3LTDA

X-ray structure of a non-biological atp binding protein determined at 2.8 a by multi-wavelength anomalous dispersion
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltdA00
3LT9A 3LTAA 3DGNA 1UW1A 3DGMA 3DGLA 3LTBA 2P0XA 2P09A 3LT8A 3LTCA 3DGOA 2P05A 3LTDA
chains in the Genus database with same CATH superfamily
1FUSA 1TU5A 1EG9B 1W7CA 4KT3B 2H0IA 3G713 2LQVA 2CWVA 1SPUA 1JZOA 4L7KA 3G16A 1O7MB 3QK9A 1VQP3 1W02A 3LTAA 1JZDA 1LOYA 2RGQA 1W6YA 4J5KA 3ZFZA 1O7HB 4IPBA 1N5PA 1LVNA 1JB2A 5LC6A 3GSPA 5M19A 4Q53A 4FCMA 5I97A 5CLKA 1Q40B 3IPTA 1JJ22 1L5GB 5JBSA 3FSDA 3IJEB 4KVHA 1QVG2 1Y4KA 4N6UA 1B2SA 3NQYA 3MG3A 1MGWA 2CG0A 1VZZA 3OWYA 3K5TA 3LOYA 2QA43 2XR8B 4LSOA 1I2EA 1RHLA 1BSDA 1U8CB 4HM2B 3EF8A 2Q07A 2W9QA 1WQLB 1OHSA 2Z7AA 1FZUA 1VQ43 1BNFA 5EEOA 3H3HA 1BSCA 4WHAA 3DGLA 1GMQA 1YJW3 2HMKB 1TFKA 1JV2B 2BIRA 2ZL8A 1OCVA 4BTYA 1EA2A 4LYLB 5AIIA 1NDOB 1A2VA 3HIGA 3Q1CA 3AGNA 3KN4A 3Q3FA 4CPKA 4N6MA 4EYCA 1FA3A 3V92A 4O8SA 3F9SA 5AIHA 3GZYB 3NXJA 2CWUA 3WODG 3MYTA 3OWUA 2J8XB 2E2TA 2AAEA 1W5ZA 4NHFA 1JB5A 1YVBI 5AEWB 2LYXA 2W56B 4J8TA 2W56A 3NHXA 1CYVA 1MWTA 3WHOA 6RNTA 1A2PA 4RBNA 3BLZA 3STDA 3EN8A 1D6UA 4EV2A 2GXFA 2JDIH 3VF1A 3CNXA 5M18A 2KF3A 3ECFA 2JQ5A 4N6V0 1T2IA 5AYRB 3WA3A 3LT8A 2CW9A 3DXOA 4XBTA 2CFGA 3X40A 3FF2A 1DVDA 2A15A 1VQ93 2QIYA 4X2OA 1I2FA 3G0KA 2H0GA 1KWIA 1E3RA 4O02B 4HM0B 2Y74A 3GZRA 3QRDA 1BNSA 4HBRA 1GYBA 3DGYA 1NWWA 5RNTA 3NM7A 5AIFA 1Q864 2XSHB 3EE1A 3EBYA 3OWSA 5GSPA 1US1A 3NV0B 1ULIB 1I0VA 3NV0A 1BGSA 1N5HA 2SARA 1NB5I 3MKIA 1UCJA 1AY7A 4HM4B 2CX0A 1Q814 1UCKA 2GU1A 3HOHA 5CK6A 3BNCA 1IT7A 3UL5A 3F7XA 4ZM8A 1V74A 1I3IA 1RTUA 3S5CA 1RGAA 1FGOA 3S67A 1N9JA 1B3SA 1FW7A 3WOEB 4EXRA 1DMMA 1OF5A 1M904 3VGNA 1BRHA 4FMDA 2P38A 1RGEA 2XFTA 1Q9EA 3CPOA 1IQYA 1ULJB 1RGLA 4R9KA 2RSXA 1N9EA 2ML5A 1T2HA 3BNDA 4RNTA 3GZBA 2Y73A 2W6JH 1O7PB 5CXOA 3OW22 1JKGA 4MMXB 3FG3A 1VQK3 1KC84 1PY3A 2KAAA 4CDLA 2XFSA 1RGFA 5FW5A 3E99A 1UDII 2IUJA 2HMJB 1KQS2 1LXEA 1BSAA 3MWZA 4HOHA 4K1VA 3GZXB 4IIAA 1B2MA 1DE3A 1OGZA 2YFLB 3LMLA 1T5YA 3BIRA 1E97A 5IEOA 4RZMA 1R4CA 1SQWA 1IYYA 4HVNA 2WOFA 7STDA 1K28A 1QMAA 3LZAA 3RNTA 1YIJ3 4OVMA 1DYUA 1GD4A 1G02A 1M9GA 3M8CA 5FGOA 1E3VA 2WGQA 1BSEA 3CC73 1N8R4 3KFQC 2XSOB 4MEIA 3SYUA 2F99A 3SXXA 4HJLB 5D82A 2CFLA 3UB1A 1CEWI 1FYSA 1RN1A 1B27A 2ML6A 5G1LA 1CQSA 1X1WA 4NPBA 2F98A 3N54B 1SJWA 3CMA3 4STDA 1DVCA 1YIT3 3EB8A 2P05A 4O3VA 3DH2A 2GBWB 2OQEA 3F8HA 3DMCA 2CWTA 3FG1A 4XDWA 1BNIA 1Q40A 3FKAA 3CC23 4WP5A 3N9HA 1QVF2 3PZWA 1RNTA 6GSPA 1BANA 1HYFA 2W04A 3SX1A 2B1XB 3URPA 5IG5A 2W0QA 2ZDJA 1YI23 3EN1B 1RGCA 1ASKA 1W4NA 3AMOB 1IV7A 1HZ1A 1Z1SA 2KF4A 1HKXA 2XEPA 2RFRA 2MF7A 3G8ZA 3CCU3 1SIIA 1WMOA 2Z77A 2WGOA 4CCVA 1CYUA 1HU9A 1RCLA 1ZO2A 3BNBA 2KF6A 2RCDA 3KSPA 5DRVA 1G96A 3B4PA 5BU4A 1VQL3 4H3UA 3DGMA 1PFPA 5AIGA 3CCR3 1IV9A 1NNVA 1OHPA 2D42A 1JRQA 3I0YA 1Q7Y4 4FCJA 3U1WA 2XRXB 1RRHA 1A90A 1JN5B 1JN5A 4XBYA 3GAXA 4R80A 3CCL3 2C10A 1BNRA 3X3ZA 1MWSA 1AVKA 3GRDA 5DREA 2FNQA 2L4VA 2UX0A 3ZG0A 3G4S3 1M1K4 1A67A 3AGOA 1I0XA 2BMRB 1GS3A 5IG3A 4RNZA 1UGIA 4HM3B 1MNLA 1OH0A 5STDA 3NUVA 2B24B 3B7CA 3KSED 5IG0A 4HM8B 1T3BA 1CH0A 4FMAA 5HGRA 1S723 1OUNA 2CX1A 8CHOA 2R4IA 3JUQA 4CJNA 3CPW2 3K0ZA 1O7NB 3X3YA 1K41A 1QJGA 1RDSA 2XH9A 3A5EA 3D5GA 4NREA 3WMDA 1MOLA 1TUHA 3CCQ3 1RRLA 1VQ83 2QEX3 4WFOA 4FMBA 1X1YA 4O2HA 3H51A 4GHOA 3JUNA 5AEUB 1RGGA 5BVBA 1TTOA 2C4BA 2ZA4A 4HM6B 4LZIA 2D1WA 3OX9A 4ORLA 3WOFB 2HMOB 3NQZA 5JPUA 2INXA 3CNMA 1K734 3S28A 5IG4A 3JUMA 3BU4A 1N8QA 1BRSA 2GU3A 2UGIA 1RSNA 3FG4A 5TGNA 1VQ63 1TP6A 4LEHA 2YFJB 1DMNA 4R1KA 3T0UA 1FGTA 3ER7A 4KFEA 4EW5A 3NBRA 4DKIA 2F56A 1SARA 1BOXA 2GBXB 4TX4A 2RNTA 2FXTA 2MC8A 1UI8A 3MPHA 4R9LA 1J2BA 3NX0A 1C54A 4RNYA 3SOYA 3WDGB 3PXMA 3B4OA 1C7HA 3PGBA 5G1KA 3RGAA 1TRPA 3LYGA 5EQLA 4H61A 3CCV3 2HMNB 1UW1A 2OQEC 4JF8A 3D9RA 3LTBA 3PS8A 3MG1A 2M7OA 1FUTA 2HOHA 1IK3A 1IU7A 3OXAA 4EC6A 2BMQB 4BU4A 1MWRA 2L1SA 4XBXA 1OACA 3SLUA 1YJN3 2OTL3 3Q2PA 1YNVX 3F7SA 1ISKA 1BUQA 1LQGC 5JPPA 2CIUA 1YVSA 3DUKA 2RBIA 1BU4A 3FH1A 1DETA 5BIRA 2AADA 3O8YA 4AKZA 4HKVB 3SOAA 4K1UA 2GSPA 3T8UA 1B20A 1BSBA 1UGHI 4WYKB 5IERA 3ROBA 3S27A 3HZPA 3LTCA 1UUGB 3LH4A 1UCIA 1BRIA 2BMOB 1U5OA 5HOHA 4MJDA 3U97A 1EEJA 1RNBA 3WR2A 3TDGA 1GY5A 1FUWA 1EUIC 3EX9A 1GMPA 1RN7A 2OCTA 3GWRA 4XM4A 3S29A 4J5GA 3UNLA 7RNTA 1STFI 1I2GA 2CK3H 3JUOA 4IT7A 1JBTA 2CG1A 1BVIA 2KF5A 3EHCA 1Q824 1VQN3 4HM7B 4EBGA 1MWUA 1K8A4 3DGOA 5IW9A 3G6E3 4QWTA 1D6YA 1GY7A 2H0HA 3SVAA 2CH9A 2CHCA 2QGUA 1QALA 1OGXA 1GMRA 1UUVB 3A76A 4FCZA 1OPYA 4XB5A 3SEDA 3V99A 1ZS7A 1KSIA 3EJVA 2SBLA 5IENA 1VQQA 1BRKA 3L0RA 5AI1A 1BAOA 2F5WA 1VQ73 1FGQA 1V57A 3DM8A 3DZLA 3RDEA 1NB3I 2KRTA 3AMOA 3D79A 2BT3A 4U13A 4GB5A 1LQMB 2XGNA 4LMIA 5A0OB 1BRGA 3CCM3 3NBBA 2I9WA 3DY5A 3CU3A 2CKFB 1FGRA 3K7CA 4HM5B 2W9PA 4N3VA 4AEQA 5D83A 5LC7A 2GEXA 2F4YA 3FGYA 1RMSA 4HZ9B 5G2GA 1LOWA 1ZGXA 1I70A 2PNCA 1AVLA 2W03A 3T8NA 3UL6A 3CD63 4PEJA 3NM2A 2O3OA 3Q90A 1NO3A 1IVUA 3D3LA 4N6NB 1GOYA 2BO9B 4BTWA 1K9M4 3HIIA 4K90B 3I553 1NJI4 1QAKA 2IMJA 4KFFA 2IUKA 1YGWA 1JBSA 2IYJA 1UUWB 2Z76A 4OUQA 1GSPA 4X2HA 4BTXA 1W6GA 1YJ93 1WMNA 4N6OB 3PCSA 5IF6A 3FCSB 1VQM3 1BRNL 2IY2A 3LXUX 4HYZA 1RCKA 5D81A 1VQ53 3CCJ3 1TFOA 1B2UA 2OOVA 1IDPA 2O9UX 5AYSC 5CF2A 2C11A 4MMYB 6STDA 1AR0A 1IVXA 2K54A 2KCDA 4I5QA 3KZTA 1Q42A 1WMPA 5IEPA 3I563 2CFWA 2CC3A 2V1LA 3ZG5A 5KP3A 3BB9A 1UCLA 2CFKA 3PYJA 3J7Yd 3FLJA 3F14A 4BL2A 2E2UA 4EV5A 2F86B 1RGKA 4BIRA 2BNGA 4JRFA 4R4KA 1W2B2 1IVWA 2GEYA 4HM1B 1BIRA 1IVVA 2W2CA 4HAAA 1Q7HA 1M1XB 1A2KA 3AHWA 1BUJA 1I8VA 1GD3A 2IA7A 4WWUC 1W6CA 2YFIB 1TRQA 3KCHA 4L8PA 3CC43 1AV4A 2K3DA 1X1XA 3JUPA 1RJOA 3NBJA 3VSYA 1LOXA 4KFDA 3LTDA 1MGRA 1S5AA 2XF3A 5EVHA 1SIHA 1YHQ3 1KD14 1DMQA 1TJDA 3OV4A 3FF0A 4GL6A 1EKMA 1JNQA 1BRJA 1V58A 1ROVA 2OWPA 4J9AA 5BXQA 1EQKA 4OK0A 1B2ZA 2P0XA 3ALAA 4HZBB 5M1AA 5ELUA 3PCRA 1GY6A 1WTHA 2CFDA 3UJMA 3KE7A 1OHOA 3WA2X 1IQXA 3EBTA 1LRAA 1PYLA 3HK4A 3CXC2 3CCE3 1W00A 2HMLB 1VQO3 3D4AA 4N6TA 5CF1A 4FMCA 7GSPA 3FZWA 2OTJ3 1GOVA 3LT9A 4AKYA 3MSOA 9RNTA 1R4YA 1QAFA 1STDA 3EC9A 1ROAA 1F8NA 2F5MA 1OF5B 1B2XA 1UI7A 3X3XA 3F40A 2WOHA 5KP1A 1GOUA 1LOVA 2KXGA 4XDVA 1G0TA 2FGTA 4ILFA 1BNJA 2ZHXB 3KKGA 3JVCA 2BU4A 1W01A 3N8BA 1TIJA 4KZ1A 4WYKA 2HMMB 1JKGB 1WNHA 1NU3A 2E2VA 4FR9A 1PU4A 2STDA 8RNTA 1O7GB 5ELJA 1RLSA 2R41A 3MHEA 1RN4A 3IMAB 3DGNA 1LNIA 3AHSA 4GSPA 1RGHA 4N6LA 2BHMA 4I4KA 1FGMA 3X42A 4BL3A 1I3FA 2YX9A 1JBRA 3F8XA 3EQQB 3HI7A 2XGLA 1X1UA 1B21A 1AQZA 3K9MC 2P0MA 3K63A 3B8LA 1W2ZA 1RKYA 1IQ8A 1O7WB 3D5IA 3HX8A 2Z6BA 2WO0A 2UUGC 4LGQA 1D6ZA 4MMZB 3CCS3 1BNEA 4L8OA 5KP4A 1ZX2A 1BNGA 1LNHA 3KIIA 3RGRA 3MG2A 4K61A 3X41A 1JB4A 2OOVC 2P09A 4G1MB 3CME3 3BNEA 2PZVA 2K0MA 1IT8A 3V98A 1YGEA
chains in the Genus database with same CATH topology
1TU5A 1EG9B 1W7CA 3G713 2LQVA 2CWVA 1SPUA 4L7KA 3G16A 1O7MB 3QK9A 1VQP3 1W02A 3LTAA 2RGQA 1W6YA 1O7HB 4IPBA 1N5PA 1LVNA 1JB2A 5LC6A 4Q53A 4FCMA 5I97A 5CLKA 1Q40B 3IPTA 1JJ22 1L5GB 5JBSA 3FSDA 3IJEB 4KVHA 1QVG2 1Y4KA 4N6UA 3NQYA 3MG3A 2CG0A 1VZZA 3OWYA 3K5TA 3LOYA 2QA43 2XR8B 4LSOA 1U8CB 4HM2B 3EF8A 2Q07A 2W9QA 1WQLB 1OHSA 2Z7AA 1VQ43 5EEOA 3H3HA 4WHAA 3DGLA 1YJW3 2HMKB 1TFKA 1JV2B 2ZL8A 1OCVA 4BTYA 1EA2A 5AIIA 1NDOB 1A2VA 3HIGA 3Q1CA 3KN4A 4N6MA 4EYCA 1FA3A 3V92A 4O8SA 3F9SA 5AIHA 3GZYB 3NXJA 2CWUA 3WODG 3MYTA 3OWUA 2E2TA 1W5ZA 4NHFA 1JB5A 1YVBI 5AEWB 2LYXA 2W56B 4J8TA 2W56A 3NHXA 1CYVA 4RBNA 3BLZA 3STDA 3EN8A 1D6UA 2GXFA 2JDIH 3VF1A 3CNXA 3ECFA 2JQ5A 4N6V0 5AYRB 3WA3A 3LT8A 2CW9A 3DXOA 4XBTA 2CFGA 3X40A 3FF2A 1DVDA 2A15A 1VQ93 2QIYA 4X2OA 3G0KA 1KWIA 1E3RA 4O02B 4HM0B 2Y74A 3GZRA 3QRDA 4HBRA 1GYBA 1NWWA 1Q864 3NM7A 5AIFA 2XSHB 3EE1A 3EBYA 3OWSA 1US1A 3NV0B 1ULIB 3NV0A 1NB5I 1N5HA 3MKIA 4HM4B 1Q814 2GU1A 5CK6A 3BNCA 1IT7A 3UL5A 3F7XA 4ZM8A 1V74A 3S5CA 1FGOA 3S67A 1N9JA 3WOEB 4EXRA 1DMMA 1OF5A 1M904 3VGNA 4FMDA 2P38A 2XFTA 3CPOA 1IQYA 1ULJB 4R9KA 2RSXA 1N9EA 2ML5A 3BNDA 3GZBA 2Y73A 2W6JH 1O7PB 5CXOA 3OW22 1JKGA 4MMXB 3FG3A 1VQK3 1KC84 4CDLA 2XFSA 5FW5A 3E99A 2IUJA 2HMJB 1KQS2 1LXEA 3MWZA 4K1VA 3GZXB 4IIAA 1OGZA 2YFLB 3LMLA 1T5YA 1E97A 5IEOA 4RZMA 1R4CA 1SQWA 4HVNA 2WOFA 7STDA 1K28A 1QMAA 3LZAA 1YIJ3 4OVMA 1DYUA 1GD4A 3M8CA 1M9GA 1E3VA 2WGQA 3CC73 1N8R4 3KFQC 2XSOB 4MEIA 2F99A 3SXXA 4HJLB 5D82A 2CFLA 3UB1A 1CEWI 2ML6A 1CQSA 2F98A 3N54B 1SJWA 3CMA3 4STDA 1DVCA 1YIT3 3EB8A 2P05A 4O3VA 2OQEA 2GBWB 3F8HA 3DMCA 2CWTA 3FG1A 4XDWA 3CC23 1Q40A 3FKAA 4WP5A 3N9HA 1QVF2 3PZWA 2W04A 3SX1A 2B1XB 5IG5A 2W0QA 2ZDJA 1YI23 3EN1B 1ASKA 1W4NA 3AMOB 1IV7A 1Z1SA 2XEPA 1HKXA 2RFRA 2MF7A 3G8ZA 3CCU3 1SIIA 1WMOA 2Z77A 2WGOA 4CCVA 1CYUA 1HU9A 1ZO2A 3BNBA 2RCDA 3KSPA 5DRVA 1G96A 3B4PA 1VQL3 4H3UA 3DGMA 1PFPA 5AIGA 3CCR3 1IV9A 1OHPA 2D42A 1JRQA 3I0YA 1Q7Y4 4FCJA 3U1WA 2XRXB 1RRHA 1A90A 1JN5B 1JN5A 4XBYA 3GAXA 4R80A 3CCL3 2C10A 3X3ZA 1AVKA 3GRDA 5DREA 2UX0A 2FNQA 2L4VA 3G4S3 1M1K4 1A67A 2BMRB 1GS3A 5IG3A 4RNZA 4HM3B 1MNLA 1OH0A 5STDA 3NUVA 2B24B 3B7CA 3KSED 5IG0A 4HM8B 4FMAA 5HGRA 1S723 1OUNA 8CHOA 2R4IA 3JUQA 3CPW2 3K0ZA 1O7NB 3X3YA 1K41A 2XH9A 1QJGA 4NREA 3WMDA 3CCQ3 1VQ83 1MOLA 1TUHA 1RRLA 2QEX3 4WFOA 4FMBA 4O2HA 3H51A 5AEUB 3JUNA 5BVBA 4LZIA 4HM6B 5JPUA 2D1WA 3OX9A 4ORLA 3WOFB 2HMOB 3NQZA 2INXA 3CNMA 1K734 3S28A 5IG4A 3JUMA 1N8QA 2GU3A 5TGNA 3FG4A 1VQ63 1TP6A 4LEHA 2YFJB 1DMNA 4R1KA 3T0UA 1FGTA 3ER7A 4KFEA 3NBRA 2GBXB 4TX4A 2FXTA 2MC8A 1UI8A 3MPHA 4R9LA 1J2BA 3NX0A 4RNYA 3SOYA 3WDGB 3PXMA 3B4OA 1C7HA 3PGBA 3RGAA 3LYGA 5EQLA 3CCV3 4H61A 2HMNB 1UW1A 2OQEC 4JF8A 3D9RA 3LTBA 3PS8A 3MG1A 2M7OA 1IK3A 1IU7A 3OXAA 4EC6A 2BMQB 4XBXA 1OACA 3SLUA 1YJN3 2OTL3 3Q2PA 3F7SA 1ISKA 1BUQA 5JPPA 2CIUA 3DUKA 3FH1A 3O8YA 4AKZA 4HKVB 3SOAA 4K1UA 3T8UA 4WYKB 5IERA 3ROBA 3S27A 3HZPA 3LTCA 3LH4A 2BMOB 1U5OA 4MJDA 3U97A 3TDGA 1GY5A 3EX9A 1RN7A 2OCTA 3GWRA 4XM4A 3S29A 3UNLA 1STFI 2CK3H 4IT7A 3JUOA 2CG1A 3EHCA 1Q824 1VQN3 4HM7B 4EBGA 1K8A4 3DGOA 5IW9A 3G6E3 4QWTA 1D6YA 1GY7A 3SVAA 2CH9A 2CHCA 2QGUA 1QALA 1OGXA 1UUVB 3A76A 4FCZA 4XB5A 1OPYA 3V99A 3SEDA 3EJVA 1KSIA 2SBLA 5IENA 3L0RA 5AI1A 1VQ73 1FGQA 3DZLA 3DM8A 3RDEA 1FUWA 1NB3I 2KRTA 3AMOA 5FGOA 2BT3A 4U13A 4GB5A 4LMIA 2XGNA 5A0OB 3CCM3 3NBBA 2I9WA 3DY5A 3CU3A 2CKFB 1FGRA 3K7CA 4HM5B 2W9PA 4N3VA 4AEQA 5D83A 5LC7A 2GEXA 3FGYA 5G2GA 4HZ9B 2PNCA 1AVLA 2W03A 3T8NA 3UL6A 3CD63 4PEJA 3NM2A 2O3OA 3Q90A 1NO3A 1IVUA 3D3LA 4N6NB 2BO9B 4BTWA 1K9M4 3HIIA 4K90B 3I553 1NJI4 1QAKA 2IMJA 4KFFA 2IUKA 1UUWB 2Z76A 4OUQA 4X2HA 4BTXA 1W6GA 1YJ93 1WMNA 4N6OB 3PCSA 5IF6A 3FCSB 1VQM3 3LXUX 4HYZA 5D81A 1VQ53 3CCJ3 1TFOA 2OOVA 1IDPA 2O9UX 5AYSC 5CF2A 2C11A 4MMYB 6STDA 1AR0A 1IVXA 2K54A 2KCDA 3KZTA 1Q42A 1WMPA 5IEPA 3I563 2CFWA 2CC3A 2V1LA 5KP3A 3BB9A 2CFKA 3PYJA 3J7Yd 3FLJA 3F14A 2E2UA 4EV5A 2F86B 2BNGA 4JRFA 4R4KA 1W2B2 1IVWA 2GEYA 4HM1B 2W2CA 1IVVA 1M1XB 1A2KA 1GD3A 2IA7A 4WWUC 1W6CA 2YFIB 3CC43 4L8PA 1AV4A 3JUPA 3NBJA 1RJOA 3VSYA 1LOXA 4KFDA 3LTDA 1S5AA 2XF3A 5EVHA 1SIHA 1YHQ3 1KD14 1DMQA 3OV4A 3FF0A 4GL6A 1EKMA 1JNQA 1ROVA 2OWPA 4J9AA 5BXQA 1EQKA 4OK0A 2P0XA 3ALAA 4HZBB 5ELUA 3PCRA 1GY6A 1WTHA 2CFDA 3UJMA 3KE7A 1OHOA 3WA2X 1IQXA 3EBTA 3CXC2 3HK4A 3CCE3 1W00A 2HMLB 1VQO3 4N6TA 5CF1A 4FMCA 2OTJ3 3FZWA 3LT9A 4AKYA 3MSOA 1QAFA 1STDA 3EC9A 1ROAA 1F8NA 1OF5B 1UI7A 3X3XA 3F40A 2WOHA 5KP1A 2KXGA 4XDVA 2FGTA 3KKGA 3JVCA 3N8BA 1W01A 4KZ1A 1TIJA 4WYKA 4EV2A 2HMMB 1JKGB 1WNHA 1NU3A 2E2VA 4FR9A 1PU4A 2STDA 1O7GB 5ELJA 3MHEA 3IMAB 3DGNA 4N6LA 2BHMA 4I4KA 1FGMA 3X42A 2YX9A 3F8XA 3EQQB 3HI7A 2XGLA 3K9MC 2P0MA 3K63A 3B8LA 1W2ZA 1RKYA 1IQ8A 1O7WB 3HX8A 2Z6BA 2WO0A 4LGQA 1D6ZA 4MMZB 3CCS3 4L8OA 5KP4A 1ZX2A 1LNHA 3KIIA 3RGRA 3MG2A 4K61A 3X41A 1JB4A 2OOVC 2P09A 4G1MB 3CME3 3BNEA 2PZVA 2K0MA 1IT8A 3V98A 1YGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LT9 A;  3LTA A;  3DGN A;  1UW1 A;  3DGM A;  3DGL A;  3LTB A;  2P0X A;  2P09 A;  3LT8 A;  3LTC A;  3DGO A;  2P05 A;  3LTD A; 
#chains in the Genus database with same CATH topology
 1FUS A;  1TU5 A;  1EG9 B;  1W7C A;  4KT3 B;  2H0I A;  3G71 3;  2LQV A;  2CWV A;  1SPU A;  1JZO A;  4L7K A;  3G16 A;  1O7M B;  3QK9 A;  1VQP 3;  1W02 A;  3LTA A;  1JZD A;  1LOY A;  2RGQ A;  1W6Y A;  4J5K A;  3ZFZ A;  1O7H B;  4IPB A;  1N5P A;  1LVN A;  1JB2 A;  5LC6 A;  3GSP A;  5M19 A;  4Q53 A;  4FCM A;  5I97 A;  5CLK A;  1Q40 B;  3IPT A;  1JJ2 2;  1L5G B;  5JBS A;  3FSD A;  3IJE B;  4KVH A;  1QVG 2;  1Y4K A;  4N6U A;  1B2S A;  3NQY A;  3MG3 A;  1MGW A;  2CG0 A;  1VZZ A;  3OWY A;  3K5T A;  3LOY A;  2QA4 3;  2XR8 B;  4LSO A;  1I2E A;  1RHL A;  1BSD A;  1U8C B;  4HM2 B;  3EF8 A;  2Q07 A;  2W9Q A;  1WQL B;  1OHS A;  2Z7A A;  1FZU A;  1VQ4 3;  1BNF A;  5EEO A;  3H3H A;  1BSC A;  4WHA A;  3DGL A;  1GMQ A;  1YJW 3;  2HMK B;  1TFK A;  1JV2 B;  2BIR A;  2ZL8 A;  1OCV A;  4BTY A;  1EA2 A;  4LYL B;  5AII A;  1NDO B;  1A2V A;  3HIG A;  3Q1C A;  3AGN A;  3KN4 A;  3Q3F A;  4CPK A;  4N6M A;  4EYC A;  1FA3 A;  3V92 A;  4O8S A;  3F9S A;  5AIH A;  3GZY B;  3NXJ A;  2CWU A;  3WOD G;  3MYT A;  3OWU A;  2J8X B;  2E2T A;  2AAE A;  1W5Z A;  4NHF A;  1JB5 A;  1YVB I;  5AEW B;  2LYX A;  2W56 B;  4J8T A;  2W56 A;  3NHX A;  1CYV A;  1MWT A;  3WHO A;  6RNT A;  1A2P A;  4RBN A;  3BLZ A;  3STD A;  3EN8 A;  1D6U A;  4EV2 A;  2GXF A;  2JDI H;  3VF1 A;  3CNX A;  5M18 A;  2KF3 A;  3ECF A;  2JQ5 A;  4N6V 0;  1T2I A;  5AYR B;  3WA3 A;  3LT8 A;  2CW9 A;  3DXO A;  4XBT A;  2CFG A;  3X40 A;  3FF2 A;  1DVD A;  2A15 A;  1VQ9 3;  2QIY A;  4X2O A;  1I2F A;  3G0K A;  2H0G A;  1KWI A;  1E3R A;  4O02 B;  4HM0 B;  2Y74 A;  3GZR A;  3QRD A;  1BNS A;  4HBR A;  1GYB A;  3DGY A;  1NWW A;  5RNT A;  3NM7 A;  5AIF A;  1Q86 4;  2XSH B;  3EE1 A;  3EBY A;  3OWS A;  5GSP A;  1US1 A;  3NV0 B;  1ULI B;  1I0V A;  3NV0 A;  1BGS A;  1N5H A;  2SAR A;  1NB5 I;  3MKI A;  1UCJ A;  1AY7 A;  4HM4 B;  2CX0 A;  1Q81 4;  1UCK A;  2GU1 A;  3HOH A;  5CK6 A;  3BNC A;  1IT7 A;  3UL5 A;  3F7X A;  4ZM8 A;  1V74 A;  1I3I A;  1RTU A;  3S5C A;  1RGA A;  1FGO A;  3S67 A;  1N9J A;  1B3S A;  1FW7 A;  3WOE B;  4EXR A;  1DMM A;  1OF5 A;  1M90 4;  3VGN A;  1BRH A;  4FMD A;  2P38 A;  1RGE A;  2XFT A;  1Q9E A;  3CPO A;  1IQY A;  1ULJ B;  1RGL A;  4R9K A;  2RSX A;  1N9E A;  2ML5 A;  1T2H A;  3BND A;  4RNT A;  3GZB A;  2Y73 A;  2W6J H;  1O7P B;  5CXO A;  3OW2 2;  1JKG A;  4MMX B;  3FG3 A;  1VQK 3;  1KC8 4;  1PY3 A;  2KAA A;  4CDL A;  2XFS A;  1RGF A;  5FW5 A;  3E99 A;  1UDI I;  2IUJ A;  2HMJ B;  1KQS 2;  1LXE A;  1BSA A;  3MWZ A;  4HOH A;  4K1V A;  3GZX B;  4IIA A;  1B2M A;  1DE3 A;  1OGZ A;  2YFL B;  3LML A;  1T5Y A;  3BIR A;  1E97 A;  5IEO A;  4RZM A;  1R4C A;  1SQW A;  1IYY A;  4HVN A;  2WOF A;  7STD A;  1K28 A;  1QMA A;  3LZA A;  3RNT A;  1YIJ 3;  4OVM A;  1DYU A;  1GD4 A;  1G02 A;  1M9G A;  3M8C A;  5FGO A;  1E3V A;  2WGQ A;  1BSE A;  3CC7 3;  1N8R 4;  3KFQ C;  2XSO B;  4MEI A;  3SYU A;  2F99 A;  3SXX A;  4HJL B;  5D82 A;  2CFL A;  3UB1 A;  1CEW I;  1FYS A;  1RN1 A;  1B27 A;  2ML6 A;  5G1L A;  1CQS A;  1X1W A;  4NPB A;  2F98 A;  3N54 B;  1SJW A;  3CMA 3;  4STD A;  1DVC A;  1YIT 3;  3EB8 A;  2P05 A;  4O3V A;  3DH2 A;  2GBW B;  2OQE A;  3F8H A;  3DMC A;  2CWT A;  3FG1 A;  4XDW A;  1BNI A;  1Q40 A;  3FKA A;  3CC2 3;  4WP5 A;  3N9H A;  1QVF 2;  3PZW A;  1RNT A;  6GSP A;  1BAN A;  1HYF A;  2W04 A;  3SX1 A;  2B1X B;  3URP A;  5IG5 A;  2W0Q A;  2ZDJ A;  1YI2 3;  3EN1 B;  1RGC A;  1ASK A;  1W4N A;  3AMO B;  1IV7 A;  1HZ1 A;  1Z1S A;  2KF4 A;  1HKX A;  2XEP A;  2RFR A;  2MF7 A;  3G8Z A;  3CCU 3;  1SII A;  1WMO A;  2Z77 A;  2WGO A;  4CCV A;  1CYU A;  1HU9 A;  1RCL A;  1ZO2 A;  3BNB A;  2KF6 A;  2RCD A;  3KSP A;  5DRV A;  1G96 A;  3B4P A;  5BU4 A;  1VQL 3;  4H3U A;  3DGM A;  1PFP A;  5AIG A;  3CCR 3;  1IV9 A;  1NNV A;  1OHP A;  2D42 A;  1JRQ A;  3I0Y A;  1Q7Y 4;  4FCJ A;  3U1W A;  2XRX B;  1RRH A;  1A90 A;  1JN5 B;  1JN5 A;  4XBY A;  3GAX A;  4R80 A;  3CCL 3;  2C10 A;  1BNR A;  3X3Z A;  1MWS A;  1AVK A;  3GRD A;  5DRE A;  2FNQ A;  2L4V A;  2UX0 A;  3ZG0 A;  3G4S 3;  1M1K 4;  1A67 A;  3AGO A;  1I0X A;  2BMR B;  1GS3 A;  5IG3 A;  4RNZ A;  1UGI A;  4HM3 B;  1MNL A;  1OH0 A;  5STD A;  3NUV A;  2B24 B;  3B7C A;  3KSE D;  5IG0 A;  4HM8 B;  1T3B A;  1CH0 A;  4FMA A;  5HGR A;  1S72 3;  1OUN A;  2CX1 A;  8CHO A;  2R4I A;  3JUQ A;  4CJN A;  3CPW 2;  3K0Z A;  1O7N B;  3X3Y A;  1K41 A;  1QJG A;  1RDS A;  2XH9 A;  3A5E A;  3D5G A;  4NRE A;  3WMD A;  1MOL A;  1TUH A;  3CCQ 3;  1RRL A;  1VQ8 3;  2QEX 3;  4WFO A;  4FMB A;  1X1Y A;  4O2H A;  3H51 A;  4GHO A;  3JUN A;  5AEU B;  1RGG A;  5BVB A;  1TTO A;  2C4B A;  2ZA4 A;  4HM6 B;  4LZI A;  2D1W A;  3OX9 A;  4ORL A;  3WOF B;  2HMO B;  3NQZ A;  5JPU A;  2INX A;  3CNM A;  1K73 4;  3S28 A;  5IG4 A;  3JUM A;  3BU4 A;  1N8Q A;  1BRS A;  2GU3 A;  2UGI A;  1RSN A;  3FG4 A;  5TGN A;  1VQ6 3;  1TP6 A;  4LEH A;  2YFJ B;  1DMN A;  4R1K A;  3T0U A;  1FGT A;  3ER7 A;  4KFE A;  4EW5 A;  3NBR A;  4DKI A;  2F56 A;  1SAR A;  1BOX A;  2GBX B;  4TX4 A;  2RNT A;  2FXT A;  2MC8 A;  1UI8 A;  3MPH A;  4R9L A;  1J2B A;  3NX0 A;  1C54 A;  4RNY A;  3SOY A;  3WDG B;  3PXM A;  3B4O A;  1C7H A;  3PGB A;  5G1K A;  3RGA A;  1TRP A;  3LYG A;  5EQL A;  4H61 A;  3CCV 3;  2HMN B;  1UW1 A;  2OQE C;  4JF8 A;  3D9R A;  3LTB A;  3PS8 A;  3MG1 A;  2M7O A;  1FUT A;  2HOH A;  1IK3 A;  1IU7 A;  3OXA A;  4EC6 A;  2BMQ B;  4BU4 A;  1MWR A;  2L1S A;  4XBX A;  1OAC A;  3SLU A;  1YJN 3;  2OTL 3;  3Q2P A;  1YNV X;  3F7S A;  1ISK A;  1BUQ A;  1LQG C;  5JPP A;  2CIU A;  1YVS A;  3DUK A;  2RBI A;  1BU4 A;  3FH1 A;  1DET A;  5BIR A;  2AAD A;  3O8Y A;  4AKZ A;  4HKV B;  3SOA A;  4K1U A;  2GSP A;  3T8U A;  1B20 A;  1BSB A;  1UGH I;  4WYK B;  5IER A;  3ROB A;  3S27 A;  3HZP A;  3LTC A;  1UUG B;  3LH4 A;  1UCI A;  1BRI A;  2BMO B;  1U5O A;  5HOH A;  4MJD A;  3U97 A;  1EEJ A;  1RNB A;  3WR2 A;  3TDG A;  1GY5 A;  1FUW A;  1EUI C;  3EX9 A;  1GMP A;  1RN7 A;  2OCT A;  3GWR A;  4XM4 A;  3S29 A;  4J5G A;  3UNL A;  7RNT A;  1STF I;  1I2G A;  2CK3 H;  3JUO A;  4IT7 A;  1JBT A;  2CG1 A;  1BVI A;  2KF5 A;  3EHC A;  1Q82 4;  1VQN 3;  4HM7 B;  4EBG A;  1MWU A;  1K8A 4;  3DGO A;  5IW9 A;  3G6E 3;  4QWT A;  1D6Y A;  1GY7 A;  2H0H A;  3SVA A;  2CH9 A;  2CHC A;  2QGU A;  1QAL A;  1OGX A;  1GMR A;  1UUV B;  3A76 A;  4FCZ A;  1OPY A;  4XB5 A;  3SED A;  3V99 A;  1ZS7 A;  1KSI A;  3EJV A;  2SBL A;  5IEN A;  1VQQ A;  1BRK A;  3L0R A;  5AI1 A;  1BAO A;  2F5W A;  1VQ7 3;  1FGQ A;  1V57 A;  3DM8 A;  3DZL A;  3RDE A;  1NB3 I;  2KRT A;  3AMO A;  3D79 A;  2BT3 A;  4U13 A;  4GB5 A;  1LQM B;  2XGN A;  4LMI A;  5A0O B;  1BRG A;  3CCM 3;  3NBB A;  2I9W A;  3DY5 A;  3CU3 A;  2CKF B;  1FGR A;  3K7C A;  4HM5 B;  2W9P A;  4N3V A;  4AEQ A;  5D83 A;  5LC7 A;  2GEX A;  2F4Y A;  3FGY A;  1RMS A;  4HZ9 B;  5G2G A;  1LOW A;  1ZGX A;  1I70 A;  2PNC A;  1AVL A;  2W03 A;  3T8N A;  3UL6 A;  3CD6 3;  4PEJ A;  3NM2 A;  2O3O A;  3Q90 A;  1NO3 A;  1IVU A;  3D3L A;  4N6N B;  1GOY A;  2BO9 B;  4BTW A;  1K9M 4;  3HII A;  4K90 B;  3I55 3;  1NJI 4;  1QAK A;  2IMJ A;  4KFF A;  2IUK A;  1YGW A;  1JBS A;  2IYJ A;  1UUW B;  2Z76 A;  4OUQ A;  1GSP A;  4X2H A;  4BTX A;  1W6G A;  1YJ9 3;  1WMN A;  4N6O B;  3PCS A;  5IF6 A;  3FCS B;  1VQM 3;  1BRN L;  2IY2 A;  3LXU X;  4HYZ A;  1RCK A;  5D81 A;  1VQ5 3;  3CCJ 3;  1TFO A;  1B2U A;  2OOV A;  1IDP A;  2O9U X;  5AYS C;  5CF2 A;  2C11 A;  4MMY B;  6STD A;  1AR0 A;  1IVX A;  2K54 A;  2KCD A;  4I5Q A;  3KZT A;  1Q42 A;  1WMP A;  5IEP A;  3I56 3;  2CFW A;  2CC3 A;  2V1L A;  3ZG5 A;  5KP3 A;  3BB9 A;  1UCL A;  2CFK A;  3PYJ A;  3J7Y d;  3FLJ A;  3F14 A;  4BL2 A;  2E2U A;  4EV5 A;  2F86 B;  1RGK A;  4BIR A;  2BNG A;  4JRF A;  4R4K A;  1W2B 2;  1IVW A;  2GEY A;  4HM1 B;  1BIR A;  1IVV A;  2W2C A;  4HAA A;  1Q7H A;  1M1X B;  1A2K A;  3AHW A;  1BUJ A;  1I8V A;  1GD3 A;  2IA7 A;  4WWU C;  1W6C A;  2YFI B;  1TRQ A;  3KCH A;  4L8P A;  3CC4 3;  1AV4 A;  2K3D A;  1X1X A;  3JUP A;  1RJO A;  3NBJ A;  3VSY A;  1LOX A;  4KFD A;  3LTD A;  1MGR A;  1S5A A;  2XF3 A;  5EVH A;  1SIH A;  1YHQ 3;  1KD1 4;  1DMQ A;  1TJD A;  3OV4 A;  3FF0 A;  4GL6 A;  1EKM A;  1JNQ A;  1BRJ A;  1V58 A;  1ROV A;  2OWP A;  4J9A A;  5BXQ A;  1EQK A;  4OK0 A;  1B2Z A;  2P0X A;  3ALA A;  4HZB B;  5M1A A;  5ELU A;  3PCR A;  1GY6 A;  1WTH A;  2CFD A;  3UJM A;  3KE7 A;  1OHO A;  3WA2 X;  1IQX A;  3EBT A;  1LRA A;  1PYL A;  3HK4 A;  3CXC 2;  3CCE 3;  1W00 A;  2HML B;  1VQO 3;  3D4A A;  4N6T A;  5CF1 A;  4FMC A;  7GSP A;  3FZW A;  2OTJ 3;  1GOV A;  3LT9 A;  4AKY A;  3MSO A;  9RNT A;  1R4Y A;  1QAF A;  1STD A;  3EC9 A;  1ROA A;  1F8N A;  2F5M A;  1OF5 B;  1B2X A;  1UI7 A;  3X3X A;  3F40 A;  2WOH A;  5KP1 A;  1GOU A;  1LOV A;  2KXG A;  4XDV A;  1G0T A;  2FGT A;  4ILF A;  1BNJ A;  2ZHX B;  3KKG A;  3JVC A;  2BU4 A;  1W01 A;  3N8B A;  1TIJ A;  4KZ1 A;  4WYK A;  2HMM B;  1JKG B;  1WNH A;  1NU3 A;  2E2V A;  4FR9 A;  1PU4 A;  2STD A;  8RNT A;  1O7G B;  5ELJ A;  1RLS A;  2R41 A;  3MHE A;  1RN4 A;  3IMA B;  3DGN A;  1LNI A;  3AHS A;  4GSP A;  1RGH A;  4N6L A;  2BHM A;  4I4K A;  1FGM A;  3X42 A;  4BL3 A;  1I3F A;  2YX9 A;  1JBR A;  3F8X A;  3EQQ B;  3HI7 A;  2XGL A;  1X1U A;  1B21 A;  1AQZ A;  3K9M C;  2P0M A;  3K63 A;  3B8L A;  1W2Z A;  1RKY A;  1IQ8 A;  1O7W B;  3D5I A;  3HX8 A;  2Z6B A;  2WO0 A;  2UUG C;  4LGQ A;  1D6Z A;  4MMZ B;  3CCS 3;  1BNE A;  4L8O A;  5KP4 A;  1ZX2 A;  1BNG A;  1LNH A;  3KII A;  3RGR A;  3MG2 A;  4K61 A;  3X41 A;  1JB4 A;  2OOV C;  2P09 A;  4G1M B;  3CME 3;  3BNE A;  2PZV A;  2K0M A;  1IT8 A;  3V98 A;  1YGE A; 
#chains in the Genus database with same CATH homology
 1TU5 A;  1EG9 B;  1W7C A;  3G71 3;  2LQV A;  2CWV A;  1SPU A;  4L7K A;  3G16 A;  1O7M B;  3QK9 A;  1VQP 3;  1W02 A;  3LTA A;  2RGQ A;  1W6Y A;  1O7H B;  4IPB A;  1N5P A;  1LVN A;  1JB2 A;  5LC6 A;  4Q53 A;  4FCM A;  5I97 A;  5CLK A;  1Q40 B;  3IPT A;  1JJ2 2;  1L5G B;  5JBS A;  3FSD A;  3IJE B;  4KVH A;  1QVG 2;  1Y4K A;  4N6U A;  3NQY A;  3MG3 A;  2CG0 A;  1VZZ A;  3OWY A;  3K5T A;  3LOY A;  2QA4 3;  2XR8 B;  4LSO A;  1U8C B;  4HM2 B;  3EF8 A;  2Q07 A;  2W9Q A;  1WQL B;  1OHS A;  2Z7A A;  1VQ4 3;  5EEO A;  3H3H A;  4WHA A;  3DGL A;  1YJW 3;  2HMK B;  1TFK A;  1JV2 B;  2ZL8 A;  1OCV A;  4BTY A;  1EA2 A;  5AII A;  1NDO B;  1A2V A;  3HIG A;  3Q1C A;  3KN4 A;  4N6M A;  4EYC A;  1FA3 A;  3V92 A;  4O8S A;  3F9S A;  5AIH A;  3GZY B;  3NXJ A;  2CWU A;  3WOD G;  3MYT A;  3OWU A;  2E2T A;  1W5Z A;  4NHF A;  1JB5 A;  1YVB I;  5AEW B;  2LYX A;  2W56 B;  4J8T A;  2W56 A;  3NHX A;  1CYV A;  4RBN A;  3BLZ A;  3STD A;  3EN8 A;  1D6U A;  2GXF A;  2JDI H;  3VF1 A;  3CNX A;  3ECF A;  2JQ5 A;  4N6V 0;  5AYR B;  3WA3 A;  3LT8 A;  2CW9 A;  3DXO A;  4XBT A;  2CFG A;  3X40 A;  3FF2 A;  1DVD A;  2A15 A;  1VQ9 3;  2QIY A;  4X2O A;  3G0K A;  1KWI A;  1E3R A;  4O02 B;  4HM0 B;  2Y74 A;  3GZR A;  3QRD A;  4HBR A;  1GYB A;  1NWW A;  1Q86 4;  3NM7 A;  5AIF A;  2XSH B;  3EE1 A;  3EBY A;  3OWS A;  1US1 A;  3NV0 B;  1ULI B;  3NV0 A;  1NB5 I;  1N5H A;  3MKI A;  4HM4 B;  1Q81 4;  2GU1 A;  5CK6 A;  3BNC A;  1IT7 A;  3UL5 A;  3F7X A;  4ZM8 A;  1V74 A;  3S5C A;  1FGO A;  3S67 A;  1N9J A;  3WOE B;  4EXR A;  1DMM A;  1OF5 A;  1M90 4;  3VGN A;  4FMD A;  2P38 A;  2XFT A;  3CPO A;  1IQY A;  1ULJ B;  4R9K A;  2RSX A;  1N9E A;  2ML5 A;  3BND A;  3GZB A;  2Y73 A;  2W6J H;  1O7P B;  5CXO A;  3OW2 2;  1JKG A;  4MMX B;  3FG3 A;  1VQK 3;  1KC8 4;  4CDL A;  2XFS A;  5FW5 A;  3E99 A;  2IUJ A;  2HMJ B;  1KQS 2;  1LXE A;  3MWZ A;  4K1V A;  3GZX B;  4IIA A;  1OGZ A;  2YFL B;  3LML A;  1T5Y A;  1E97 A;  5IEO A;  4RZM A;  1R4C A;  1SQW A;  4HVN A;  2WOF A;  7STD A;  1K28 A;  1QMA A;  3LZA A;  1YIJ 3;  4OVM A;  1DYU A;  1GD4 A;  3M8C A;  1M9G A;  1E3V A;  2WGQ A;  3CC7 3;  1N8R 4;  3KFQ C;  2XSO B;  4MEI A;  2F99 A;  3SXX A;  4HJL B;  5D82 A;  2CFL A;  3UB1 A;  1CEW I;  2ML6 A;  1CQS A;  2F98 A;  3N54 B;  1SJW A;  3CMA 3;  4STD A;  1DVC A;  1YIT 3;  3EB8 A;  2P05 A;  4O3V A;  2OQE A;  2GBW B;  3F8H A;  3DMC A;  2CWT A;  3FG1 A;  4XDW A;  3CC2 3;  1Q40 A;  3FKA A;  4WP5 A;  3N9H A;  1QVF 2;  3PZW A;  2W04 A;  3SX1 A;  2B1X B;  5IG5 A;  2W0Q A;  2ZDJ A;  1YI2 3;  3EN1 B;  1ASK A;  1W4N A;  3AMO B;  1IV7 A;  1Z1S A;  2XEP A;  1HKX A;  2RFR A;  2MF7 A;  3G8Z A;  3CCU 3;  1SII A;  1WMO A;  2Z77 A;  2WGO A;  4CCV A;  1CYU A;  1HU9 A;  1ZO2 A;  3BNB A;  2RCD A;  3KSP A;  5DRV A;  1G96 A;  3B4P A;  1VQL 3;  4H3U A;  3DGM A;  1PFP A;  5AIG A;  3CCR 3;  1IV9 A;  1OHP A;  2D42 A;  1JRQ A;  3I0Y A;  1Q7Y 4;  4FCJ A;  3U1W A;  2XRX B;  1RRH A;  1A90 A;  1JN5 B;  1JN5 A;  4XBY A;  3GAX A;  4R80 A;  3CCL 3;  2C10 A;  3X3Z A;  1AVK A;  3GRD A;  5DRE A;  2UX0 A;  2FNQ A;  2L4V A;  3G4S 3;  1M1K 4;  1A67 A;  2BMR B;  1GS3 A;  5IG3 A;  4RNZ A;  4HM3 B;  1MNL A;  1OH0 A;  5STD A;  3NUV A;  2B24 B;  3B7C A;  3KSE D;  5IG0 A;  4HM8 B;  4FMA A;  5HGR A;  1S72 3;  1OUN A;  8CHO A;  2R4I A;  3JUQ A;  3CPW 2;  3K0Z A;  1O7N B;  3X3Y A;  1K41 A;  2XH9 A;  1QJG A;  4NRE A;  3WMD A;  3CCQ 3;  1VQ8 3;  1MOL A;  1TUH A;  1RRL A;  2QEX 3;  4WFO A;  4FMB A;  4O2H A;  3H51 A;  5AEU B;  3JUN A;  5BVB A;  4LZI A;  4HM6 B;  5JPU A;  2D1W A;  3OX9 A;  4ORL A;  3WOF B;  2HMO B;  3NQZ A;  2INX A;  3CNM A;  1K73 4;  3S28 A;  5IG4 A;  3JUM A;  1N8Q A;  2GU3 A;  5TGN A;  3FG4 A;  1VQ6 3;  1TP6 A;  4LEH A;  2YFJ B;  1DMN A;  4R1K A;  3T0U A;  1FGT A;  3ER7 A;  4KFE A;  3NBR A;  2GBX B;  4TX4 A;  2FXT A;  2MC8 A;  1UI8 A;  3MPH A;  4R9L A;  1J2B A;  3NX0 A;  4RNY A;  3SOY A;  3WDG B;  3PXM A;  3B4O A;  1C7H A;  3PGB A;  3RGA A;  3LYG A;  5EQL A;  3CCV 3;  4H61 A;  2HMN B;  1UW1 A;  2OQE C;  4JF8 A;  3D9R A;  3LTB A;  3PS8 A;  3MG1 A;  2M7O A;  1IK3 A;  1IU7 A;  3OXA A;  4EC6 A;  2BMQ B;  4XBX A;  1OAC A;  3SLU A;  1YJN 3;  2OTL 3;  3Q2P A;  3F7S A;  1ISK A;  1BUQ A;  5JPP A;  2CIU A;  3DUK A;  3FH1 A;  3O8Y A;  4AKZ A;  4HKV B;  3SOA A;  4K1U A;  3T8U A;  4WYK B;  5IER A;  3ROB A;  3S27 A;  3HZP A;  3LTC A;  3LH4 A;  2BMO B;  1U5O A;  4MJD A;  3U97 A;  3TDG A;  1GY5 A;  3EX9 A;  1RN7 A;  2OCT A;  3GWR A;  4XM4 A;  3S29 A;  3UNL A;  1STF I;  2CK3 H;  4IT7 A;  3JUO A;  2CG1 A;  3EHC A;  1Q82 4;  1VQN 3;  4HM7 B;  4EBG A;  1K8A 4;  3DGO A;  5IW9 A;  3G6E 3;  4QWT A;  1D6Y A;  1GY7 A;  3SVA A;  2CH9 A;  2CHC A;  2QGU A;  1QAL A;  1OGX A;  1UUV B;  3A76 A;  4FCZ A;  4XB5 A;  1OPY A;  3V99 A;  3SED A;  3EJV A;  1KSI A;  2SBL A;  5IEN A;  3L0R A;  5AI1 A;  1VQ7 3;  1FGQ A;  3DZL A;  3DM8 A;  3RDE A;  1FUW A;  1NB3 I;  2KRT A;  3AMO A;  5FGO A;  2BT3 A;  4U13 A;  4GB5 A;  4LMI A;  2XGN A;  5A0O B;  3CCM 3;  3NBB A;  2I9W A;  3DY5 A;  3CU3 A;  2CKF B;  1FGR A;  3K7C A;  4HM5 B;  2W9P A;  4N3V A;  4AEQ A;  5D83 A;  5LC7 A;  2GEX A;  3FGY A;  5G2G A;  4HZ9 B;  2PNC A;  1AVL A;  2W03 A;  3T8N A;  3UL6 A;  3CD6 3;  4PEJ A;  3NM2 A;  2O3O A;  3Q90 A;  1NO3 A;  1IVU A;  3D3L A;  4N6N B;  2BO9 B;  4BTW A;  1K9M 4;  3HII A;  4K90 B;  3I55 3;  1NJI 4;  1QAK A;  2IMJ A;  4KFF A;  2IUK A;  1UUW B;  2Z76 A;  4OUQ A;  4X2H A;  4BTX A;  1W6G A;  1YJ9 3;  1WMN A;  4N6O B;  3PCS A;  5IF6 A;  3FCS B;  1VQM 3;  3LXU X;  4HYZ A;  5D81 A;  1VQ5 3;  3CCJ 3;  1TFO A;  2OOV A;  1IDP A;  2O9U X;  5AYS C;  5CF2 A;  2C11 A;  4MMY B;  6STD A;  1AR0 A;  1IVX A;  2K54 A;  2KCD A;  3KZT A;  1Q42 A;  1WMP A;  5IEP A;  3I56 3;  2CFW A;  2CC3 A;  2V1L A;  5KP3 A;  3BB9 A;  2CFK A;  3PYJ A;  3J7Y d;  3FLJ A;  3F14 A;  2E2U A;  4EV5 A;  2F86 B;  2BNG A;  4JRF A;  4R4K A;  1W2B 2;  1IVW A;  2GEY A;  4HM1 B;  2W2C A;  1IVV A;  1M1X B;  1A2K A;  1GD3 A;  2IA7 A;  4WWU C;  1W6C A;  2YFI B;  3CC4 3;  4L8P A;  1AV4 A;  3JUP A;  3NBJ A;  1RJO A;  3VSY A;  1LOX A;  4KFD A;  3LTD A;  1S5A A;  2XF3 A;  5EVH A;  1SIH A;  1YHQ 3;  1KD1 4;  1DMQ A;  3OV4 A;  3FF0 A;  4GL6 A;  1EKM A;  1JNQ A;  1ROV A;  2OWP A;  4J9A A;  5BXQ A;  1EQK A;  4OK0 A;  2P0X A;  3ALA A;  4HZB B;  5ELU A;  3PCR A;  1GY6 A;  1WTH A;  2CFD A;  3UJM A;  3KE7 A;  1OHO A;  3WA2 X;  1IQX A;  3EBT A;  3CXC 2;  3HK4 A;  3CCE 3;  1W00 A;  2HML B;  1VQO 3;  4N6T A;  5CF1 A;  4FMC A;  2OTJ 3;  3FZW A;  3LT9 A;  4AKY A;  3MSO A;  1QAF A;  1STD A;  3EC9 A;  1ROA A;  1F8N A;  1OF5 B;  1UI7 A;  3X3X A;  3F40 A;  2WOH A;  5KP1 A;  2KXG A;  4XDV A;  2FGT A;  3KKG A;  3JVC A;  3N8B A;  1W01 A;  4KZ1 A;  1TIJ A;  4WYK A;  4EV2 A;  2HMM B;  1JKG B;  1WNH A;  1NU3 A;  2E2V A;  4FR9 A;  1PU4 A;  2STD A;  1O7G B;  5ELJ A;  3MHE A;  3IMA B;  3DGN A;  4N6L A;  2BHM A;  4I4K A;  1FGM A;  3X42 A;  2YX9 A;  3F8X A;  3EQQ B;  3HI7 A;  2XGL A;  3K9M C;  2P0M A;  3K63 A;  3B8L A;  1W2Z A;  1RKY A;  1IQ8 A;  1O7W B;  3HX8 A;  2Z6B A;  2WO0 A;  4LGQ A;  1D6Z A;  4MMZ B;  3CCS 3;  4L8O A;  5KP4 A;  1ZX2 A;  1LNH A;  3KII A;  3RGR A;  3MG2 A;  4K61 A;  3X41 A;  1JB4 A;  2OOV C;  2P09 A;  4G1M B;  3CME 3;  3BNE A;  2PZV A;  2K0M A;  1IT8 A;  3V98 A;  1YGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...