72 3;  3BLZ A;  3EN8 A;  4LYL B;  3K7C A;  1NWW A;  2CFW A;  2KF4 A;  2R41 A;  2BU4 A;  3DGL A;  4N6M A;  4BIR A;  3BB9 A;  1ZO2 A;  5CF1 A;  2F56 A;  3KKG A;  4L7K A;  5AEW B;  1AR0 A;  1LNH A;  4QWT A;  4HM6 B;  1QAK A;  5M18 A;  5AII A;  5HOH A;  3HI7 A;  4XBT A;  1V74 A;  1WMN A;  2RBI A;  1EUI C;  1BAN A;  4N6T A;  2JQ5 A;  1X1U A;  3PZW A;  4FCM A;  1RGG A;  1RGL A;  4XB5 A;  1R4Y A;  3Q3F A;  1Q81 4;  1Q82 4;  4O02 B;  3MWZ A;  2LYX A;  4LSO A;  2CG1 A;  1RN1 A;  1GD3 A;  1RGE A;  1A2V A;  4K1U A;  1OF5 B;  4J9A A;  4LEH A;  5EEO A;  1JB2 A;  2FGT A;  2RNT A;  4OVM A;  5AIH A;  4K1V A;  1VQ9 3;  1ULI B;  4TX4 A;  1I2F A;  2P05 A;  3AHS A;  1WTH A;  4KFE A;  5G1K A;  2CK3 H;  1LQM B;  3M8C A;  1QAL A;  3EF8 A;  3HZP A;  5KP3 A;  2ML6 A;  1MWR A;  1HKX A;  3DGY A;  3X3Z A;  1RSN A;  3DXO A;  2WOH A;  1D6Z A;  2XFS A;  1GYB A;  1MWU A;  1JJ2 2;  3IMA B;  4J5K A;  1OPY A;  3FKA A;  4HZB B;  2F98 A;  4O2H A;  2K3D A;  4MEI A;  5EVH A;  3LT8 A;  2W03 A;  2XFT A;  2AAE A;  3NM7 A;  1KD1 4;  5RNT A;  2OOV A;  1B2S A;  5IG3 A;  4FMC A;  3N54 B;  5CF2 A;  3G0K A;  1AV4 A;  1ZS7 A;  1SJW A;  2F5M A;  2GBW B;  5KP4 A;  1BSD A;  2IMJ A;  4J8T A;  8CHO A;  1UCJ A;  1DMM A;  5D83 A;  1N9J A;  2XF3 A;  4EYC A;  1MOL A;  1VQQ A;  3X40 A;  1FUT A;  3MG1 A;  3Q1C A;  3S67 A;  1RGF A;  3Q90 A;  5FW5 A;  3G4S 3;  1Q7Y 4;  3NV0 B;  1W6G A;  1BIR A;  4XM4 A;  1VQ8 3;  2BMQ B;  1G0T A;  2CWV A;  3BU4 A;  3FGY A;  1M1X B;  4HJL B;  1W2Z A;  1JBS A;  3SVA A;  1M90 4;  3ECF A;  3F40 A;  2KRT A;  1BNJ A;  1NDO B;  2A15 A;  4IPB A;  2P38 A;  2UX0 A;  4DKI A;  1HU9 A;  1NNV A;  1HZ1 A;  1SIH A;  3B4P A;  3B8L A;  5EQL A;  3MSO A;  3DGN A;  3WA2 X;  1TRQ A;  2WGO A;  6GSP A;  3H51 A;  4ZM8 A;  3S28 A;  3RNT A;  1RCL A;  2CFK A;  1YJ9 3;  2GSP A;  3NQY A;  3H3H A;  3D79 A;  3CME 3;  5IG0 A;  1JB5 A;  4RZM A;  1GMP A;  3UB1 A;  1O7N B;  1KWI A;  1YVS A;  1W5Z A;  1UCL A;  2L4V A;  3DM8 A;  4NRE A;  3BNB A;  3SX1 A;  4EV2 A;  4HAA A;  1VQM 3;  3LXU X;  1LOV A;  1BUJ A;  3DGM A;  3HII A;  1OAC A;  1M9G A;  3WDG B;  3G8Z A;  4J5G A;  4WP5 A;  3U1W A;  1RNT A;  1B2M A;  3LZA A;  2ZA4 A;  1YIJ 3;  2H0G A;  3CC4 3;  2CFD A;  4KFF A;  4LGQ A;  5JPU A;  2C10 A;  2JDI H;  7RNT A;  3CCR 3;  1PFP A;  1Y4K A;  4FR9 A;  3RGR A;  1WQL B;  3SOY A;  5FGO A;  1BRJ A;  2W9P A;  1GMR A;  4GHO A;  3CCE 3;  4RNT A;  1DE3 A;  2H0I A;  5JPP A;  2WOF A;  4MMZ B;  4CJN A;  3PYJ A;  4R80 A;  3FF2 A;  1IYY A;  1VQ7 3;  1IQX A;  5KP1 A;  3I56 3;  1GMQ A;  1Q7H A;  4R9K A;  3EHC A;  1GOU A;  1QAF A;  3CXC 2;  1WNH A;  1WMP A;  1DMQ A;  1BSE A;  1X1W A;  2F99 A;  2HML B;  5TGN A;  4HZ9 B;  3ZG0 A;  3EBT A;  2UUG C;  4HBR A;  2XR8 B;  5IEO A;  1TIJ A;  2INX A;  3LT9 A;  1BRG A;  2GU3 A;  1CYV A;  2XGL A;  2HMK B;  1ROA A;  3NQZ A;  3F7S A;  1T3B A;  3G6E 3;  1FGR A;  2CWU A;  3FCS B;  2XH9 A;  2Y73 A;  1W01 A;  3AGO A;  2IUK A;  3EB8 A;  2OTJ 3;  1TJD A;  3CNM A;  1DYU A;  1VQK 3;  4HM5 B;  3DGO A;  4KFD A;  1IVV A;  1T2I A;  1LNI A;  2ZHX B;  3CC7 3;  3KZT A;  3NUV A;  3JUQ A;  3SXX A;  1K8A 4;  4N6V 0;  2GXF A;  3X42 A;  2C4B A;  3CPW 2;  3MPH A;  1ZX2 A;  2P0X A;  3ALA A;  3GWR A;  3V92 A;  2ZL8 A;  1K73 4;  1TFO A;  2BIR A;  5A0O B;  2PZV A;  1N5P A;  1K28 A;  1OH0 A;  2CX1 A;  2FNQ A;  4GSP A;  1NU3 A;  4R4K A;  3SOA A;  1CQS A;  3CCJ 3;  3BNE A;  2W0Q A;  1IDP A;  3PGB A;  3NV0 A;  2BHM A;  2YFI B;  3IJE B;  2CX0 A;  2F5W A;  4Q53 A;  2W6J H;  3AMO B;  4JRF A;  4EXR A;  1BRS A;  1V57 A;  1RGK A;  4BTY A;  5IW9 A;  2RCD A;  2P09 A;  4N6N B;  1JRQ A;  1STD A;  3FF0 A;  2O3O A;  4HVN A;  1RCK A;  1G02 A;  3S5C A;  1JN5 A;  2XGN A;  2Z7A A;  1JBT A;  1ASK A;  1G96 A;  1RLS A;  3KSE D;  1RDS A;  1A2P A;  1QMA A;  1RKY A;  1K41 A;  1DET A;  3MKI A;  1BNE A;  1RMS A;  1NB5 I;  5D82 A;  3FZW A;  1N9E A;  3T8U A;  4N3V A;  4HOH A;  3J7Y d;  3GRD A;  3S27 A;  2KAA A;  3V99 A;  1FA3 A;  1LOX A;  1IT7 A;  2KXG A;  1PY3 A;  3BND A;  2SBL A;  1VQP 3;  3GZR A;  1JNQ A;  3QRD A;  4AEQ A;  1RRL A;  3KCH A;  3ER7 A;  2KF3 A;  5IG4 A;  3VSY A;  1TRP A;  1W00 A;  1D6Y A;  4CCV A;  3EBY A;  3PCR A;  3HK4 A;  2GBX B;  1BNS A;  1VQL 3;  2LQV A;  1OUN A;  2UGI A;  3JUM A;  3K5T A;  4HKV B;  5ELU A;  3DUK A;  5BIR A;  5I97 A;  1ISK A;  3D5G A;  1B20 A;  1I2G A;  4WYK A;  1E3V A;  2K54 A;  3LYG A;  5ELJ A;  1BSC A;  3WOE B;  4PEJ A;  1JN5 B;  2KF5 A;  1RN4 A;  4MMX B;  5IG5 A;  1OGZ A;  1YI2 3;  2OTL 3;  3MG3 A;  1BRI A;  1UUG B;  3OV4 A;  4KT3 B;  1SPU A;  3JUO A;  1A2K A;  5CLK A;  1OGX A;  1TP6 A;  1KSI A;  1CYU A;  5D81 A;  1DVD A;  3WOF B;  2AAD A;  4WWU C;  2CIU A;  3F7X A;  3EE1 A;  1BSB A;  4FMA A;  2B24 B;  3EQQ B;  3OW2 2;  2J8X B;  1LQG C;  2P0M A;  2OCT A;  1N5H A;  3IPT A;  1BGS A;  2GEX A;  4H61 A;  4ORL A;  2CG0 A;  5CXO A;  2D42 A;  2RFR A;  1MGW A;  1A67 A;  1N8Q A;  1VZZ A;  4NPB A;  3TDG A;  1JB4 A;  1HYF A;  1UW1 A;  1Q40 B;  2E2V A;  2GU1 A;  3CCV 3;  4R9L A;  5LC6 A;  1SQW A;  2L1S A;  3F9S A;  1Q86 4;  3A76 A;  3BNC A;  2Z77 A;  3NBB A;  4I4K A;  4U13 A;  5AI1 A;  3SED A;  3VF1 A;  3I0Y A;  1FGO A;  4BTW A;  1OHO A;  3KN4 A;  2CC3 A;  3D4A A;  5STD A;  1O7G B;  1UCK A;  2YFJ B;  3CCL 3;  3GZB A;  2SAR A;  1RGH A;  3KII A;  3F8H A;  4WYK B;  4XBY A;  1T2H A;  2K0M A;  5AIG A;  1EEJ A;  4GL6 A;  1VQ4 3;  1I3I A;  1W4N A;  4BU4 A;  1BVI A;  3NBR A;  1IV9 A;  1VQ6 3;  1QVG 2;  2OQE C;  1PYL A;  5M1A A;  1FUS A;  5BVB A;  3AMO A;  3MYT A;  1LVN A;  1LXE A;  3GZX B;  3T0U A;  4AKZ A;  3WOD G;  1QVF 2;  3BIR A;  3VGN A;  2CFG A;  1LOY A;  1UUW B;  1FGM A;  2BNG A;  2HMN B;  1LRA A;  1U8C B;  3F14 A;  3FG4 A;  3PS8 A;  4WHA A;  1I8V A;  1C7H A;  1Q42 A;  7GSP A;  1VQ5 3;  1BNF A;  4RNZ A;  2PNC A;  1JV2 B;  5AEU B;  4HM0 B;  5GSP A;  2HOH A;  1MWT A;  2BMR B;  3NXJ A;  1B21 A;  2CFL A;  3CCU 3;  3ROB A;  5JBS A;  1IK3 A;  3JUP A;  1GOV A;  1W7C A;  2CW9 A;  1ROV A;  2W9Q A;  1SAR A;  2MF7 A;  1NB3 I;  5M19 A;  3LTC A;  5G2G A;  2CWT A;  3HIG A;  3GAX A;  1RNB A;  3GSP A;  4XDW A;  2F4Y A;  3ZG5 A;  1IQ8 A;  1BRK A;  1O7M B;  1RJO A;  3OX9 A;  1KQS 2;  4H3U A;  3N8B A;  1PU4 A;  3G71 3;  3EX9 A;  3STD A;  2C11 A;  3HX8 A;  1BU4 A;  3LOY A;  2RSX A;  2KF6 A;  3FLJ A;  2GEY A;  3K0Z A;  4I5Q A;  4HM2 B;  4K61 A;  2R4I A;  3V98 A;  3CD6 3;  3DZL A;  3WHO A;  1S5A A;  3CU3 A;  3OWS A;  1OHS A;  2IUJ A;  6RNT A;  4O3V A;  1NJI 4;  3RDE A;  1I2E A;  4K90 B;  1BUQ A;  3O8Y A;  5DRE A;  3FH1 A;  3LTD A;  4OUQ A;  1F8N A;  5AYR B;  1B3S A;  1RGA A;  4EBG A;  3NM2 A;  3WMD A;  2M7O A;  1W6C A;  4MJD A;  5AYS C;  5IEP A;  1CH0 A;  4JF8 A;  4R1K A;  3UL6 A;  3SLU A;  4FMB A;  5IF6 A;  1GSP A;  1YNV X;  1IQY A;  4WFO A;  1JBR A;  3LTB A;  1JKG A;  1BNR A;  1IVX A;  2Y74 A;  3OWY A;  3WA3 A;  2W56 B;  3GZY B;  1JZO A;  1L5G B;  1B2X A;  4CDL A;  1ULJ B;  3L0R A;  1TFK A;  4FCJ A;  3KE7 A;  2XRX B;  1STF I;  1VQN 3;  1RRH A;  4HM4 B;  4O8S A;  1TU5 A;  2BMO B;  3HOH A;  1MGR A;  1O7P B;  1UGH I;  1UCI A;  1YVB I;  2ZDJ A;  4HM7 B;  4N6U A;  3JVC A;  3PCS A;  3DY5 A;  4IT7 A;  4FMD A;  3RGA A;  3EN1 B;  1RTU A;  1MNL A;  2YX9 A;  1DVC A;  1Q40 A;  3CC2 3;  2O9U X;  2STD A;  2XSO B;  2Z6B A;  3B7C A;  3K9M C;  3CMA 3;  1T5Y A;  1I0V A;  1UI7 A;  3CPO A;  5G1L A;  4FCZ A;  4BTX A;  4X2O A;  3FG3 A;  1YIT 3;  1YGE A;  2CKF B;  2HMO B;  5IEN A;  3B4O A;  1I70 A;  3E99 A;  1EA2 A;  1W02 A;  3FG1 A;  3D9R A;  3K63 A;  3NX0 A;  2OOV C;  2WO0 A;  3AGN A;  3D5I A;  3A5E A;  1BSA A;  1BNI A;  4N6L A;  3SYU A;  3U97 A;  3UL5 A;  1ZGX A;  5LC7 A;  4CPK A;  2IYJ A;  3D3L A;  1B27 A;  1JKG B;  1IU7 A;  3PXM A;  1GY5 A;  4STD A;  1BOX A;  2Q07 A;  1IVU A;  4HM1 B;  1FGQ A;  4LMI A;  1BAO A;  3LML A;  4X2H A;  3CCS 3;  1YJW 3;  2BO9 B;  2B1X B;  1SII A;  7STD A;  1AVL A;  4AKY A;  1DMN A;  1GY6 A;  2OWP A;  3AHW A;  4HM3 B;  4GB5 A;  1TUH A;  3KSP A;  1RN7 A;  1FW7 A;  3N9H A;  3CCM 3;  9RNT A;  4ILF A;  1BRN L;  3EJV A;  2ML5 A;  4LZI A;  3NHX A;  1V58 A;  1FUW A;  2I9W A;  3MHE A;  3OWU A;  4L8O A;  2MC8 A;  1I3F A;  1Z1S A;  4RNY A;  1UI8 A;  1W6Y A;  4G1M B;  5IER A;  3CCQ 3;  2QA4 3;  1GY7 A;  5CK6 A;  2E2U A;  2QGU A;  1YJN 3;  2IA7 A;  1K9M 4;  1IT8 A;  3G16 A;  1FZU A;  1IV7 A;  1WMO A;  4IIA A;  4NHF A;  3KFQ C;  3LH4 A;  2W2C A;  1TTO A;  2W04 A;  1FYS A;  1Q9E A;  1GOY A;  1LOW A;  2HMJ B;  3NBJ A;  1N8R 4;  1EQK A;  1E97 A;  1UDI I;  3X3X A;  1O7W B;  1J2B A;  1CEW I;  1O7H B;  3ZFZ A;  1A90 A;  3WR2 A;  1KC8 4;  3DMC A;  2XSH B;  4MMY B;  1RHL A;  3UJM A;  2D1W A;  1W2B 2;  4XBX A;  2V1L A;  3LTA A;  2XEP A;  2OQE A;  2KCD A;  1US1 A;  5DRV A;  3EC9 A;  8RNT A;  4OK0 A;  3F8X A;  4KVH A;  1YHQ 3;  3Q2P A;  1E3R A;  1FGT A;  4EW5 A;  1AVK A;  1GS3 A;  3T8N A;  6STD A;  1RGC A;  1MWS A;  2Z76 A;  4EV5 A;  1M1K 4;  1JZD A;  1BRH A;  2FXT A;  2QIY A;  1U5O A;  1YGW A;  1GD4 A;  2CH9 A;  3X41 A;  2F86 B;  4HYZ A;  5BXQ A;  3I55 3;  4BL3 A;  1QJG A;  1R4C A;  2W56 A;  1X1X A;  2BT3 A;  3DH2 A;  2YFL B;  3FSD A;  3URP A;  3JUN A;  1VQO 3;  1C54 A;  1AY7 A;  3MG2 A;  4L8P A;  1OCV A;  1OF5 A;  5HGR A; 
#chains in the Genus database with same CATH homology
 1D6U A;  3X3Y A;  4HM8 B;  1EG9 B;  1NO3 A;  1IVW A;  1UUV B;  3QK9 A;  2CHC A;  4XDV A;  1OHP A;  2HMM B;  4KZ1 A;  3UNL A;  4EC6 A;  2QEX 3;  3S29 A;  2E2T A;  2RGQ A;  3OXA A;  4N6O B;  2WGQ A;  3CNX A;  4RBN A;  1EKM A;  1S72 3;  5AIF A;  3BLZ A;  3EN8 A;  3K7C A;  1NWW A;  2CFW A;  3DGL A;  4N6M A;  3BB9 A;  1ZO2 A;  5CF1 A;  4L7K A;  3KKG A;  5AEW B;  1AR0 A;  1LNH A;  4QWT A;  4HM6 B;  1QAK A;  5AII A;  3HI7 A;  4XBT A;  1V74 A;  1WMN A;  4N6T A;  2JQ5 A;  4FCM A;  3PZW A;  4XB5 A;  1Q81 4;  1Q82 4;  4O02 B;  3MWZ A;  2LYX A;  4LSO A;  2CG1 A;  3CME 3;  1GD3 A;  4K1U A;  1A2V A;  4LEH A;  1OF5 B;  4J9A A;  5EEO A;  1JB2 A;  2FGT A;  4OVM A;  5AIH A;  4K1V A;  1VQ9 3;  1ULI B;  4TX4 A;  2P05 A;  1WTH A;  4KFE A;  2CK3 H;  3M8C A;  1QAL A;  3EF8 A;  3HZP A;  5KP3 A;  2ML6 A;  1HKX A;  3X3Z A;  3DXO A;  2WOH A;  1D6Z A;  2XFS A;  1GYB A;  1JJ2 2;  3IMA B;  1OPY A;  3FKA A;  4HZB B;  2F98 A;  4O2H A;  5EVH A;  4MEI A;  3LT8 A;  2W03 A;  2XFT A;  3NM7 A;  1KD1 4;  2OOV A;  5IG3 A;  4FMC A;  3N54 B;  5CF2 A;  3G0K A;  1AV4 A;  2GBW B;  1SJW A;  5KP4 A;  2IMJ A;  4J8T A;  8CHO A;  1DMM A;  5D83 A;  1N9J A;  2XF3 A;  4EYC A;  1MOL A;  3X40 A;  3MG1 A;  3Q1C A;  3S67 A;  1Q7Y 4;  5FW5 A;  3Q90 A;  3G4S 3;  3NV0 B;  1W6G A;  4XM4 A;  1VQ8 3;  2BMQ B;  2CWV A;  4HJL B;  3FGY A;  1M1X B;  1W2Z A;  3SVA A;  1M90 4;  3ECF A;  3F40 A;  2KRT A;  1NDO B;  2A15 A;  4IPB A;  2P38 A;  2UX0 A;  1HU9 A;  1SIH A;  3B4P A;  3B8L A;  5EQL A;  3MSO A;  3DGN A;  3WA2 X;  2WGO A;  3H51 A;  4ZM8 A;  3S28 A;  1YJ9 3;  2CFK A;  3NQY A;  3H3H A;  5IG0 A;  1JB5 A;  4RZM A;  3UB1 A;  1O7N B;  1KWI A;  3DM8 A;  1W5Z A;  4NRE A;  2L4V A;  3SX1 A;  4EV2 A;  3BNB A;  1VQM 3;  3LXU X;  3DGM A;  3HII A;  1OAC A;  1M9G A;  3WDG B;  3G8Z A;  4WP5 A;  3U1W A;  3LZA A;  1YIJ 3;  3CC4 3;  2CFD A;  4KFF A;  4LGQ A;  5JPU A;  2C10 A;  2JDI H;  3CCR 3;  1PFP A;  1Y4K A;  4FR9 A;  3RGR A;  1WQL B;  3SOY A;  5FGO A;  2W9P A;  3CCE 3;  5JPP A;  2WOF A;  4MMZ B;  3PYJ A;  4R80 A;  3FF2 A;  1VQ7 3;  1IQX A;  5KP1 A;  3I56 3;  4R9K A;  3EHC A;  1QAF A;  3CXC 2;  1WNH A;  1WMP A;  1DMQ A;  2F99 A;  2HML B;  5TGN A;  4HZ9 B;  3EBT A;  4HBR A;  2XR8 B;  5IEO A;  1TIJ A;  2INX A;  3LT9 A;  2GU3 A;  1CYV A;  2XGL A;  2HMK B;  1ROA A;  3NQZ A;  3F7S A;  3G6E 3;  1FGR A;  2CWU A;  3FCS B;  2XH9 A;  2Y73 A;  1W01 A;  3EB8 A;  2IUK A;  3CNM A;  1DYU A;  1VQK 3;  4HM5 B;  3DGO A;  4KFD A;  1IVV A;  3CC7 3;  3KZT A;  3NUV A;  3JUQ A;  3SXX A;  1K8A 4;  4N6V 0;  2GXF A;  3X42 A;  3CPW 2;  3MPH A;  1ZX2 A;  2P0X A;  3ALA A;  3GWR A;  3V92 A;  2ZL8 A;  1K73 4;  1TFO A;  5A0O B;  2PZV A;  1N5P A;  1K28 A;  1OH0 A;  2FNQ A;  4R4K A;  1NU3 A;  3SOA A;  1CQS A;  3CCJ 3;  3BNE A;  2W0Q A;  1IDP A;  3PGB A;  3NV0 A;  2BHM A;  2YFI B;  3IJE B;  4Q53 A;  2W6J H;  3AMO B;  4JRF A;  4EXR A;  4BTY A;  5IW9 A;  2RCD A;  2P09 A;  4N6N B;  1JRQ A;  1STD A;  3FF0 A;  2O3O A;  4HVN A;  3S5C A;  1JN5 A;  2XGN A;  2Z7A A;  1ASK A;  1G96 A;  3KSE D;  1QMA A;  1RKY A;  1K41 A;  3MKI A;  1NB5 I;  5D82 A;  3FZW A;  1N9E A;  3T8U A;  4N3V A;  3J7Y d;  3GRD A;  3S27 A;  3V99 A;  1FA3 A;  1LOX A;  1IT7 A;  2KXG A;  3BND A;  2SBL A;  1VQP 3;  3GZR A;  1JNQ A;  3QRD A;  4AEQ A;  1RRL A;  3ER7 A;  5IG4 A;  3VSY A;  1W00 A;  1D6Y A;  4CCV A;  3EBY A;  3PCR A;  3HK4 A;  2GBX B;  1VQL 3;  2LQV A;  1OUN A;  3K5T A;  3JUM A;  5ELU A;  4HKV B;  5I97 A;  3DUK A;  1ISK A;  4WYK A;  1E3V A;  2K54 A;  3LYG A;  5ELJ A;  3WOE B;  4PEJ A;  1JN5 B;  4MMX B;  5IG5 A;  1OGZ A;  1YI2 3;  2OTL 3;  3MG3 A;  3OV4 A;  1SPU A;  3JUO A;  1A2K A;  5CLK A;  1OGX A;  1TP6 A;  1KSI A;  1CYU A;  5D81 A;  1DVD A;  3WOF B;  4WWU C;  2CIU A;  3F7X A;  3EE1 A;  4FMA A;  2B24 B;  3EQQ B;  3OW2 2;  2P0M A;  2OCT A;  1N5H A;  3IPT A;  4ORL A;  2GEX A;  4H61 A;  2CG0 A;  5CXO A;  2D42 A;  2RFR A;  1A67 A;  1N8Q A;  1VZZ A;  3TDG A;  1JB4 A;  1UW1 A;  1Q40 B;  2E2V A;  2GU1 A;  3CCV 3;  4R9L A;  5LC6 A;  1SQW A;  3F9S A;  1Q86 4;  3A76 A;  3BNC A;  2Z77 A;  3NBB A;  4I4K A;  4U13 A;  5AI1 A;  3SED A;  3VF1 A;  3I0Y A;  1FGO A;  4BTW A;  1OHO A;  3KN4 A;  2CC3 A;  5STD A;  1O7G B;  2YFJ B;  3CCL 3;  3GZB A;  3KII A;  3F8H A;  4WYK B;  4XBY A;  5AIG A;  2K0M A;  4GL6 A;  1VQ4 3;  1W4N A;  3NBR A;  1IV9 A;  1VQ6 3;  1QVG 2;  2OQE C;  5BVB A;  3AMO A;  3MYT A;  1LVN A;  1LXE A;  3GZX B;  3T0U A;  4AKZ A;  3WOD G;  1QVF 2;  3VGN A;  2CFG A;  1UUW B;  1FGM A;  2BNG A;  2HMN B;  1U8C B;  3F14 A;  3FG4 A;  3PS8 A;  4WHA A;  1C7H A;  1Q42 A;  1VQ5 3;  4RNZ A;  2PNC A;  1JV2 B;  5AEU B;  4HM0 B;  2BMR B;  3NXJ A;  2CFL A;  3CCU 3;  3ROB A;  5JBS A;  1IK3 A;  3JUP A;  1W7C A;  2CW9 A;  1ROV A;  2W9Q A;  2MF7 A;  1NB3 I;  3LTC A;  5G2G A;  2CWT A;  3HIG A;  3GAX A;  4XDW A;  1IQ8 A;  1O7M B;  1RJO A;  3OX9 A;  1KQS 2;  4H3U A;  3N8B A;  1PU4 A;  3G71 3;  3EX9 A;  3STD A;  2C11 A;  3HX8 A;  3LOY A;  4K61 A;  2RSX A;  3FLJ A;  3K0Z A;  2GEY A;  3V98 A;  2OTJ 3;  4HM2 B;  3CD6 3;  2R4I A;  3DZL A;  1S5A A;  3CU3 A;  3OWS A;  1OHS A;  2IUJ A;  4O3V A;  1NJI 4;  3RDE A;  4K90 B;  1BUQ A;  3O8Y A;  5DRE A;  3FH1 A;  3LTD A;  4OUQ A;  1F8N A;  5AYR B;  4EBG A;  3NM2 A;  3WMD A;  2M7O A;  1W6C A;  4MJD A;  5AYS C;  5IEP A;  4JF8 A;  4R1K A;  3UL6 A;  3SLU A;  4FMB A;  5IF6 A;  4WFO A;  1IQY A;  3LTB A;  1JKG A;  1IVX A;  2Y74 A;  3OWY A;  3WA3 A;  2W56 B;  3GZY B;  1L5G B;  4CDL A;  1ULJ B;  3L0R A;  1TFK A;  4FCJ A;  3KE7 A;  2XRX B;  1STF I;  1VQN 3;  1RRH A;  4HM4 B;  4O8S A;  1TU5 A;  2BMO B;  1O7P B;  1YVB I;  2ZDJ A;  4HM7 B;  4N6U A;  3JVC A;  3PCS A;  3DY5 A;  4IT7 A;  4FMD A;  3RGA A;  3EN1 B;  1MNL A;  2YX9 A;  1DVC A;  1Q40 A;  3CC2 3;  2O9U X;  2STD A;  2Z6B A;  2XSO B;  3B7C A;  3K9M C;  3CMA 3;  1T5Y A;  1UI7 A;  3CPO A;  4FCZ A;  4BTX A;  4X2O A;  3FG3 A;  1YIT 3;  1YGE A;  2CKF B;  2HMO B;  5IEN A;  3B4O A;  3E99 A;  3K63 A;  1EA2 A;  1W02 A;  3FG1 A;  3D9R A;  3NX0 A;  2OOV C;  2WO0 A;  4N6L A;  3U97 A;  3UL5 A;  5LC7 A;  3D3L A;  1JKG B;  1IU7 A;  3PXM A;  1GY5 A;  4STD A;  2Q07 A;  1IVU A;  4HM1 B;  1FGQ A;  4LMI A;  3CCS 3;  3LML A;  4X2H A;  1YJW 3;  2BO9 B;  2B1X B;  1SII A;  7STD A;  1AVL A;  4AKY A;  1DMN A;  1GY6 A;  2OWP A;  4HM3 B;  4GB5 A;  1TUH A;  3KSP A;  1RN7 A;  3N9H A;  3CCM 3;  3EJV A;  2ML5 A;  4LZI A;  3NHX A;  1FUW A;  2I9W A;  3MHE A;  3OWU A;  4L8O A;  2MC8 A;  2QA4 3;  1Z1S A;  4RNY A;  1UI8 A;  1W6Y A;  4G1M B;  5IER A;  3CCQ 3;  1GY7 A;  5CK6 A;  2E2U A;  2QGU A;  1YJN 3;  2IA7 A;  1K9M 4;  1IT8 A;  3G16 A;  1IV7 A;  1WMO A;  4IIA A;  4NHF A;  3KFQ C;  3LH4 A;  2W2C A;  2W04 A;  3NBJ A;  2HMJ B;  1N8R 4;  1EQK A;  1E97 A;  3X3X A;  1O7W B;  1J2B A;  1CEW I;  1O7H B;  1A90 A;  1KC8 4;  3DMC A;  2XSH B;  4MMY B;  1W2B 2;  3UJM A;  2D1W A;  4XBX A;  2V1L A;  3LTA A;  2XEP A;  2OQE A;  2KCD A;  1US1 A;  5DRV A;  3EC9 A;  4OK0 A;  3F8X A;  4KVH A;  1YHQ 3;  3Q2P A;  1E3R A;  1FGT A;  1AVK A;  1GS3 A;  3T8N A;  6STD A;  2Z76 A;  4EV5 A;  1M1K 4;  2FXT A;  2QIY A;  1U5O A;  3X41 A;  1GD4 A;  2CH9 A;  2F86 B;  4HYZ A;  5BXQ A;  3I55 3;  1QJG A;  1R4C A;  2W56 A;  2BT3 A;  2YFL B;  3FSD A;  1VQO 3;  3JUN A;  3MG2 A;  4L8P A;  1OCV A;  1OF5 A;  5HGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...