6STDA

Scytalone dehydratase plus inhibitor 3
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
total genus 55
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 6stdA00
4XDVA 1TUHA 1VZZA 1GYBA 3FF0A 1UUWB 1E3VA 1OH0A 4ORLA 2XSOB 3IPTA 2XSHB 1IDPA 1NWWA 3F8XA 1EA2A 2R4IA 1ISKA 2PZVA 3CPOA 1JN5A 1GY6A 4LMIA 3D9RA 5IENA 3F9SA 3H3HA 3S5CA 1W01A 4XB5A 2GEYA 1S5AA 3MG1A 3FF2A 3OWUA 4XDWA 3Q90A 5AEUB 2Z7AA 3EN1B 4J9AA 3T8UA 2RGQA 3EBYA 4XBTA 3RGRA 3OX9A 3MG3A 3GWRA 1SJWA 4HM1B 3B7CA 1Q42A 1NDOB 4HM7B 3SOAA 3UNLA 3B8LA 1ULJB 3JUQA 1GS3A 4X2HA 4WWUC 4HM3B 2B1XB 2GEXA 3OWSA 1WQLB 3EC9A 3DXOA 5D83A 1ZO2A 5G2GA 2BMOB 4K1VA 4N3VA 4I4KA 3JUOA 2A15A 1STDA 5IG0A 4XM4A 2IMJA 3EQQB 4RZMA 2GBXB 2XRXB 3G16A 1GY7A 3GZBA 2HMNB 2YFIB 1JKGA 1W00A 3RGAA 4OUQA 5HGRA 5IEOA 4XBYA 2BNGA 1E3RA 2CKFB 2K54A 2GBWB 1JB4A 5STDA 1W02A 3B4OA 3EHCA 4STDA 1OHSA 4GB5A 4HZ9B 1O7WB 5DRVA 3BLZA 5CLKA 2W2CA 3M8CA 5KP4A 3FLJA 3KKGA 5CF2A 5IG4A 1OHPA 1OUNA 3NBRA 3F7XA 2INXA 3FZWA 3CNMA 2HMMB 4HM5B 5JPUA 3MHEA 4HM2B 1BUQA 3EX9A 4KVHA 3DUKA 2XR8B 2F86B 1W6YA 3F8HA 4L8OA 3G0KA 3NHXA 1OPYA 1HKXA 3GZRA 4PEJA 5JPPA 1A2KA 4R1KA 3JUPA 2UX0A 4WYKA 5KP1A 5CF1A 4WP5A 3WMDA 5D81A 4L8PA 3H51A 1Q40B 4HM8B 3G8ZA 5CK6A 7STDA 4R9KA 3KSPA 2BMRB 1JKGB 3BB9A 5EVHA 1OGXA 5TGNA 2RFRA 1C7HA 5D82A 3KE7A 4MJDA 3DM8A 4HM4B 3LZAA 3CNXA 3OWYA 1JB2A 3SEDA 2YFJB 1Q40A 2Z77A 4OVMA 5KP3A 2F99A 1OGZA 5AIIA 5FW5A 3VSYA 4FCMA 1Z1SA 3JUMA 4U13A 3K0ZA 4H3UA 4FCJA 3FGYA 5BVBA 4R9LA 5IG3A 1O7PB 3F14A 3HK4A 5DREA 2OWPA 3NM2A 5AIHA 1O7MB 4HM6B 3T8NA 2YFLB 2I9WA 1DMNA 6STDA 1JB5A 3EN8A 3VGNA 3B4PA 1ZX2A 2B24B 3MKIA 3HX8A 4Q53A 2HMJB 2HMKB 1DMMA 3MSOA 3GZYB 3NV0B 3NUVA 3OXAA 2GXFA 3K7CA 3MYTA 1OF5A 4LGQA 3ECFA 2QGUA 5IF6A 5BXQA 4HJLB 5IEPA 4WYKB 1DMQA 4IIAA 3NV0A 3EF8A 1K41A 3F7SA 5AI1A 3I0YA 1O7HB 8CHOA 3E99A 3FH1A 1EG9B 5IG5A 4L7KA 3CU3A 4HZBB 3MG2A 3LYGA 1ULIB 3GZXB 3A76A 5AIGA 4HVNA 4K1UA 4HKVB 1GY5A 3EJVA 2F98A 3ER7A 2RCDA 1U5OA 5CXOA 2JQ5A 3HZPA 1QMAA 1NU3A 3SOYA 1E97A 2Z76A 3DZLA 1OHOA 3GRDA 2BMQB 1TP6A 2HMOB 4LEHA 3STDA 1ASKA 1O7GB 2QIYA 5AIFA 1AR0A 2HMLB 2STDA 2CHCA 3KZTA 1OCVA 3FSDA 3JUNA 3NXJA 4HM0B 1O7NB 3F40A 4J8TA 5IERA 1CQSA 1OF5B 4XBXA 3FKAA 1QJGA 3DMCA 3EBTA 4X2OA 1UUVB 3UJMA 1JN5B 3ROBA 4CDLA 3OV4A 5AEWB
chains in the Genus database with same CATH superfamily
1B2XA 2W9QA 1R4CA 4RNZA 2OQEC 3MPHA 4H61A 1TUHA 4XDVA 1VZZA 3WOFB 1I2GA 1BRSA 4N6V0 2CG0A 1GYBA 3FF0A 3PCSA 3AMOA 1N5HA 2WO0A 3QRDA 1BNRA 1UUWB 3V99A 1IYYA 1DVCA 2H0IA 7RNTA 1E3VA 1OH0A 2MF7A 4ORLA 4AEQA 2XSOB 3IPTA 2XSHB 1IDPA 1BRJA 1NWWA 1BGSA 1JV2B 3F8XA 4EC6A 3IMAB 1VQP3 1EA2A 1BRGA 1RLSA 3CCE3 2R4IA 2WOHA 1RN7A 2WGQA 1ISKA 2CFKA 1YI23 2PZVA 8RNTA 1B3SA 3CPOA 1JN5A 2GSPA 3BNDA 1GY6A 2BO9B 4LMIA 4FMDA 3FG4A 3NBJA 3D9RA 2SARA 1DVDA 1VQ53 5IENA 3F9SA 3H3HA 3S5CA 1W01A 4I5QA 1IVXA 1FA3A 4N6OB 2GEYA 4XB5A 1FGRA 5M18A 1S5AA 3MG1A 1X1WA 1FGTA 3FF2A 2CFLA 1CYVA 1FUSA 3OWUA 4XDWA 1ZS7A 1AVLA 2HOHA 2IUKA 3Q90A 1C54A 1EKMA 5AEUB 3SYUA 4CCVA 2WOFA 2Z7AA 3EN1B 4J9AA 2K0MA 3T8UA 1NJI4 1G02A 2RGQA 1M904 3EBYA 1STFI 2W56B 3IJEB 2KRTA 4XBTA 3RGRA 3X42A 3OX9A 3MG3A 2M7OA 2MC8A 3GWRA 3TDGA 1Q7Y4 1KD14 1IV7A 1AQZA 1LVNA 1SJWA 3D79A 2F5WA 4HM1B 1LOWA 1N8QA 2L1SA 1TFKA 4IT7A 3B7CA 1Q42A 3KIIA 3ZG5A 4N6NB 3FG1A 3D5GA 1IK3A 1I0XA 1YGWA 2GU3A 1NDOB 3LT8A 4HM7B 4KT3B 4O3VA 3SOAA 1VQ83 2IUJA 3UNLA 2PNCA 1GOUA 3WA3A 3B8LA 3ALAA 3PS8A 1ULJB 2CC3A 2CH9A 3D4AA 1UCKA 3JUQA 1VQM3 3G713 4BIRA 1GS3A 4X2HA 1Q9EA 1BOXA 2CIUA 4WWUC 1AVKA 2W56A 2O3OA 3DY5A 1WMPA 2C11A 3BNEA 4HM3B 2B1XB 2GEXA 3OWSA 1RDSA 3S67A 4AKYA 1TRPA 1WQLB 1BRIA 3EC9A 2ZHXB 3DXOA 1QVG2 2W9PA 2KCDA 2BU4A 5D83A 1LNHA 1ZO2A 5G2GA 2BMOB 4ILFA 2QEX3 3PCRA 4RNYA 1MOLA 4K1VA 4N3VA 2KAAA 4I4KA 3JUOA 5BIRA 3SVAA 2A15A 1JZDA 1CH0A 3ZG0A 1I2EA 3N54B 1STDA 1W7CA 5IG0A 3NQYA 2W04A 4XM4A 3WOEB 2IMJA 3KFQC 1BNJA 3URPA 3EQQB 4RZMA 4FCZA 1BSEA 2GBXB 2XRXB 4K61A 1LXEA 2C10A 1RGEA 3HIGA 1ROVA 2RNTA 3G16A 1BRNL 1GY7A 4WHAA 4KFFA 3GZBA 1VQN3 2HMNB 1CYUA 1JRQA 1R4YA 3X3ZA 1B27A 2YFIB 1JKGA 1W00A 1BU4A 1V74A 3RGAA 3RDEA 3HIIA 1L5GB 4EYCA 4OUQA 2CFWA 3NQZA 1KWIA 1YJW3 5HGRA 5IEOA 4XBYA 2BNGA 1D6YA 3AGOA 2H0GA 1E3RA 2AADA 2CKFB 3RNTA 3K5TA 2H0HA 2K54A 2GBWB 2E2TA 3SLUA 1JB4A 1T2IA 1N8R4 5STDA 1ROAA 1W02A 3U1WA 4CJNA 1IVUA 1J2BA 1FUTA 3B4OA 4DKIA 5M1AA 3EHCA 3X3XA 4STDA 1RRHA 1YHQ3 3PGBA 1OHSA 1BUJA 4GB5A 3CC23 2RBIA 4HZ9B 1O7WB 2CFDA 2ZA4A 1VQ93 1V57A 5DRVA 1W6CA 1DETA 3AGNA 3BLZA 5CLKA 4BU4A 4TX4A 1LQGC 1EUIC 1RKYA 3KN4A 2W2CA 3M8CA 5KP4A 3FLJA 3KKGA 4NHFA 5CF2A 3LT9A 3MWZA 1OHPA 5IG4A 4MMYB 2JDIH 4RBNA 2CWTA 3EE1A 1VQ63 1OUNA 1YGEA 1X1UA 3NBRA 3F7XA 2ZL8A 1SIHA 3AHSA 2INXA 2P0MA 1RGLA 3FZWA 1N9EA 1HZ1A 3CNMA 2J8XB 3DGMA 3I553 2HMMB 4HM5B 1FZUA 1K28A 3MHEA 5JPUA 3HI7A 1JNQA 4HM2B 4NREA 1K8A4 1HYFA 1MWTA 3LH4A 4HOHA 4EXRA 1RMSA 2XFTA 1BUQA 1AV4A 3CXC2 5G1LA 2K3DA 3S27A 2UGIA 1WNHA 4FMBA 3EX9A 4HAAA 4KVHA 3DUKA 1JBTA 3PXMA 4EBGA 1VQ73 2XR8B 2F86B 3I563 1W6YA 1M9GA 3F8HA 1PY3A 4OK0A 4L8OA 2W6JH 3KSED 3G0KA 1RTUA 3NHXA 3FG3A 4LZIA 3CCV3 1TTOA 1BRKA 4BL2A 3CCJ3 3CC73 1CEWI 2CK3H 1FGMA 2ML5A 1YIJ3 1BSDA 1W5ZA 2BHMA 1GMPA 1OPYA 1HKXA 2OTJ3 1IQXA 4LSOA 1BNSA 2F4YA 1BNEA 3LTAA 1ZGXA 3DGOA 3GZRA 4PEJA 4MMXB 5AYSC 1LRAA 1MWRA 1OACA 1UCLA 1LOXA 2XEPA 1TJDA 5JPPA 2E2UA 1A2KA 4R1KA 2OCTA 3VF1A 3JUPA 4GL6A 1VQO3 2UX0A 3HOHA 3NM7A 2E2VA 4WYKA 1T2HA 3UL5A 5KP1A 3CCR3 1M1XB 5CF1A 3CD63 1SPUA 4WP5A 3WMDA 2R41A 3CCQ3 2CX0A 3A5EA 5D81A 1IV9A 1GOVA 1SIIA 2GU1A 1BNIA 4HBRA 4L8PA 3H51A 1A2VA 1N5PA 3T0UA 1W6GA 1Q40B 1UCIA 2KF3A 4HM8B 1RCKA 3G8ZA 1WTHA 5CK6A 2OOVA 1TIJA 1UGHI 1Q814 3QK9A 7GSPA 1G0TA 7STDA 4R9KA 3KSPA 2BMRB 4AKZA 1B2MA 1JKGB 3BB9A 1I2FA 2WGOA 2F56A 2CW9A 1GD4A 5EVHA 1OGXA 1EEJA 2SBLA 4MMZB 5TGNA 2RFRA 1RRLA 1C7HA 4BTXA 2CFGA 2P0XA 5D82A 3KE7A 4MJDA 3DM8A 1X1YA 4HM4B 4KZ1A 3LZAA 2W0QA 3CNXA 3OWYA 1SQWA 1US1A 1JB2A 3SEDA 3CCS3 2CX1A 2O9UX 2YFJB 4J5KA 4O2HA 4BL3A 1NNVA 1Q40A 5GSPA 2Z77A 4OVMA 5KP3A 2F99A 1I3IA 4QWTA 1RN1A 1A67A 1OGZA 5AIIA 1DYUA 2Z6BA 2RSXA 2XH9A 3DGLA 1D6UA 1V58A 5FW5A 1W2B2 3VSYA 3J7Yd 4FCMA 1Z1SA 1UDII 4KFDA 2QA43 1B2SA 3BNCA 1TFOA 3SXXA 1D6ZA 1B21A 1IQYA 1AY7A 1RHLA 1LQMB 1GMRA 2CWVA 2KXGA 3JUMA 1PFPA 4U13A 3K0ZA 1B2UA 4H3UA 3V98A 3V92A 1NO3A 1W4NA 2BIRA 3FGYA 4FCJA 4R9LA 3S28A 5BVBA 3X41A 1O7PB 5IG3A 4N6TA 4NPBA 1FUWA 1SARA 3U97A 4GHOA 4R80A 3LMLA 2CWUA 3FCSB 1LOVA 3F14A 1Y4KA 2OWPA 3HK4A 3K63A 2OOVC 3NM2A 5AIHA 5DREA 3DH2A 4EV2A 1O7MB 4HM6B 1N9JA 3T8NA 3CME3 3CMA3 2F5MA 2YFLB 2I9WA 1DMNA 2P09A 2XF3A 3KCHA 4KFEA 1K734 6STDA 1IQ8A 1LOYA 1JB5A 3D3LA 3EN8A 3Q3FA 3VGNA 1NB5I 3B4PA 1ZX2A 5IW9A 1KQS2 2B24B 2D1WA 1A2PA 9RNTA 3MKIA 3UB1A 1IVWA 2KF5A 3HX8A 2FNQA 4Q53A 2HMJB 2KF4A 5A0OB 2HMKB 1K9M4 1MGRA 1DMMA 1YVBI 5HOHA 3DGNA 4N6UA 1EQKA 3UL6A 1QAKA 1RSNA 2LYXA 1T5YA 2V1LA 3GZYB 3MSOA 1UI8A 3NUVA 3NV0B 3OXAA 4WFOA 2GXFA 5ELJA 1LNIA 1W2ZA 3K7CA 2KF6A 1PYLA 3MYTA 4J5GA 2P38A 1VQK3 1B20A 1UW1A 5ELUA 1OF5A 1TU5A 4LGQA 2Y73A 1VQL3 3ECFA 3WODG 1BANA 2QGUA 5IF6A 5BXQA 1F8NA 5AYRB 3K9MC 5RNTA 5I97A 3N8BA 4HJLB 3L0RA 5IEPA 4WYKB 1DMQA 3DGYA 2FXTA 1BSBA 5EQLA 3G6E3 5EEOA 2CG1A 1MWUA 3JVCA 4FMCA 4IIAA 3NV0A 1TRQA 1IVVA 3EF8A 1UGIA 3ZFZA 1WMOA 1U8CB 3Q2PA 1RGKA 3BU4A 3LTDA 3LOYA 1K41A 3F7SA 4ZM8A 5G1KA 3WHOA 5AI1A 3I0YA 3PZWA 1S723 1FGQA 1VQQA 4FR9A 1Q824 3G4S3 1RCLA 1BRHA 1YVSA 1O7HB 2D42A 2XGLA 4FMAA 4BTYA 1DE3A 1NB3I 3CCL3 8CHOA 1JBSA 4RNTA 1BIRA 2XGNA 1BSAA 3E99A 1MWSA 3EB8A 3WDGB 3FH1A 1Q864 1EG9B 1RNBA 1MNLA 4MEIA 6GSPA 2OTL3 1FYSA 5IG5A 3X3YA 4L7KA 3CU3A 3PYJA 4HZBB 3CCU3 3CC43 1JJ22 3MG2A 1I70A 1YIT3 3LYGA 1RGGA 2ZDJA 5BU4A 4LYLB 4N6LA 5M19A 1ULIB 3GZXB 3A76A 5AIGA 4HVNA 4K1UA 5JBSA 3GSPA 3OW22 1X1XA 2L4VA 4EV5A 3NX0A 4HKVB 1I3FA 3AHWA 3S29A 1GY5A 3EJVA 2AAEA 2Q07A 3CPW2 3WA2X 2F98A 3BIRA 1FW7A 1Q7HA 1GOYA 3D5IA 2YX9A 1KC84 1UUGB 2BT3A 2IYJA 1QALA 3X40A 4O02B 2W03A 3ER7A 4K90B 4G1MB 5FGOA 1YNVX 1U5OA 2RCDA 1RGHA 1MGWA 5CXOA 2OQEA 1RGFA 3LTCA 1YJ93 2JQ5A 1JBRA 3HZPA 2P05A 1QMAA 1B2ZA 1FGOA 3LTBA 1VQ43 3NBBA 1NU3A 3SOYA 1E97A 3O8YA 2Z76A 1YJN3 1RGCA 1BAOA 1OHOA 3DZLA 3GRDA 2BMQB 1TP6A 2HMOB 1RNTA 1IT7A 4LEHA 5LC6A 1RN4A 3STDA 1QVF2 1IU7A 1KSIA 1ASKA 1IT8A 1O7GB 2QIYA 5AIFA 3LXUX 1M1K4 1A90A 1AR0A 1I8VA 2HMLB 2STDA 3N9HA 4JRFA 4R4KA 2CHCA 2IA7A 1HU9A 2LQVA 1G96A 1RGAA 2IY2A 3KZTA 1OCVA 4HYZA 1WMNA 1GD3A 1GSPA 3FSDA 1JZOA 4BTWA 1T3BA 3JUNA 3NXJA 4HM0B 1QAFA 3AMOB 3SX1A 4GSPA 3WR2A 2FGTA 2ML6A 1O7NB 3F40A 3Q1CA 3CCM3 6RNTA 2UUGC 2XFSA 4IPBA 1GMQA 4J8TA 4O8SA 5IERA 1CQSA 4N6MA 1OF5B 5LC7A 4XBXA 1PU4A 1BNGA 2C4BA 3FKAA 1BNFA 1I0VA 1QJGA 3DMCA 1UCJA 1BVIA 3EBTA 2Y74A 4JF8A 4X2OA 1UI7A 1UUVB 4CPKA 3BNBA 3UJMA 1JN5B 3GAXA 3ROBA 4CDLA 4EW5A 3OV4A 1RJOA 1BSCA 5AEWB
chains in the Genus database with same CATH topology
2W9QA 1R4CA 4RNZA 2OQEC 3MPHA 4H61A 1TUHA 4XDVA 1VZZA 3WOFB 4N6V0 2CG0A 1GYBA 3FF0A 3PCSA 3AMOA 1N5HA 2WO0A 3QRDA 1UUWB 3V99A 1DVCA 1E3VA 1OH0A 2MF7A 4ORLA 4AEQA 2XSOB 3IPTA 2XSHB 1IDPA 1NWWA 1JV2B 3F8XA 4EC6A 3IMAB 1VQP3 1EA2A 3CCE3 2R4IA 2WOHA 1RN7A 2WGQA 1ISKA 2CFKA 1YI23 2PZVA 3CPOA 1JN5A 3BNDA 1GY6A 2BO9B 4LMIA 4FMDA 3FG4A 3NBJA 3D9RA 1DVDA 1VQ53 5IENA 3F9SA 3H3HA 3S5CA 1W01A 1FA3A 1IVXA 4N6OB 2GEYA 4XB5A 1FGRA 1S5AA 3MG1A 1FGTA 3FF2A 2CFLA 1CYVA 3OWUA 4XDWA 1AVLA 2IUKA 3Q90A 1EKMA 5AEUB 4CCVA 2WOFA 2Z7AA 3EN1B 4J9AA 2K0MA 3T8UA 1NJI4 2RGQA 1M904 3EBYA 1STFI 2W56B 3IJEB 2KRTA 4XBTA 3RGRA 3X42A 3OX9A 3MG3A 2M7OA 2MC8A 3GWRA 3TDGA 1Q7Y4 1KD14 1IV7A 1LVNA 1SJWA 4HM1B 1N8QA 1TFKA 4IT7A 3B7CA 1Q42A 3KIIA 4N6NB 3FG1A 1IK3A 3LT8A 2GU3A 1NDOB 4HM7B 4O3VA 3SOAA 1VQ83 2IUJA 3UNLA 2PNCA 3WA3A 3B8LA 3ALAA 3PS8A 1ULJB 2CC3A 2CH9A 3JUQA 1VQM3 3G713 1GS3A 4X2HA 2CIUA 4WWUC 1AVKA 2W56A 2O3OA 3DY5A 1WMPA 2C11A 3BNEA 4HM3B 2B1XB 2GEXA 3OWSA 3S67A 4AKYA 1WQLB 3EC9A 3DXOA 1QVG2 2W9PA 2KCDA 5D83A 1LNHA 1ZO2A 5G2GA 2BMOB 2QEX3 3PCRA 4RNYA 1MOLA 4K1VA 4N3VA 4I4KA 3JUOA 3SVAA 2A15A 3N54B 1STDA 1W7CA 5IG0A 3NQYA 2W04A 4XM4A 3WOEB 2IMJA 3KFQC 3EQQB 4RZMA 4FCZA 2GBXB 2XRXB 4K61A 1LXEA 2C10A 3HIGA 1ROVA 3G16A 1GY7A 4WHAA 4KFFA 3GZBA 1VQN3 2HMNB 1CYUA 1JRQA 3X3ZA 2YFIB 1JKGA 1W00A 1V74A 3RGAA 3RDEA 3HIIA 1L5GB 4EYCA 4OUQA 2CFWA 3NQZA 1KWIA 1YJW3 5HGRA 5IEOA 4XBYA 2BNGA 1D6YA 1E3RA 2CKFB 3K5TA 2K54A 2GBWB 2E2TA 3SLUA 1JB4A 1N8R4 1J2BA 5STDA 1ROAA 1W02A 3U1WA 1IVUA 3B4OA 3EHCA 3X3XA 4STDA 1RRHA 1YHQ3 3PGBA 1OHSA 4GB5A 3CC23 4HZ9B 1O7WB 2CFDA 1VQ93 5DRVA 1W6CA 3BLZA 5CLKA 4TX4A 1RKYA 3KN4A 2W2CA 3M8CA 5KP4A 3FLJA 3KKGA 4NHFA 5CF2A 3LT9A 3MWZA 1OHPA 5IG4A 4MMYB 2JDIH 4RBNA 2CWTA 3EE1A 1VQ63 1OUNA 1YGEA 3NBRA 3F7XA 2ZL8A 1SIHA 2INXA 2P0MA 3FZWA 1N9EA 3DGMA 3CNMA 3I553 2HMMB 4HM5B 1K28A 3MHEA 5JPUA 3HI7A 1JNQA 4HM2B 4NREA 1K8A4 3LH4A 4EXRA 2XFTA 1BUQA 1AV4A 3CXC2 3S27A 1WNHA 4FMBA 3EX9A 4KVHA 3DUKA 3PXMA 4EBGA 1VQ73 2XR8B 2F86B 3I563 1W6YA 1M9GA 3F8HA 4OK0A 4L8OA 2W6JH 3KSED 3G0KA 3NHXA 3FG3A 4LZIA 3CCV3 3CCJ3 3CC73 1CEWI 2CK3H 1FGMA 2ML5A 1YIJ3 1W5ZA 2BHMA 1OPYA 1HKXA 2OTJ3 1IQXA 4LSOA 3LTAA 3DGOA 3GZRA 4PEJA 5AYSC 4MMXB 1OACA 2XEPA 1LOXA 5JPPA 2E2UA 1A2KA 4R1KA 2OCTA 3VF1A 3JUPA 4GL6A 1VQO3 2UX0A 3NM7A 2E2VA 4WYKA 3UL5A 3CCR3 5KP1A 3CD63 1M1XB 5CF1A 1SPUA 4WP5A 3WMDA 3CCQ3 5D81A 1IV9A 1SIIA 2GU1A 4HBRA 4L8PA 3H51A 1A2VA 1N5PA 3T0UA 1W6GA 1Q40B 4HM8B 3G8ZA 1WTHA 5CK6A 2OOVA 1TIJA 1Q814 3QK9A 7STDA 4R9KA 3KSPA 2BMRB 4AKZA 1JKGB 3BB9A 2WGOA 2CW9A 1GD4A 5EVHA 1OGXA 4MMZB 2SBLA 5TGNA 2RFRA 1RRLA 1C7HA 4BTXA 2CFGA 2P0XA 5D82A 3KE7A 4MJDA 3DM8A 4HM4B 4KZ1A 3LZAA 2W0QA 3CNXA 3OWYA 1SQWA 1US1A 1JB2A 3SEDA 3CCS3 2O9UX 2YFJB 4O2HA 1Q40A 2Z77A 4OVMA 5KP3A 2F99A 4QWTA 1A67A 1OGZA 5AIIA 1DYUA 2Z6BA 2RSXA 2XH9A 3DGLA 1D6UA 5FW5A 1W2B2 3VSYA 3J7Yd 4FCMA 1Z1SA 4KFDA 2QA43 3BNCA 1TFOA 3SXXA 1IQYA 1D6ZA 2KXGA 3JUMA 2CWVA 4U13A 1PFPA 3V98A 3K0ZA 4H3UA 3V92A 1NO3A 1W4NA 3FGYA 4FCJA 4R9LA 3S28A 5BVBA 5IG3A 3X41A 1O7PB 1FUWA 4N6TA 3U97A 4R80A 3LMLA 2CWUA 3FCSB 3F14A 3HK4A 1Y4KA 2OWPA 5DREA 3K63A 2OOVC 3NM2A 5AIHA 4EV2A 1O7MB 4HM6B 1N9JA 3T8NA 3CME3 3CMA3 2YFLB 2I9WA 1DMNA 2P09A 2XF3A 4KFEA 1K734 6STDA 1IQ8A 1JB5A 3D3LA 3EN8A 3VGNA 1NB5I 3B4PA 1ZX2A 5IW9A 1KQS2 2B24B 2D1WA 3MKIA 3UB1A 1IVWA 3HX8A 2FNQA 4Q53A 2HMJB 5A0OB 2HMKB 1K9M4 1DMMA 1YVBI 3DGNA 4N6UA 1EQKA 3UL6A 1QAKA 2LYXA 2V1LA 1T5YA 3GZYB 3MSOA 3NV0B 1UI8A 3NUVA 4WFOA 3OXAA 5ELJA 2GXFA 1W2ZA 3K7CA 3MYTA 2P38A 1VQK3 1UW1A 5ELUA 1OF5A 1TU5A 4LGQA 2Y73A 1VQL3 3ECFA 3WODG 2QGUA 5IF6A 5BXQA 1F8NA 5AYRB 3K9MC 5I97A 3N8BA 4HJLB 3L0RA 5IEPA 4WYKB 1DMQA 2FXTA 3G6E3 5EQLA 5EEOA 2CG1A 3JVCA 4FMCA 4IIAA 3NV0A 3EF8A 1IVVA 1WMOA 1U8CB 3Q2PA 3LTDA 3LOYA 1K41A 3F7SA 4ZM8A 5AI1A 3I0YA 3PZWA 1S723 1FGQA 4FR9A 1Q824 3G4S3 1O7HB 2D42A 2XGLA 4FMAA 4BTYA 1NB3I 3CCL3 8CHOA 2XGNA 3E99A 3EB8A 3WDGB 3FH1A 1Q864 1EG9B 1MNLA 4MEIA 2OTL3 5IG5A 3X3YA 4L7KA 3CU3A 3PYJA 4HZBB 3CCU3 3CC43 1JJ22 3MG2A 1YIT3 3LYGA 2ZDJA 4N6LA 1ULIB 3GZXB 3A76A 5AIGA 4HVNA 4K1UA 5JBSA 3OW22 2L4VA 4EV5A 3NX0A 4HKVB 3S29A 1GY5A 3EJVA 2Q07A 3CPW2 3WA2X 2F98A 1KC84 2YX9A 2BT3A 1QALA 3X40A 4O02B 2W03A 3ER7A 4K90B 4G1MB 5FGOA 2RCDA 1U5OA 2OQEA 5CXOA 1YJ93 3LTCA 2JQ5A 3HZPA 2P05A 1QMAA 1FGOA 3LTBA 1VQ43 3NBBA 1NU3A 3SOYA 1E97A 3O8YA 2Z76A 1YJN3 3DZLA 1OHOA 3GRDA 2BMQB 1TP6A 2HMOB 4LEHA 1IT7A 5LC6A 3STDA 1QVF2 1IU7A 1KSIA 1ASKA 1IT8A 1O7GB 2QIYA 5AIFA 3LXUX 1M1K4 1A90A 1AR0A 2HMLB 2STDA 3N9HA 4JRFA 4R4KA 2CHCA 2IA7A 1HU9A 2LQVA 1G96A 3KZTA 1OCVA 4HYZA 1GD3A 1WMNA 4BTWA 3FSDA 3JUNA 3NXJA 4HM0B 1QAFA 3AMOB 3SX1A 2FGTA 2ML6A 1O7NB 3F40A 3Q1CA 3CCM3 2XFSA 4IPBA 4J8TA 4O8SA 5IERA 1CQSA 4N6MA 1OF5B 5LC7A 4XBXA 1PU4A 3FKAA 1QJGA 3DMCA 3EBTA 2Y74A 4JF8A 4X2OA 1UI7A 1UUVB 3BNBA 3UJMA 1JN5B 3GAXA 3ROBA 4CDLA 3OV4A 1RJOA 5AEWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDV A;  1TUH A;  1VZZ A;  1GYB A;  3FF0 A;  1UUW B;  1E3V A;  1OH0 A;  4ORL A;  2XSO B;  3IPT A;  2XSH B;  1IDP A;  1NWW A;  3F8X A;  1EA2 A;  2R4I A;  1ISK A;  2PZV A;  3CPO A;  1JN5 A;  1GY6 A;  4LMI A;  3D9R A;  5IEN A;  3F9S A;  3H3H A;  3S5C A;  1W01 A;  4XB5 A;  2GEY A;  1S5A A;  3MG1 A;  3FF2 A;  3OWU A;  4XDW A;  3Q90 A;  5AEU B;  2Z7A A;  3EN1 B;  4J9A A;  3T8U A;  2RGQ A;  3EBY A;  4XBT A;  3RGR A;  3OX9 A;  3MG3 A;  3GWR A;  1SJW A;  4HM1 B;  3B7C A;  1Q42 A;  1NDO B;  4HM7 B;  3SOA A;  3UNL A;  3B8L A;  1ULJ B;  3JUQ A;  1GS3 A;  4X2H A;  4WWU C;  4HM3 B;  2B1X B;  2GEX A;  3OWS A;  1WQL B;  3EC9 A;  3DXO A;  5D83 A;  1ZO2 A;  5G2G A;  2BMO B;  4K1V A;  4N3V A;  4I4K A;  3JUO A;  2A15 A;  1STD A;  5IG0 A;  4XM4 A;  2IMJ A;  3EQQ B;  4RZM A;  2GBX B;  2XRX B;  3G16 A;  1GY7 A;  3GZB A;  2HMN B;  2YFI B;  1JKG A;  1W00 A;  3RGA A;  4OUQ A;  5HGR A;  5IEO A;  4XBY A;  2BNG A;  1E3R A;  2CKF B;  2K54 A;  2GBW B;  1JB4 A;  5STD A;  1W02 A;  3B4O A;  3EHC A;  4STD A;  1OHS A;  4GB5 A;  4HZ9 B;  1O7W B;  5DRV A;  3BLZ A;  5CLK A;  2W2C A;  3M8C A;  5KP4 A;  3FLJ A;  3KKG A;  5CF2 A;  5IG4 A;  1OHP A;  1OUN A;  3NBR A;  3F7X A;  2INX A;  3FZW A;  3CNM A;  2HMM B;  4HM5 B;  5JPU A;  3MHE A;  4HM2 B;  1BUQ A;  3EX9 A;  4KVH A;  3DUK A;  2XR8 B;  2F86 B;  1W6Y A;  3F8H A;  4L8O A;  3G0K A;  3NHX A;  1OPY A;  1HKX A;  3GZR A;  4PEJ A;  5JPP A;  1A2K A;  4R1K A;  3JUP A;  2UX0 A;  4WYK A;  5KP1 A;  5CF1 A;  4WP5 A;  3WMD A;  5D81 A;  4L8P A;  3H51 A;  1Q40 B;  4HM8 B;  3G8Z A;  5CK6 A;  7STD A;  4R9K A;  3KSP A;  2BMR B;  1JKG B;  3BB9 A;  5EVH A;  1OGX A;  5TGN A;  2RFR A;  1C7H A;  5D82 A;  3KE7 A;  4MJD A;  3DM8 A;  4HM4 B;  3LZA A;  3CNX A;  3OWY A;  1JB2 A;  3SED A;  2YFJ B;  1Q40 A;  2Z77 A;  4OVM A;  5KP3 A;  2F99 A;  1OGZ A;  5AII A;  5FW5 A;  3VSY A;  4FCM A;  1Z1S A;  3JUM A;  4U13 A;  3K0Z A;  4H3U A;  4FCJ A;  3FGY A;  5BVB A;  4R9L A;  5IG3 A;  1O7P B;  3F14 A;  3HK4 A;  5DRE A;  2OWP A;  3NM2 A;  5AIH A;  1O7M B;  4HM6 B;  3T8N A;  2YFL B;  2I9W A;  1DMN A;  6STD A;  1JB5 A;  3EN8 A;  3VGN A;  3B4P A;  1ZX2 A;  2B24 B;  3MKI A;  3HX8 A;  4Q53 A;  2HMJ B;  2HMK B;  1DMM A;  3MSO A;  3GZY B;  3NV0 B;  3NUV A;  3OXA A;  2GXF A;  3K7C A;  3MYT A;  1OF5 A;  4LGQ A;  3ECF A;  2QGU A;  5IF6 A;  5BXQ A;  4HJL B;  5IEP A;  4WYK B;  1DMQ A;  4IIA A;  3NV0 A;  3EF8 A;  1K41 A;  3F7S A;  5AI1 A;  3I0Y A;  1O7H B;  8CHO A;  3E99 A;  3FH1 A;  1EG9 B;  5IG5 A;  4L7K A;  3CU3 A;  4HZB B;  3MG2 A;  3LYG A;  1ULI B;  3GZX B;  3A76 A;  5AIG A;  4HVN A;  4K1U A;  4HKV B;  1GY5 A;  3EJV A;  2F98 A;  3ER7 A;  2RCD A;  1U5O A;  5CXO A;  2JQ5 A;  3HZP A;  1QMA A;  1NU3 A;  3SOY A;  1E97 A;  2Z76 A;  3DZL A;  1OHO A;  3GRD A;  2BMQ B;  1TP6 A;  2HMO B;  4LEH A;  3STD A;  1ASK A;  1O7G B;  2QIY A;  5AIF A;  1AR0 A;  2HML B;  2STD A;  2CHC A;  3KZT A;  1OCV A;  3FSD A;  3JUN A;  3NXJ A;  4HM0 B;  1O7N B;  3F40 A;  4J8T A;  5IER A;  1CQS A;  1OF5 B;  4XBX A;  3FKA A;  1QJG A;  3DMC A;  3EBT A;  4X2O A;  1UUV B;  3UJM A;  1JN5 B;  3ROB A;  4CDL A;  3OV4 A;  5AEW B; 
#chains in the Genus database with same CATH topology
 1B2X A;  2W9Q A;  1R4C A;  4RNZ A;  2OQE C;  3MPH A;  4H61 A;  1TUH A;  4XDV A;  1VZZ A;  3WOF B;  1I2G A;  1BRS A;  4N6V 0;  2CG0 A;  1GYB A;  3FF0 A;  3PCS A;  3AMO A;  1N5H A;  2WO0 A;  3QRD A;  1BNR A;  1UUW B;  3V99 A;  1IYY A;  1DVC A;  2H0I A;  7RNT A;  1E3V A;  1OH0 A;  2MF7 A;  4ORL A;  4AEQ A;  2XSO B;  3IPT A;  2XSH B;  1IDP A;  1BRJ A;  1NWW A;  1BGS A;  1JV2 B;  3F8X A;  4EC6 A;  3IMA B;  1VQP 3;  1EA2 A;  1BRG A;  1RLS A;  3CCE 3;  2R4I A;  2WOH A;  1RN7 A;  2WGQ A;  1ISK A;  2CFK A;  1YI2 3;  2PZV A;  8RNT A;  1B3S A;  3CPO A;  1JN5 A;  2GSP A;  3BND A;  1GY6 A;  2BO9 B;  4LMI A;  4FMD A;  3FG4 A;  3NBJ A;  3D9R A;  2SAR A;  1DVD A;  1VQ5 3;  5IEN A;  3F9S A;  3H3H A;  3S5C A;  1W01 A;  4I5Q A;  1IVX A;  1FA3 A;  4N6O B;  2GEY A;  4XB5 A;  1FGR A;  5M18 A;  1S5A A;  3MG1 A;  1X1W A;  1FGT A;  3FF2 A;  2CFL A;  1CYV A;  1FUS A;  3OWU A;  4XDW A;  1ZS7 A;  1AVL A;  2HOH A;  2IUK A;  3Q90 A;  1C54 A;  1EKM A;  5AEU B;  3SYU A;  4CCV A;  2WOF A;  2Z7A A;  3EN1 B;  4J9A A;  2K0M A;  3T8U A;  1NJI 4;  1G02 A;  2RGQ A;  1M90 4;  3EBY A;  1STF I;  2W56 B;  3IJE B;  2KRT A;  4XBT A;  3RGR A;  3X42 A;  3OX9 A;  3MG3 A;  2M7O A;  2MC8 A;  3GWR A;  3TDG A;  1Q7Y 4;  1KD1 4;  1IV7 A;  1AQZ A;  1LVN A;  1SJW A;  3D79 A;  2F5W A;  4HM1 B;  1LOW A;  1N8Q A;  2L1S A;  1TFK A;  4IT7 A;  3B7C A;  1Q42 A;  3KII A;  3ZG5 A;  4N6N B;  3FG1 A;  3D5G A;  1IK3 A;  1I0X A;  1YGW A;  2GU3 A;  1NDO B;  3LT8 A;  4HM7 B;  4KT3 B;  4O3V A;  3SOA A;  1VQ8 3;  2IUJ A;  3UNL A;  2PNC A;  1GOU A;  3WA3 A;  3B8L A;  3ALA A;  3PS8 A;  1ULJ B;  2CC3 A;  2CH9 A;  3D4A A;  1UCK A;  3JUQ A;  1VQM 3;  3G71 3;  4BIR A;  1GS3 A;  4X2H A;  1Q9E A;  1BOX A;  2CIU A;  4WWU C;  1AVK A;  2W56 A;  2O3O A;  3DY5 A;  1WMP A;  2C11 A;  3BNE A;  4HM3 B;  2B1X B;  2GEX A;  3OWS A;  1RDS A;  3S67 A;  4AKY A;  1TRP A;  1WQL B;  1BRI A;  3EC9 A;  2ZHX B;  3DXO A;  1QVG 2;  2W9P A;  2KCD A;  2BU4 A;  5D83 A;  1LNH A;  1ZO2 A;  5G2G A;  2BMO B;  4ILF A;  2QEX 3;  3PCR A;  4RNY A;  1MOL A;  4K1V A;  4N3V A;  2KAA A;  4I4K A;  3JUO A;  5BIR A;  3SVA A;  2A15 A;  1JZD A;  1CH0 A;  3ZG0 A;  1I2E A;  3N54 B;  1STD A;  1W7C A;  5IG0 A;  3NQY A;  2W04 A;  4XM4 A;  3WOE B;  2IMJ A;  3KFQ C;  1BNJ A;  3URP A;  3EQQ B;  4RZM A;  4FCZ A;  1BSE A;  2GBX B;  2XRX B;  4K61 A;  1LXE A;  2C10 A;  1RGE A;  3HIG A;  1ROV A;  2RNT A;  3G16 A;  1BRN L;  1GY7 A;  4WHA A;  4KFF A;  3GZB A;  1VQN 3;  2HMN B;  1CYU A;  1JRQ A;  1R4Y A;  3X3Z A;  1B27 A;  2YFI B;  1JKG A;  1W00 A;  1BU4 A;  1V74 A;  3RGA A;  3RDE A;  3HII A;  1L5G B;  4EYC A;  4OUQ A;  2CFW A;  3NQZ A;  1KWI A;  1YJW 3;  5HGR A;  5IEO A;  4XBY A;  2BNG A;  1D6Y A;  3AGO A;  2H0G A;  1E3R A;  2AAD A;  2CKF B;  3RNT A;  3K5T A;  2H0H A;  2K54 A;  2GBW B;  2E2T A;  3SLU A;  1JB4 A;  1T2I A;  1N8R 4;  5STD A;  1ROA A;  1W02 A;  3U1W A;  4CJN A;  1IVU A;  1J2B A;  1FUT A;  3B4O A;  4DKI A;  5M1A A;  3EHC A;  3X3X A;  4STD A;  1RRH A;  1YHQ 3;  3PGB A;  1OHS A;  1BUJ A;  4GB5 A;  3CC2 3;  2RBI A;  4HZ9 B;  1O7W B;  2CFD A;  2ZA4 A;  1VQ9 3;  1V57 A;  5DRV A;  1W6C A;  1DET A;  3AGN A;  3BLZ A;  5CLK A;  4BU4 A;  4TX4 A;  1LQG C;  1EUI C;  1RKY A;  3KN4 A;  2W2C A;  3M8C A;  5KP4 A;  3FLJ A;  3KKG A;  4NHF A;  5CF2 A;  3LT9 A;  3MWZ A;  1OHP A;  5IG4 A;  4MMY B;  2JDI H;  4RBN A;  2CWT A;  3EE1 A;  1VQ6 3;  1OUN A;  1YGE A;  1X1U A;  3NBR A;  3F7X A;  2ZL8 A;  1SIH A;  3AHS A;  2INX A;  2P0M A;  1RGL A;  3FZW A;  1N9E A;  1HZ1 A;  3CNM A;  2J8X B;  3DGM A;  3I55 3;  2HMM B;  4HM5 B;  1FZU A;  1K28 A;  3MHE A;  5JPU A;  3HI7 A;  1JNQ A;  4HM2 B;  4NRE A;  1K8A 4;  1HYF A;  1MWT A;  3LH4 A;  4HOH A;  4EXR A;  1RMS A;  2XFT A;  1BUQ A;  1AV4 A;  3CXC 2;  5G1L A;  2K3D A;  3S27 A;  2UGI A;  1WNH A;  4FMB A;  3EX9 A;  4HAA A;  4KVH A;  3DUK A;  1JBT A;  3PXM A;  4EBG A;  1VQ7 3;  2XR8 B;  2F86 B;  3I56 3;  1W6Y A;  1M9G A;  3F8H A;  1PY3 A;  4OK0 A;  4L8O A;  2W6J H;  3KSE D;  3G0K A;  1RTU A;  3NHX A;  3FG3 A;  4LZI A;  3CCV 3;  1TTO A;  1BRK A;  4BL2 A;  3CCJ 3;  3CC7 3;  1CEW I;  2CK3 H;  1FGM A;  2ML5 A;  1YIJ 3;  1BSD A;  1W5Z A;  2BHM A;  1GMP A;  1OPY A;  1HKX A;  2OTJ 3;  1IQX A;  4LSO A;  1BNS A;  2F4Y A;  1BNE A;  3LTA A;  1ZGX A;  3DGO A;  3GZR A;  4PEJ A;  4MMX B;  5AYS C;  1LRA A;  1MWR A;  1OAC A;  1UCL A;  1LOX A;  2XEP A;  1TJD A;  5JPP A;  2E2U A;  1A2K A;  4R1K A;  2OCT A;  3VF1 A;  3JUP A;  4GL6 A;  1VQO 3;  2UX0 A;  3HOH A;  3NM7 A;  2E2V A;  4WYK A;  1T2H A;  3UL5 A;  5KP1 A;  3CCR 3;  1M1X B;  5CF1 A;  3CD6 3;  1SPU A;  4WP5 A;  3WMD A;  2R41 A;  3CCQ 3;  2CX0 A;  3A5E A;  5D81 A;  1IV9 A;  1GOV A;  1SII A;  2GU1 A;  1BNI A;  4HBR A;  4L8P A;  3H51 A;  1A2V A;  1N5P A;  3T0U A;  1W6G A;  1Q40 B;  1UCI A;  2KF3 A;  4HM8 B;  1RCK A;  3G8Z A;  1WTH A;  5CK6 A;  2OOV A;  1TIJ A;  1UGH I;  1Q81 4;  3QK9 A;  7GSP A;  1G0T A;  7STD A;  4R9K A;  3KSP A;  2BMR B;  4AKZ A;  1B2M A;  1JKG B;  3BB9 A;  1I2F A;  2WGO A;  2F56 A;  2CW9 A;  1GD4 A;  5EVH A;  1OGX A;  1EEJ A;  2SBL A;  4MMZ B;  5TGN A;  2RFR A;  1RRL A;  1C7H A;  4BTX A;  2CFG A;  2P0X A;  5D82 A;  3KE7 A;  4MJD A;  3DM8 A;  1X1Y A;  4HM4 B;  4KZ1 A;  3LZA A;  2W0Q A;  3CNX A;  3OWY A;  1SQW A;  1US1 A;  1JB2 A;  3SED A;  3CCS 3;  2CX1 A;  2O9U X;  2YFJ B;  4J5K A;  4O2H A;  4BL3 A;  1NNV A;  1Q40 A;  5GSP A;  2Z77 A;  4OVM A;  5KP3 A;  2F99 A;  1I3I A;  4QWT A;  1RN1 A;  1A67 A;  1OGZ A;  5AII A;  1DYU A;  2Z6B A;  2RSX A;  2XH9 A;  3DGL A;  1D6U A;  1V58 A;  5FW5 A;  1W2B 2;  3VSY A;  3J7Y d;  4FCM A;  1Z1S A;  1UDI I;  4KFD A;  2QA4 3;  1B2S A;  3BNC A;  1TFO A;  3SXX A;  1D6Z A;  1B21 A;  1IQY A;  1AY7 A;  1RHL A;  1LQM B;  1GMR A;  2CWV A;  2KXG A;  3JUM A;  1PFP A;  4U13 A;  3K0Z A;  1B2U A;  4H3U A;  3V98 A;  3V92 A;  1NO3 A;  1W4N A;  2BIR A;  3FGY A;  4FCJ A;  4R9L A;  3S28 A;  5BVB A;  3X41 A;  1O7P B;  5IG3 A;  4N6T A;  4NPB A;  1FUW A;  1SAR A;  3U97 A;  4GHO A;  4R80 A;  3LML A;  2CWU A;  3FCS B;  1LOV A;  3F14 A;  1Y4K A;  2OWP A;  3HK4 A;  3K63 A;  2OOV C;  3NM2 A;  5AIH A;  5DRE A;  3DH2 A;  4EV2 A;  1O7M B;  4HM6 B;  1N9J A;  3T8N A;  3CME 3;  3CMA 3;  2F5M A;  2YFL B;  2I9W A;  1DMN A;  2P09 A;  2XF3 A;  3KCH A;  4KFE A;  1K73 4;  6STD A;  1IQ8 A;  1LOY A;  1JB5 A;  3D3L A;  3EN8 A;  3Q3F A;  3VGN A;  1NB5 I;  3B4P A;  1ZX2 A;  5IW9 A;  1KQS 2;  2B24 B;  2D1W A;  1A2P A;  9RNT A;  3MKI A;  3UB1 A;  1IVW A;  2KF5 A;  3HX8 A;  2FNQ A;  4Q53 A;  2HMJ B;  2KF4 A;  5A0O B;  2HMK B;  1K9M 4;  1MGR A;  1DMM A;  1YVB I;  5HOH A;  3DGN A;  4N6U A;  1EQK A;  3UL6 A;  1QAK A;  1RSN A;  2LYX A;  1T5Y A;  2V1L A;  3GZY B;  3MSO A;  1UI8 A;  3NUV A;  3NV0 B;  3OXA A;  4WFO A;  2GXF A;  5ELJ A;  1LNI A;  1W2Z A;  3K7C A;  2KF6 A;  1PYL A;  3MYT A;  4J5G A;  2P38 A;  1VQK 3;  1B20 A;  1UW1 A;  5ELU A;  1OF5 A;  1TU5 A;  4LGQ A;  2Y73 A;  1VQL 3;  3ECF A;  3WOD G;  1BAN A;  2QGU A;  5IF6 A;  5BXQ A;  1F8N A;  5AYR B;  3K9M C;  5RNT A;  5I97 A;  3N8B A;  4HJL B;  3L0R A;  5IEP A;  4WYK B;  1DMQ A;  3DGY A;  2FXT A;  1BSB A;  5EQL A;  3G6E 3;  5EEO A;  2CG1 A;  1MWU A;  3JVC A;  4FMC A;  4IIA A;  3NV0 A;  1TRQ A;  1IVV A;  3EF8 A;  1UGI A;  3ZFZ A;  1WMO A;  1U8C B;  3Q2P A;  1RGK A;  3BU4 A;  3LTD A;  3LOY A;  1K41 A;  3F7S A;  4ZM8 A;  5G1K A;  3WHO A;  5AI1 A;  3I0Y A;  3PZW A;  1S72 3;  1FGQ A;  1VQQ A;  4FR9 A;  1Q82 4;  3G4S 3;  1RCL A;  1BRH A;  1YVS A;  1O7H B;  2D42 A;  2XGL A;  4FMA A;  4BTY A;  1DE3 A;  1NB3 I;  3CCL 3;  8CHO A;  1JBS A;  4RNT A;  1BIR A;  2XGN A;  1BSA A;  3E99 A;  1MWS A;  3EB8 A;  3WDG B;  3FH1 A;  1Q86 4;  1EG9 B;  1RNB A;  1MNL A;  4MEI A;  6GSP A;  2OTL 3;  1FYS A;  5IG5 A;  3X3Y A;  4L7K A;  3CU3 A;  3PYJ A;  4HZB B;  3CCU 3;  3CC4 3;  1JJ2 2;  3MG2 A;  1I70 A;  1YIT 3;  3LYG A;  1RGG A;  2ZDJ A;  5BU4 A;  4LYL B;  4N6L A;  5M19 A;  1ULI B;  3GZX B;  3A76 A;  5AIG A;  4HVN A;  4K1U A;  5JBS A;  3GSP A;  3OW2 2;  1X1X A;  2L4V A;  4EV5 A;  3NX0 A;  4HKV B;  1I3F A;  3AHW A;  3S29 A;  1GY5 A;  3EJV A;  2AAE A;  2Q07 A;  3CPW 2;  3WA2 X;  2F98 A;  3BIR A;  1FW7 A;  1Q7H A;  1GOY A;  3D5I A;  2YX9 A;  1KC8 4;  1UUG B;  2BT3 A;  2IYJ A;  1QAL A;  3X40 A;  4O02 B;  2W03 A;  3ER7 A;  4K90 B;  4G1M B;  5FGO A;  1YNV X;  1U5O A;  2RCD A;  1RGH A;  1MGW A;  5CXO A;  2OQE A;  1RGF A;  3LTC A;  1YJ9 3;  2JQ5 A;  1JBR A;  3HZP A;  2P05 A;  1QMA A;  1B2Z A;  1FGO A;  3LTB A;  1VQ4 3;  3NBB A;  1NU3 A;  3SOY A;  1E97 A;  3O8Y A;  2Z76 A;  1YJN 3;  1RGC A;  1BAO A;  1OHO A;  3DZL A;  3GRD A;  2BMQ B;  1TP6 A;  2HMO B;  1RNT A;  1IT7 A;  4LEH A;  5LC6 A;  1RN4 A;  3STD A;  1QVF 2;  1IU7 A;  1KSI A;  1ASK A;  1IT8 A;  1O7G B;  2QIY A;  5AIF A;  3LXU X;  1M1K 4;  1A90 A;  1AR0 A;  1I8V A;  2HML B;  2STD A;  3N9H A;  4JRF A;  4R4K A;  2CHC A;  2IA7 A;  1HU9 A;  2LQV A;  1G96 A;  1RGA A;  2IY2 A;  3KZT A;  1OCV A;  4HYZ A;  1WMN A;  1GD3 A;  1GSP A;  3FSD A;  1JZO A;  4BTW A;  1T3B A;  3JUN A;  3NXJ A;  4HM0 B;  1QAF A;  3AMO B;  3SX1 A;  4GSP A;  3WR2 A;  2FGT A;  2ML6 A;  1O7N B;  3F40 A;  3Q1C A;  3CCM 3;  6RNT A;  2UUG C;  2XFS A;  4IPB A;  1GMQ A;  4J8T A;  4O8S A;  5IER A;  1CQS A;  4N6M A;  1OF5 B;  5LC7 A;  4XBX A;  1PU4 A;  1BNG A;  2C4B A;  3FKA A;  1BNF A;  1I0V A;  1QJG A;  3DMC A;  1UCJ A;  1BVI A;  3EBT A;  2Y74 A;  4JF8 A;  4X2O A;  1UI7 A;  1UUV B;  4CPK A;  3BNB A;  3UJM A;  1JN5 B;  3GAX A;  3ROB A;  4CDL A;  4EW5 A;  3OV4 A;  1RJO A;  1BSC A;  5AEW B; 
#chains in the Genus database with same CATH homology
 2W9Q A;  1R4C A;  4RNZ A;  2OQE C;  3MPH A;  4H61 A;  1TUH A;  4XDV A;  1VZZ A;  3WOF B;  4N6V 0;  2CG0 A;  1GYB A;  3FF0 A;  3PCS A;  3AMO A;  1N5H A;  2WO0 A;  3QRD A;  1UUW B;  3V99 A;  1DVC A;  1E3V A;  1OH0 A;  2MF7 A;  4ORL A;  4AEQ A;  2XSO B;  3IPT A;  2XSH B;  1IDP A;  1NWW A;  1JV2 B;  3F8X A;  4EC6 A;  3IMA B;  1VQP 3;  1EA2 A;  3CCE 3;  2R4I A;  2WOH A;  1RN7 A;  2WGQ A;  1ISK A;  2CFK A;  1YI2 3;  2PZV A;  3CPO A;  1JN5 A;  3BND A;  1GY6 A;  2BO9 B;  4LMI A;  4FMD A;  3FG4 A;  3NBJ A;  3D9R A;  1DVD A;  1VQ5 3;  5IEN A;  3F9S A;  3H3H A;  3S5C A;  1W01 A;  1FA3 A;  1IVX A;  4N6O B;  2GEY A;  4XB5 A;  1FGR A;  1S5A A;  3MG1 A;  1FGT A;  3FF2 A;  2CFL A;  1CYV A;  3OWU A;  4XDW A;  1AVL A;  2IUK A;  3Q90 A;  1EKM A;  5AEU B;  4CCV A;  2WOF A;  2Z7A A;  3EN1 B;  4J9A A;  2K0M A;  3T8U A;  1NJI 4;  2RGQ A;  1M90 4;  3EBY A;  1STF I;  2W56 B;  3IJE B;  2KRT A;  4XBT A;  3RGR A;  3X42 A;  3OX9 A;  3MG3 A;  2M7O A;  2MC8 A;  3GWR A;  3TDG A;  1Q7Y 4;  1KD1 4;  1IV7 A;  1LVN A;  1SJW A;  4HM1 B;  1N8Q A;  1TFK A;  4IT7 A;  3B7C A;  1Q42 A;  3KII A;  4N6N B;  3FG1 A;  1IK3 A;  3LT8 A;  2GU3 A;  1NDO B;  4HM7 B;  4O3V A;  3SOA A;  1VQ8 3;  2IUJ A;  3UNL A;  2PNC A;  3WA3 A;  3B8L A;  3ALA A;  3PS8 A;  1ULJ B;  2CC3 A;  2CH9 A;  3JUQ A;  1VQM 3;  3G71 3;  1GS3 A;  4X2H A;  2CIU A;  4WWU C;  1AVK A;  2W56 A;  2O3O A;  3DY5 A;  1WMP A;  2C11 A;  3BNE A;  4HM3 B;  2B1X B;  2GEX A;  3OWS A;  3S67 A;  4AKY A;  1WQL B;  3EC9 A;  3DXO A;  1QVG 2;  2W9P A;  2KCD A;  5D83 A;  1LNH A;  1ZO2 A;  5G2G A;  2BMO B;  2QEX 3;  3PCR A;  4RNY A;  1MOL A;  4K1V A;  4N3V A;  4I4K A;  3JUO A;  3SVA A;  2A15 A;  3N54 B;  1STD A;  1W7C A;  5IG0 A;  3NQY A;  2W04 A;  4XM4 A;  3WOE B;  2IMJ A;  3KFQ C;  3EQQ B;  4RZM A;  4FCZ A;  2GBX B;  2XRX B;  4K61 A;  1LXE A;  2C10 A;  3HIG A;  1ROV A;  3G16 A;  1GY7 A;  4WHA A;  4KFF A;  3GZB A;  1VQN 3;  2HMN B;  1CYU A;  1JRQ A;  3X3Z A;  2YFI B;  1JKG A;  1W00 A;  1V74 A;  3RGA A;  3RDE A;  3HII A;  1L5G B;  4EYC A;  4OUQ A;  2CFW A;  3NQZ A;  1KWI A;  1YJW 3;  5HGR A;  5IEO A;  4XBY A;  2BNG A;  1D6Y A;  1E3R A;  2CKF B;  3K5T A;  2K54 A;  2GBW B;  2E2T A;  3SLU A;  1JB4 A;  1N8R 4;  1J2B A;  5STD A;  1ROA A;  1W02 A;  3U1W A;  1IVU A;  3B4O A;  3EHC A;  3X3X A;  4STD A;  1RRH A;  1YHQ 3;  3PGB A;  1OHS A;  4GB5 A;  3CC2 3;  4HZ9 B;  1O7W B;  2CFD A;  1VQ9 3;  5DRV A;  1W6C A;  3BLZ A;  5CLK A;  4TX4 A;  1RKY A;  3KN4 A;  2W2C A;  3M8C A;  5KP4 A;  3FLJ A;  3KKG A;  4NHF A;  5CF2 A;  3LT9 A;  3MWZ A;  1OHP A;  5IG4 A;  4MMY B;  2JDI H;  4RBN A;  2CWT A;  3EE1 A;  1VQ6 3;  1OUN A;  1YGE A;  3NBR A;  3F7X A;  2ZL8 A;  1SIH A;  2INX A;  2P0M A;  3FZW A;  1N9E A;  3DGM A;  3CNM A;  3I55 3;  2HMM B;  4HM5 B;  1K28 A;  3MHE A;  5JPU A;  3HI7 A;  1JNQ A;  4HM2 B;  4NRE A;  1K8A 4;  3LH4 A;  4EXR A;  2XFT A;  1BUQ A;  1AV4 A;  3CXC 2;  3S27 A;  1WNH A;  4FMB A;  3EX9 A;  4KVH A;  3DUK A;  3PXM A;  4EBG A;  1VQ7 3;  2XR8 B;  2F86 B;  3I56 3;  1W6Y A;  1M9G A;  3F8H A;  4OK0 A;  4L8O A;  2W6J H;  3KSE D;  3G0K A;  3NHX A;  3FG3 A;  4LZI A;  3CCV 3;  3CCJ 3;  3CC7 3;  1CEW I;  2CK3 H;  1FGM A;  2ML5 A;  1YIJ 3;  1W5Z A;  2BHM A;  1OPY A;  1HKX A;  2OTJ 3;  1IQX A;  4LSO A;  3LTA A;  3DGO A;  3GZR A;  4PEJ A;  5AYS C;  4MMX B;  1OAC A;  2XEP A;  1LOX A;  5JPP A;  2E2U A;  1A2K A;  4R1K A;  2OCT A;  3VF1 A;  3JUP A;  4GL6 A;  1VQO 3;  2UX0 A;  3NM7 A;  2E2V A;  4WYK A;  3UL5 A;  3CCR 3;  5KP1 A;  3CD6 3;  1M1X B;  5CF1 A;  1SPU A;  4WP5 A;  3WMD A;  3CCQ 3;  5D81 A;  1IV9 A;  1SII A;  2GU1 A;  4HBR A;  4L8P A;  3H51 A;  1A2V A;  1N5P A;  3T0U A;  1W6G A;  1Q40 B;  4HM8 B;  3G8Z A;  1WTH A;  5CK6 A;  2OOV A;  1TIJ A;  1Q81 4;  3QK9 A;  7STD A;  4R9K A;  3KSP A;  2BMR B;  4AKZ A;  1JKG B;  3BB9 A;  2WGO A;  2CW9 A;  1GD4 A;  5EVH A;  1OGX A;  4MMZ B;  2SBL A;  5TGN A;  2RFR A;  1RRL A;  1C7H A;  4BTX A;  2CFG A;  2P0X A;  5D82 A;  3KE7 A;  4MJD A;  3DM8 A;  4HM4 B;  4KZ1 A;  3LZA A;  2W0Q A;  3CNX A;  3OWY A;  1SQW A;  1US1 A;  1JB2 A;  3SED A;  3CCS 3;  2O9U X;  2YFJ B;  4O2H A;  1Q40 A;  2Z77 A;  4OVM A;  5KP3 A;  2F99 A;  4QWT A;  1A67 A;  1OGZ A;  5AII A;  1DYU A;  2Z6B A;  2RSX A;  2XH9 A;  3DGL A;  1D6U A;  5FW5 A;  1W2B 2;  3VSY A;  3J7Y d;  4FCM A;  1Z1S A;  4KFD A;  2QA4 3;  3BNC A;  1TFO A;  3SXX A;  1IQY A;  1D6Z A;  2KXG A;  3JUM A;  2CWV A;  4U13 A;  1PFP A;  3V98 A;  3K0Z A;  4H3U A;  3V92 A;  1NO3 A;  1W4N A;  3FGY A;  4FCJ A;  4R9L A;  3S28 A;  5BVB A;  5IG3 A;  3X41 A;  1O7P B;  1FUW A;  4N6T A;  3U97 A;  4R80 A;  3LML A;  2CWU A;  3FCS B;  3F14 A;  3HK4 A;  1Y4K A;  2OWP A;  5DRE A;  3K63 A;  2OOV C;  3NM2 A;  5AIH A;  4EV2 A;  1O7M B;  4HM6 B;  1N9J A;  3T8N A;  3CME 3;  3CMA 3;  2YFL B;  2I9W A;  1DMN A;  2P09 A;  2XF3 A;  4KFE A;  1K73 4;  6STD A;  1IQ8 A;  1JB5 A;  3D3L A;  3EN8 A;  3VGN A;  1NB5 I;  3B4P A;  1ZX2 A;  5IW9 A;  1KQS 2;  2B24 B;  2D1W A;  3MKI A;  3UB1 A;  1IVW A;  3HX8 A;  2FNQ A;  4Q53 A;  2HMJ B;  5A0O B;  2HMK B;  1K9M 4;  1DMM A;  1YVB I;  3DGN A;  4N6U A;  1EQK A;  3UL6 A;  1QAK A;  2LYX A;  2V1L A;  1T5Y A;  3GZY B;  3MSO A;  3NV0 B;  1UI8 A;  3NUV A;  4WFO A;  3OXA A;  5ELJ A;  2GXF A;  1W2Z A;  3K7C A;  3MYT A;  2P38 A;  1VQK 3;  1UW1 A;  5ELU A;  1OF5 A;  1TU5 A;  4LGQ A;  2Y73 A;  1VQL 3;  3ECF A;  3WOD G;  2QGU A;  5IF6 A;  5BXQ A;  1F8N A;  5AYR B;  3K9M C;  5I97 A;  3N8B A;  4HJL B;  3L0R A;  5IEP A;  4WYK B;  1DMQ A;  2FXT A;  3G6E 3;  5EQL A;  5EEO A;  2CG1 A;  3JVC A;  4FMC A;  4IIA A;  3NV0 A;  3EF8 A;  1IVV A;  1WMO A;  1U8C B;  3Q2P A;  3LTD A;  3LOY A;  1K41 A;  3F7S A;  4ZM8 A;  5AI1 A;  3I0Y A;  3PZW A;  1S72 3;  1FGQ A;  4FR9 A;  1Q82 4;  3G4S 3;  1O7H B;  2D42 A;  2XGL A;  4FMA A;  4BTY A;  1NB3 I;  3CCL 3;  8CHO A;  2XGN A;  3E99 A;  3EB8 A;  3WDG B;  3FH1 A;  1Q86 4;  1EG9 B;  1MNL A;  4MEI A;  2OTL 3;  5IG5 A;  3X3Y A;  4L7K A;  3CU3 A;  3PYJ A;  4HZB B;  3CCU 3;  3CC4 3;  1JJ2 2;  3MG2 A;  1YIT 3;  3LYG A;  2ZDJ A;  4N6L A;  1ULI B;  3GZX B;  3A76 A;  5AIG A;  4HVN A;  4K1U A;  5JBS A;  3OW2 2;  2L4V A;  4EV5 A;  3NX0 A;  4HKV B;  3S29 A;  1GY5 A;  3EJV A;  2Q07 A;  3CPW 2;  3WA2 X;  2F98 A;  1KC8 4;  2YX9 A;  2BT3 A;  1QAL A;  3X40 A;  4O02 B;  2W03 A;  3ER7 A;  4K90 B;  4G1M B;  5FGO A;  2RCD A;  1U5O A;  2OQE A;  5CXO A;  1YJ9 3;  3LTC A;  2JQ5 A;  3HZP A;  2P05 A;  1QMA A;  1FGO A;  3LTB A;  1VQ4 3;  3NBB A;  1NU3 A;  3SOY A;  1E97 A;  3O8Y A;  2Z76 A;  1YJN 3;  3DZL A;  1OHO A;  3GRD A;  2BMQ B;  1TP6 A;  2HMO B;  4LEH A;  1IT7 A;  5LC6 A;  3STD A;  1QVF 2;  1IU7 A;  1KSI A;  1ASK A;  1IT8 A;  1O7G B;  2QIY A;  5AIF A;  3LXU X;  1M1K 4;  1A90 A;  1AR0 A;  2HML B;  2STD A;  3N9H A;  4JRF A;  4R4K A;  2CHC A;  2IA7 A;  1HU9 A;  2LQV A;  1G96 A;  3KZT A;  1OCV A;  4HYZ A;  1GD3 A;  1WMN A;  4BTW A;  3FSD A;  3JUN A;  3NXJ A;  4HM0 B;  1QAF A;  3AMO B;  3SX1 A;  2FGT A;  2ML6 A;  1O7N B;  3F40 A;  3Q1C A;  3CCM 3;  2XFS A;  4IPB A;  4J8T A;  4O8S A;  5IER A;  1CQS A;  4N6M A;  1OF5 B;  5LC7 A;  4XBX A;  1PU4 A;  3FKA A;  1QJG A;  3DMC A;  3EBT A;  2Y74 A;  4JF8 A;  4X2O A;  1UI7 A;  1UUV B;  3BNB A;  3UJM A;  1JN5 B;  3GAX A;  3ROB A;  4CDL A;  3OV4 A;  1RJO A;  5AEW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...