6STDA

Scytalone dehydratase plus inhibitor 3
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Scytalone dehydratase
publication title High-resolution structures of scytalone dehydratase-inhibitor complexes crystallized at physiological pH.
pubmed doi rcsb
source organism Magnaporthe grisea
total genus 55
structure length 164
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 6stdA00
3F7XA 4HM1B 4CDLA 5TGNA 5DRVA 3SEDA 3VSYA 2XSHB 1GS3A 3GWRA 4HM3B 4HVNA 2A15A 3STDA 2HMNB 2RGQA 1SJWA 4FCJA 3HX8A 2F99A 3HZPA 3EN1B 1O7NB 4HM4B 4LGQA 2HMJB 5AEUB 3NM2A 5CXOA 3T8NA 3ROBA 1ULIB 3HK4A 3JUPA 3FKAA 1WQLB 1Q40A 3B7CA 3CNXA 3JUMA 3NXJA 4XDWA 2GEYA 3D9RA 3ECFA 2GBXB 1O7HB 2INXA 5D82A 3S5CA 1OHSA 3FF0A 5JPUA 4XBYA 5CF2A 3VGNA 2JQ5A 5IG5A 3RGAA 1HKXA 5IF6A 1DMMA 2GEXA 1TP6A 1STDA 2I9WA 3CPOA 3DXOA 5KP1A 2W2CA 3A76A 3G16A 8CHOA 1VZZA 4L8PA 4FCMA 5CF1A 4HM0B 1DMNA 5G2GA 4XB5A 1JN5A 5D83A 4X2OA 3F7SA 1NDOB 7STDA 2YFIB 1K41A 2YFLB 3K0ZA 1QMAA 3FLJA 5KP4A 5IG3A 1JN5B 2CHCA 3EQQB 3CNMA 3NV0B 4HZBB 1O7WB 1O7MB 1JKGA 3I0YA 2GXFA 1OF5B 1AR0A 2BMOB 1JB5A 3SOYA 2XSOB 3MKIA 1O7GB 4R1KA 5JPPA 1W00A 4HZ9B 1JKGB 1E3RA 5AIGA 5KP3A 4IIAA 3OX9A 3FSDA 2B1XB 3FZWA 1GY6A 1E97A 5AIIA 3GRDA 2B24B 4LMIA 5FW5A 1OHOA 2QIYA 2BNGA 3F40A 1W02A 4U13A 4WYKA 3EBYA 4L8OA 2Z77A 2K54A 2OWPA 3KKGA 5IEPA 3B4OA 4MJDA 5CLKA 5IG4A 2F86B 1ZX2A 1C7HA 2HMLB 1OPYA 4L7KA 3FH1A 1S5AA 3KSPA 1O7PB 1OGZA 5IENA 3IPTA 4WYKB 3LZAA 5AIFA 2R4IA 5EVHA 3OXAA 4K1UA 1BUQA 2HMOB 2CKFB 2RFRA 4XBXA 4XDVA 4J9AA 1OHPA 2HMMB 3NUVA 4GB5A 4HM8B 3EX9A 3H3HA 3FGYA 2Z7AA 3K7CA 1JB4A 4STDA 1E3VA 4K1VA 1UUWB 3DUKA 4OVMA 4WP5A 3NV0A 1OGXA 3MG2A 5AEWB 4XM4A 3B4PA 1OF5A 2BMRB 3DZLA 4HM5B 3OWUA 3Q90A 4N3VA 1W6YA 2Z76A 3JUQA 2BMQB 1NWWA 3MYTA 2QGUA 5IERA 3GZRA 2GBWB 1OH0A 1OCVA 4R9KA 2F98A 1EG9B 3F8HA 3FF2A 4HJLB 3MG1A 2PZVA 4HM6B 3JUNA 1ZO2A 4HM2B 1UUVB 3KZTA 3MSOA 3UNLA 1A2KA 3OWYA 2STDA 1ULJB 2HMKB 3F14A 4HM7B 3JUOA 3BLZA 1GY7A 4OUQA 2YFJB 3F8XA 4PEJA 4XBTA 1Q42A 5HGRA 3F9SA 3OWSA 5BVBA 1QJGA 1JB2A 1OUNA 3ER7A 3GZXB 5STDA 3EC9A 5IG0A 1DMQA 3EHCA 3B8LA 3BB9A 4H3UA 3OV4A 1Z1SA 4KVHA 3EJVA 1GY5A 3WMDA 2UX0A 4X2HA 4RZMA 1CQSA 3EBTA 3T8UA 3MG3A 1ISKA 1Q40B 3KE7A 3M8CA 3RGRA 3G0KA 1NU3A 1TUHA 4ORLA 3UJMA 3CU3A 3SOAA 3EN8A 6STDA 3H51A 1U5OA 4HKVB 5AI1A 4J8TA 2IMJA 1IDPA 2XR8B 1EA2A 5IEOA 4WWUC 5BXQA 5CK6A 3NBRA 3DM8A 5D81A 1ASKA 4I4KA 3G8ZA 3EF8A 3LYGA 4Q53A 1GYBA 5DREA 2XRXB 4R9LA 2RCDA 5AIHA 4LEHA 3GZYB 3GZBA 3DMCA 3NHXA 3E99A 3MHEA 1W01A
chains in the Genus database with same CATH superfamily
2SARA 1JV2B 1UCLA 1I3FA 2J8XB 1FGRA 4K61A 4WHAA 1IT8A 2WO0A 1U8CB 3D3LA 1I70A 3F7XA 1LOVA 2XFTA 4HM1B 2F5MA 4CDLA 3WR2A 5TGNA 4EYCA 2WGQA 3KSED 3U1WA 1Q864 5DRVA 3Q1CA 1WNHA 4RBNA 2W56B 3SEDA 3VSYA 3CCL3 1FUWA 2XSHB 2BT3A 1IK3A 3NQZA 1GS3A 1R4CA 3GWRA 4HM3B 1SIHA 4IT7A 3BNEA 4HVNA 1X1UA 2A15A 1I3IA 2RNTA 2SBLA 3STDA 3X3ZA 2HMNB 3X42A 4BIRA 1RMSA 1CH0A 2RGQA 4CPKA 1AVLA 1SJWA 2PNCA 1JZDA 4FCJA 3HX8A 3PCRA 4O2HA 1VQL3 2F99A 4NHFA 1RCLA 1RDSA 3HZPA 3SYUA 1I2FA 3EN1B 1GOUA 1O7NB 1QAKA 2W03A 1V57A 4HM4B 4LGQA 2CWUA 2MC8A 2HMJB 3V98A 4EV2A 5AEUB 2F5WA 3CXC2 2CFGA 2GSPA 3NM2A 5CXOA 5M1AA 3CD63 3T8NA 3ROBA 3RDEA 3CCR3 1MWSA 1ULIB 3HK4A 3JUPA 3NBJA 3X3YA 1EQKA 2WOHA 3FKAA 1WQLB 3RNTA 3AGNA 4HAAA 1RN7A 2OQEC 1B3SA 1Q40A 3CCM3 2E2TA 1IQYA 1BNEA 2YX9A 3B7CA 1UUGB 2CG0A 1UI8A 3CNXA 3JUMA 3NXJA 4XDWA 1DVDA 2M7OA 2GEYA 1RN4A 3HI7A 2QEX3 2BHMA 3D9RA 3ECFA 2CIUA 2GBXB 1UGHI 4GHOA 1O7HB 1IQ8A 3N54B 1X1XA 2INXA 1G02A 3Q2PA 4RNYA 5D82A 1LXEA 1YGEA 1PU4A 1FA3A 3S5CA 3D5GA 1KD14 1OHSA 1RGHA 3FF0A 5JPUA 3FG4A 2C11A 2W9QA 3G713 1NO3A 1BSBA 4XBYA 3SLUA 5CF2A 3VGNA 2JQ5A 5IG5A 2LQVA 1UCIA 3I563 1RRHA 2XGLA 3HIGA 3RGAA 2XEPA 1HKXA 4HYZA 5IF6A 3K63A 3ZFZA 1DMMA 2GEXA 2O9UX 2CX0A 2Y74A 1MWUA 1STDA 1TP6A 2I9WA 2WOFA 2OQEA 1QVG2 3CPOA 2BO9B 3DGMA 3BIRA 3DXOA 2P0MA 1DVCA 3LOYA 1A90A 4FMAA 4BTYA 2IYJA 2W2CA 5KP1A 3A76A 3G16A 2KF4A 2CWTA 1T3BA 8CHOA 1YJ93 1I8VA 1VZZA 4L8PA 3UB1A 4FCMA 5CF1A 4HM0B 1BNGA 1DMNA 4OK0A 5G2GA 3BNDA 1BVIA 2XF3A 1YI23 4G1MB 4XB5A 4EW5A 1JN5A 1M9GA 2K0MA 1D6UA 3ALAA 3LTCA 5D83A 2H0GA 1VQ53 4X2OA 1BNIA 1LNHA 1NDOB 3F7SA 1TIJA 5EEOA 1B2SA 7STDA 2YFIB 5I97A 2BIRA 3MWZA 4LZIA 1YVBI 1FYSA 1UCKA 3SXXA 3L0RA 2CFDA 1K41A 1WTHA 2KRTA 2YFLB 1IU7A 3K0ZA 1QMAA 3FLJA 2W9PA 4LYLB 5KP4A 1BSDA 1B27A 1CEWI 1KWIA 1RKYA 1VQ43 1VQP3 5IG3A 1JN5B 2OTL3 2CHCA 2HOHA 4JF8A 3EQQB 3CNMA 3NV0B 2ML5A 4HZBB 1O7WB 1O7MB 3CPW2 4O3VA 1IV9A 1JKGA 3I0YA 1BRHA 1GD3A 2GXFA 4MEIA 5RNTA 1W2ZA 1GMQA 1N8QA 2XH9A 4HOHA 1OF5B 1AR0A 1RLSA 3A5EA 1D6YA 1W6CA 1MWTA 2BMOB 1RHLA 1JB5A 3SOYA 3S27A 4O8SA 2KF5A 1TRQA 1VQ83 2XSOB 1BRGA 4ILFA 3MKIA 1SPUA 2F4YA 3LTDA 1TU5A 3AGOA 1O7GB 4R1KA 1X1WA 1TFOA 5JPPA 1UI7A 4MMZB 1W00A 4KZ1A 2OCTA 4HZ9B 1W7CA 1JKGB 1YJW3 1VQ93 1S723 5LC7A 1E3RA 2AADA 4HBRA 2E2VA 4GSPA 5AIGA 5KP3A 4FMBA 1W6GA 1FZUA 1I2EA 4IIAA 1M1XB 3OX9A 1B2UA 2P0XA 3FSDA 3CMA3 1FW7A 4KFDA 5BU4A 2B1XB 1Q7HA 1GY6A 3FZWA 5M19A 1E97A 5AIIA 4KT3B 1US1A 1TJDA 4BTWA 3GRDA 1BNRA 2CWVA 6GSPA 1I0XA 1MGWA 2E2UA 1GMRA 2B24B 3G4S3 3UL5A 4LMIA 3LMLA 1EKMA 5FW5A 1LNIA 3CCV3 1RNTA 1D6ZA 1OHOA 1AQZA 4FMCA 2QIYA 1AVKA 2BNGA 3F40A 1MGRA 2OOVC 1W02A 1B2ZA 4U13A 2CG1A 4WYKA 1BSAA 2P38A 1I2GA 1A2VA 3EBYA 4L8OA 1Q814 1F8NA 5AYSC 2Z77A 3CCE3 1IYYA 1UDII 1B20A 3V99A 1A2PA 1TTOA 2K54A 1T2IA 1V74A 4FMDA 3DGNA 2W6JH 1C54A 2OWPA 3D5IA 3KKGA 3LXUX 3I553 5IEPA 1UCJA 2CC3A 2CK3H 3B4OA 3WA3A 3WODG 1RJOA 1ZS7A 4MJDA 1QALA 5CLKA 2F86B 5G1KA 1RRLA 1ZX2A 1C7HA 2HMLB 5IG4A 1OPYA 1VQK3 1Q9EA 4L7KA 3K5TA 3FH1A 3AHSA 1S5AA 3KSPA 3X40A 1O7PB 1OGZA 5IENA 3IPTA 1JBRA 1YHQ3 4WYKB 1MNLA 1BSCA 2L1SA 3KN4A 3T0UA 1JBSA 1LVNA 3LZAA 5AIFA 2R4IA 5EVHA 2KCDA 3OXAA 4K1UA 2FXTA 1RGGA 4MMXB 3X41A 1BUQA 2HMOB 1RNBA 1RSNA 2CKFB 2RFRA 3FCSB 4XBXA 3LTAA 4J9AA 1STFI 3IMAB 4XDVA 1OHPA 2OOVA 1SARA 1VQ63 3NX0A 1G0TA 1PYLA 2HMMB 5IW9A 3NUVA 4GB5A 4HM8B 3EX9A 3G6E3 1N5HA 2R41A 3H3HA 1SIIA 3FGYA 2FGTA 2CW9A 2Z7AA 3K7CA 3CME3 1N8R4 4ZM8A 1JZOA 3KFQC 4CCVA 1JB4A 3WOFB 1BNSA 4STDA 1E3VA 3ZG5A 1GOVA 4K1VA 1UUWB 3DUKA 2H0HA 4OVMA 2CFLA 4FCZA 2UUGC 2KXGA 1RGKA 2ZHXB 3DGOA 1EEJA 4WP5A 2W0QA 2LYXA 3NV0A 4GL6A 6RNTA 1OGXA 1TFKA 3DY5A 1K734 3MG2A 1JBTA 5AEWB 3EE1A 4XM4A 2RSXA 1W4NA 2O3OA 5G1LA 3B4PA 1OF5A 3V92A 2K3DA 1PY3A 4BL2A 1B2MA 1JNQA 2BMRB 4KFFA 1W2B2 1BUJA 3N8BA 3BNBA 1BAOA 3DZLA 5JBSA 3VF1A 3MPHA 4HM5B 1GMPA 1LOWA 3OWUA 3Q90A 2KF3A 7GSPA 1LQMB 1X1YA 5A0OB 1OACA 4N3VA 4J5GA 5EQLA 3PS8A 4TX4A 4N6V0 2WGOA 1WMPA 2GU3A 2IUJA 7RNTA 1W6YA 2Z76A 2IUKA 1BRKA 3JUQA 2BMQB 2MF7A 1EUIC 1GOYA 1RN1A 4NREA 3X3XA 1NWWA 5AYRB 3UL6A 4WFOA 4EC6A 3MYTA 1KC84 2QGUA 1N5PA 3SVAA 1SQWA 2H0IA 1VQO3 2GU1A 2D42A 5IERA 3GZRA 1IVUA 2GBWB 1OH0A 1JRQA 3GAXA 1OCVA 1BANA 3CC23 4R9KA 2F98A 2L4VA 1EG9B 1FGOA 3F8HA 3FF2A 1R4YA 4HJLB 3WDGB 1BRSA 2BU4A 1ROAA 3MG1A 4QWTA 3WOEB 1GSPA 2PZVA 4N6MA 4RNZA 4HM6B 1NB5I 3JUNA 1ZO2A 4HM2B 1BU4A 1UUVB 2CH9A 2IY2A 3BNCA 2Z6BA 3IJEB 1RGCA 2XFSA 3KIIA 2C4BA 2ZDJA 3KZTA 3MSOA 3UNLA 2V1LA 1A2KA 1YJN3 3OWYA 2STDA 2OTJ3 3CC43 4FR9A 3CCJ3 1FUSA 1IV7A 5GSPA 1IVXA 1CYVA 1ULJB 1BIRA 1ZGXA 1DYUA 2HMKB 3F14A 1RGFA 4HM7B 3JUOA 4H61A 4BU4A 3LT9A 1VQQA 3BLZA 1GY7A 3PXMA 1VQ73 1T5YA 4OUQA 2YFJB 3U97A 3F8XA 4PEJA 4EV5A 3J7Yd 1IVWA 1L5GB 1YNVX 8RNTA 3URPA 1Y4KA 1MWRA 3NBBA 1IQXA 4RNTA 4XBTA 3HOHA 3O8YA 4J5KA 3PZWA 4NPBA 3DGLA 3NM7A 1FGMA 3S67A 1Q42A 1YIT3 3ZG0A 1WMNA 5HGRA 1B2XA 1BNFA 2C10A 1AY7A 3F9SA 4JRFA 3OWSA 3AHWA 4N6TA 3LH4A 4O02B 5BVBA 3S29A 3CC73 3PCSA 5LC6A 3FG1A 1QJGA 1JB2A 2W04A 1OUNA 3BU4A 3ER7A 3GZXB 3JVCA 5STDA 4AEQA 3EC9A 1K8A4 3K9MC 1TRPA 2UGIA 1LOXA 1YVSA 4I5QA 3D79A 5IG0A 1DMQA 3EHCA 3B8LA 3BB9A 4H3UA 1YGWA 1K9M4 3OV4A 1G96A 1Z1SA 1FUTA 1BRIA 1AV4A 2KAAA 4KVHA 1W5ZA 3EJVA 1B21A 1GY5A 5BIRA 4LSOA 3WMDA 1UGIA 2UX0A 3AMOA 4X2HA 4BL3A 1M1K4 1JJ22 4RZMA 1CQSA 1RGAA 3EBTA 4N6LA 5ELUA 1DETA 2F56A 4AKZA 1FGTA 1RGEA 3N9HA 1HU9A 1PFPA 1DE3A 1K28A 9RNTA 3T8UA 2P09A 3WHOA 1WMOA 1V58A 1IT7A 3HIIA 3MG3A 1ISKA 1Q40B 1BSEA 3KE7A 4N6NB 1LQGC 1KQS2 1MOLA 1RCKA 2JDIH 3TDGA 3M8CA 1J2BA 3RGRA 1QAFA 3G0KA 1NU3A 1TUHA 4AKYA 3QK9A 4N6OB 1NJI4 2Q07A 1LRAA 1LOYA 4ORLA 3CU3A 3UJMA 1HYFA 4CJNA 4R80A 3AMOB 3EB8A 3SOAA 3EN8A 2XGNA 1RTUA 3Q3FA 5M18A 3LT8A 6STDA 3H51A 1N9EA 1U5OA 3PGBA 1T2HA 2RBIA 1IVVA 2P05A 1UW1A 1HZ1A 4N6UA 1NNVA 2AAEA 4HKVB 5AI1A 3NQYA 1N9JA 1VQM3 3FG3A 1NB3I 1ROVA 2CX1A 4J8TA 2IMJA 1M904 4IPBA 4EXRA 1IDPA 3DGYA 2Y73A 5FGOA 2XR8B 1EA2A 5IEOA 3DH2A 3CCU3 2ZA4A 3OW22 1VQN3 3LTBA 4DKIA 5HOHA 1RGLA 4WWUC 5BXQA 2IA7A 5CK6A 2CFWA 3NBRA 4R4KA 1YIJ3 3DM8A 5D81A 1ASKA 4I4KA 3G8ZA 1FGQA 3EF8A 3LYGA 2CFKA 3PYJA 1I0VA 4Q53A 1GYBA 1A67A 5DREA 3D4AA 2XRXB 3CCQ3 3WA2X 2ZL8A 4R9LA 2RCDA 3GSPA 1Q7Y4 1Q824 2ML6A 1BGSA 1CYUA 2FNQA 5AIHA 3S28A 4K90B 4LEHA 1KSIA 2W56A 3GZYB 3GZBA 1BNJA 2KF6A 3KCHA 3SX1A 5ELJA 3DMCA 4KFEA 4BTXA 1GD4A 3NHXA 3CCS3 4EBGA 3E99A 4MMYB 1QVF2 1BRJA 3MHEA 2QA43 1BOXA 3QRDA 1BRNL 1W01A 2D1WA
chains in the Genus database with same CATH topology
1JV2B 4K61A 1FGRA 4WHAA 1IT8A 2WO0A 1U8CB 3D3LA 3F7XA 2XFTA 4HM1B 4CDLA 5TGNA 4EYCA 2WGQA 3KSED 3U1WA 1Q864 5DRVA 3Q1CA 1WNHA 4RBNA 2W56B 3SEDA 3VSYA 3CCL3 1FUWA 2XSHB 2BT3A 1IK3A 3NQZA 1GS3A 1R4CA 3GWRA 4HM3B 1SIHA 4IT7A 3BNEA 4HVNA 2SBLA 2A15A 3STDA 3X3ZA 2HMNB 3X42A 2RGQA 1AVLA 1SJWA 2PNCA 4FCJA 4O2HA 3HX8A 3PCRA 1VQL3 2F99A 4NHFA 3HZPA 3EN1B 1QAKA 1O7NB 4HM4B 2W03A 4LGQA 2MC8A 3V98A 2CWUA 4EV2A 2HMJB 5AEUB 1VQ83 3CXC2 2CFGA 3NM2A 5CXOA 3CD63 3T8NA 3ROBA 3RDEA 3CCR3 1ULIB 3HK4A 3JUPA 3NBJA 3X3YA 1EQKA 2WOHA 3FKAA 1WQLB 1RN7A 2OQEC 1Q40A 3CCM3 2E2TA 1IQYA 2YX9A 3B7CA 2CG0A 1UI8A 3CNXA 3JUMA 3NXJA 4XDWA 1DVDA 2M7OA 2GEYA 2QEX3 3HI7A 2BHMA 3D9RA 3ECFA 2CIUA 2GBXB 1O7HB 1IQ8A 3N54B 2INXA 3Q2PA 4RNYA 5D82A 1LXEA 1YGEA 1PU4A 1FA3A 3S5CA 1KD14 1OHSA 3FF0A 5JPUA 3FG4A 2C11A 2W9QA 3G713 1NO3A 4XBYA 3SLUA 5CF2A 3VGNA 2JQ5A 5IG5A 2LQVA 3I563 1RRHA 2XGLA 3HIGA 3RGAA 2XEPA 1HKXA 4HYZA 5IF6A 3K63A 1DMMA 2GEXA 2O9UX 2Y74A 1STDA 1TP6A 2I9WA 2WOFA 2OQEA 1QVG2 3CPOA 2BO9B 3DGMA 3DXOA 2P0MA 1DVCA 3LOYA 1A90A 4FMAA 4BTYA 2W2CA 5KP1A 3A76A 3G16A 2CWTA 8CHOA 1YJ93 1VZZA 3UB1A 4L8PA 4FCMA 5CF1A 4HM0B 1DMNA 4OK0A 5G2GA 3BNDA 2XF3A 1YI23 4G1MB 4XB5A 1JN5A 1M9GA 2K0MA 1D6UA 3ALAA 3LTCA 5D83A 1VQ53 4X2OA 1LNHA 3F7SA 1NDOB 1TIJA 5EEOA 7STDA 2YFIB 5I97A 3MWZA 4LZIA 1YVBI 3SXXA 3L0RA 2CFDA 1K41A 1WTHA 2KRTA 2YFLB 1IU7A 3K0ZA 1QMAA 3FLJA 2W9PA 5KP4A 1KWIA 1CEWI 1VQ43 1RKYA 1VQP3 5IG3A 1JN5B 2OTL3 2CHCA 4JF8A 3EQQB 3CNMA 3NV0B 2ML5A 4HZBB 1O7WB 1O7MB 3CPW2 4O3VA 1IV9A 1JKGA 3I0YA 1GD3A 2GXFA 4MEIA 1W2ZA 2XH9A 1N8QA 1OF5B 1AR0A 1D6YA 1W6CA 2BMOB 1JB5A 3SOYA 3S27A 4O8SA 2XSOB 3MKIA 1SPUA 3LTDA 1TU5A 1O7GB 4R1KA 1TFOA 5JPPA 1UI7A 4MMZB 1W00A 4KZ1A 2OCTA 4HZ9B 1W7CA 1JKGB 1YJW3 1VQ93 1S723 5LC7A 1E3RA 4HBRA 2E2VA 5AIGA 5KP3A 4FMBA 1W6GA 4IIAA 1M1XB 3OX9A 2P0XA 3FSDA 3CMA3 4KFDA 2B1XB 3FZWA 1GY6A 1E97A 5AIIA 1US1A 4BTWA 3GRDA 2CWVA 2E2UA 2B24B 3G4S3 3UL5A 4LMIA 3LMLA 1EKMA 5FW5A 3CCV3 1D6ZA 1OHOA 4FMCA 2QIYA 1AVKA 2BNGA 3F40A 2OOVC 1W02A 4U13A 2CG1A 4WYKA 2P38A 1A2VA 3EBYA 4L8OA 1Q814 1F8NA 5AYSC 2Z77A 3CCE3 3V99A 2K54A 1V74A 4FMDA 3DGNA 2W6JH 2OWPA 3KKGA 3LXUX 3I553 5IEPA 2CC3A 2CK3H 3B4OA 3WA3A 3WODG 1RJOA 4MJDA 5CLKA 1QALA 5IG4A 2F86B 1RRLA 1ZX2A 1C7HA 2HMLB 1OPYA 1VQK3 4L7KA 3K5TA 3FH1A 1S5AA 3KSPA 3X40A 1O7PB 1OGZA 5IENA 3IPTA 1YHQ3 4WYKB 1MNLA 3KN4A 3T0UA 1LVNA 3LZAA 5AIFA 2R4IA 5EVHA 2KCDA 3OXAA 4K1UA 2FXTA 3X41A 4MMXB 1BUQA 2HMOB 2CKFB 2RFRA 3FCSB 4XBXA 3LTAA 4J9AA 1STFI 3IMAB 4XDVA 1OHPA 2OOVA 1VQ63 3NX0A 2HMMB 5IW9A 3NUVA 4GB5A 4HM8B 3EX9A 3G6E3 1N5HA 3H3HA 1SIIA 3FGYA 2FGTA 2CW9A 2Z7AA 3K7CA 3CME3 1N8R4 4ZM8A 3KFQC 4CCVA 1JB4A 3WOFB 4STDA 1E3VA 4K1VA 1UUWB 3DUKA 4OVMA 2CFLA 4FCZA 2KXGA 3DGOA 4WP5A 2W0QA 2LYXA 3NV0A 4GL6A 1OGXA 1TFKA 3DY5A 1K734 3MG2A 5AEWB 3EE1A 4XM4A 2RSXA 1W4NA 2O3OA 3B4PA 1OF5A 3V92A 1JNQA 2BMRB 4KFFA 1W2B2 3N8BA 3BNBA 3DZLA 5JBSA 3VF1A 3MPHA 4HM5B 3OWUA 3Q90A 5A0OB 1OACA 4N3VA 5EQLA 3PS8A 4TX4A 4N6V0 2WGOA 1WMPA 2GU3A 2IUJA 1W6YA 2Z76A 2IUKA 3JUQA 2BMQB 2MF7A 4NREA 3X3XA 1NWWA 5AYRB 3UL6A 4WFOA 4EC6A 3MYTA 1KC84 2QGUA 1N5PA 3SVAA 1SQWA 1VQO3 2GU1A 2D42A 5IERA 3GZRA 1IVUA 2GBWB 1OH0A 1JRQA 3GAXA 1OCVA 3CC23 4R9KA 2F98A 2L4VA 1EG9B 1FGOA 3F8HA 3FF2A 3WDGB 4HJLB 1ROAA 3MG1A 4QWTA 3WOEB 2PZVA 1NB5I 4N6MA 4RNZA 4HM6B 3JUNA 1ZO2A 4HM2B 1K9M4 1UUVB 2CH9A 3BNCA 3IJEB 2Z6BA 3KIIA 2XFSA 2ZDJA 3KZTA 3MSOA 3UNLA 2V1LA 1A2KA 1YJN3 3OWYA 2STDA 2OTJ3 3CC43 4FR9A 3CCJ3 1IV7A 1IVXA 1CYVA 1ULJB 2HMKB 3F14A 1DYUA 4HM7B 3JUOA 4H61A 3LT9A 3PXMA 3BLZA 1GY7A 1VQ73 1T5YA 4OUQA 2YFJB 3U97A 3F8XA 4PEJA 4EV5A 3J7Yd 1IVWA 1L5GB 1Y4KA 3NBBA 1IQXA 4XBTA 3O8YA 3PZWA 3DGLA 3NM7A 1FGMA 3S67A 1Q42A 1YIT3 1WMNA 5HGRA 2C10A 3F9SA 4JRFA 3OWSA 4N6TA 3LH4A 4O02B 5BVBA 3S29A 3CC73 3PCSA 5LC6A 3FG1A 1QJGA 1JB2A 2W04A 1OUNA 3ER7A 3GZXB 5STDA 3JVCA 4AEQA 3EC9A 1K8A4 3K9MC 1LOXA 5IG0A 1DMQA 3EHCA 3B8LA 3BB9A 4H3UA 3OV4A 1G96A 1Z1SA 1AV4A 4KVHA 1W5ZA 3EJVA 1GY5A 4LSOA 3WMDA 2UX0A 4X2HA 3AMOA 1M1K4 1JJ22 4RZMA 1CQSA 3EBTA 4N6LA 4AKZA 5ELUA 1FGTA 3N9HA 1HU9A 1PFPA 1K28A 3T8UA 2P09A 1WMOA 1IT7A 3HIIA 3MG3A 1ISKA 1Q40B 3KE7A 4N6NB 1KQS2 1MOLA 2JDIH 3TDGA 3M8CA 1J2BA 3RGRA 1QAFA 3G0KA 1NU3A 1TUHA 4AKYA 3QK9A 4N6OB 1NJI4 2Q07A 4ORLA 3UJMA 3CU3A 4R80A 3AMOB 3EB8A 3SOAA 3EN8A 2XGNA 3LT8A 6STDA 3H51A 1N9EA 1U5OA 3PGBA 1IVVA 2P05A 1UW1A 4N6UA 4HKVB 5AI1A 3NQYA 1N9JA 1VQM3 3FG3A 1NB3I 1ROVA 4J8TA 2IMJA 1M904 4IPBA 4EXRA 1IDPA 5FGOA 2Y73A 2XR8B 1EA2A 5IEOA 3CCU3 1VQN3 3OW22 3LTBA 4WWUC 5BXQA 2IA7A 5CK6A 2CFWA 3NBRA 4R4KA 1YIJ3 3DM8A 5D81A 1ASKA 4I4KA 3G8ZA 1FGQA 3EF8A 3LYGA 2CFKA 3PYJA 4Q53A 1GYBA 1A67A 5DREA 2XRXB 3CCQ3 3WA2X 2ZL8A 4R9LA 2RCDA 1Q7Y4 1Q824 2ML6A 1CYUA 2FNQA 5AIHA 3S28A 4K90B 4LEHA 1KSIA 2W56A 3GZYB 3GZBA 3SX1A 5ELJA 3DMCA 4KFEA 4BTXA 1GD4A 3NHXA 3CCS3 4EBGA 3E99A 4MMYB 1QVF2 3MHEA 2QA43 3QRDA 1W01A 2D1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7X A;  4HM1 B;  4CDL A;  5TGN A;  5DRV A;  3SED A;  3VSY A;  2XSH B;  1GS3 A;  3GWR A;  4HM3 B;  4HVN A;  2A15 A;  3STD A;  2HMN B;  2RGQ A;  1SJW A;  4FCJ A;  3HX8 A;  2F99 A;  3HZP A;  3EN1 B;  1O7N B;  4HM4 B;  4LGQ A;  2HMJ B;  5AEU B;  3NM2 A;  5CXO A;  3T8N A;  3ROB A;  1ULI B;  3HK4 A;  3JUP A;  3FKA A;  1WQL B;  1Q40 A;  3B7C A;  3CNX A;  3JUM A;  3NXJ A;  4XDW A;  2GEY A;  3D9R A;  3ECF A;  2GBX B;  1O7H B;  2INX A;  5D82 A;  3S5C A;  1OHS A;  3FF0 A;  5JPU A;  4XBY A;  5CF2 A;  3VGN A;  2JQ5 A;  5IG5 A;  3RGA A;  1HKX A;  5IF6 A;  1DMM A;  2GEX A;  1TP6 A;  1STD A;  2I9W A;  3CPO A;  3DXO A;  5KP1 A;  2W2C A;  3A76 A;  3G16 A;  8CHO A;  1VZZ A;  4L8P A;  4FCM A;  5CF1 A;  4HM0 B;  1DMN A;  5G2G A;  4XB5 A;  1JN5 A;  5D83 A;  4X2O A;  3F7S A;  1NDO B;  7STD A;  2YFI B;  1K41 A;  2YFL B;  3K0Z A;  1QMA A;  3FLJ A;  5KP4 A;  5IG3 A;  1JN5 B;  2CHC A;  3EQQ B;  3CNM A;  3NV0 B;  4HZB B;  1O7W B;  1O7M B;  1JKG A;  3I0Y A;  2GXF A;  1OF5 B;  1AR0 A;  2BMO B;  1JB5 A;  3SOY A;  2XSO B;  3MKI A;  1O7G B;  4R1K A;  5JPP A;  1W00 A;  4HZ9 B;  1JKG B;  1E3R A;  5AIG A;  5KP3 A;  4IIA A;  3OX9 A;  3FSD A;  2B1X B;  3FZW A;  1GY6 A;  1E97 A;  5AII A;  3GRD A;  2B24 B;  4LMI A;  5FW5 A;  1OHO A;  2QIY A;  2BNG A;  3F40 A;  1W02 A;  4U13 A;  4WYK A;  3EBY A;  4L8O A;  2Z77 A;  2K54 A;  2OWP A;  3KKG A;  5IEP A;  3B4O A;  4MJD A;  5CLK A;  5IG4 A;  2F86 B;  1ZX2 A;  1C7H A;  2HML B;  1OPY A;  4L7K A;  3FH1 A;  1S5A A;  3KSP A;  1O7P B;  1OGZ A;  5IEN A;  3IPT A;  4WYK B;  3LZA A;  5AIF A;  2R4I A;  5EVH A;  3OXA A;  4K1U A;  1BUQ A;  2HMO B;  2CKF B;  2RFR A;  4XBX A;  4XDV A;  4J9A A;  1OHP A;  2HMM B;  3NUV A;  4GB5 A;  4HM8 B;  3EX9 A;  3H3H A;  3FGY A;  2Z7A A;  3K7C A;  1JB4 A;  4STD A;  1E3V A;  4K1V A;  1UUW B;  3DUK A;  4OVM A;  4WP5 A;  3NV0 A;  1OGX A;  3MG2 A;  5AEW B;  4XM4 A;  3B4P A;  1OF5 A;  2BMR B;  3DZL A;  4HM5 B;  3OWU A;  3Q90 A;  4N3V A;  1W6Y A;  2Z76 A;  3JUQ A;  2BMQ B;  1NWW A;  3MYT A;  2QGU A;  5IER A;  3GZR A;  2GBW B;  1OH0 A;  1OCV A;  4R9K A;  2F98 A;  1EG9 B;  3F8H A;  3FF2 A;  4HJL B;  3MG1 A;  2PZV A;  4HM6 B;  3JUN A;  1ZO2 A;  4HM2 B;  1UUV B;  3KZT A;  3MSO A;  3UNL A;  1A2K A;  3OWY A;  2STD A;  1ULJ B;  2HMK B;  3F14 A;  4HM7 B;  3JUO A;  3BLZ A;  1GY7 A;  4OUQ A;  2YFJ B;  3F8X A;  4PEJ A;  4XBT A;  1Q42 A;  5HGR A;  3F9S A;  3OWS A;  5BVB A;  1QJG A;  1JB2 A;  1OUN A;  3ER7 A;  3GZX B;  5STD A;  3EC9 A;  5IG0 A;  1DMQ A;  3EHC A;  3B8L A;  3BB9 A;  4H3U A;  3OV4 A;  1Z1S A;  4KVH A;  3EJV A;  1GY5 A;  3WMD A;  2UX0 A;  4X2H A;  4RZM A;  1CQS A;  3EBT A;  3T8U A;  3MG3 A;  1ISK A;  1Q40 B;  3KE7 A;  3M8C A;  3RGR A;  3G0K A;  1NU3 A;  1TUH A;  4ORL A;  3UJM A;  3CU3 A;  3SOA A;  3EN8 A;  6STD A;  3H51 A;  1U5O A;  4HKV B;  5AI1 A;  4J8T A;  2IMJ A;  1IDP A;  2XR8 B;  1EA2 A;  5IEO A;  4WWU C;  5BXQ A;  5CK6 A;  3NBR A;  3DM8 A;  5D81 A;  1ASK A;  4I4K A;  3G8Z A;  3EF8 A;  3LYG A;  4Q53 A;  1GYB A;  5DRE A;  2XRX B;  4R9L A;  2RCD A;  5AIH A;  4LEH A;  3GZY B;  3GZB A;  3DMC A;  3NHX A;  3E99 A;  3MHE A;  1W01 A; 
#chains in the Genus database with same CATH topology
 2SAR A;  1JV2 B;  1UCL A;  1I3F A;  2J8X B;  1FGR A;  4K61 A;  4WHA A;  1IT8 A;  2WO0 A;  1U8C B;  3D3L A;  1I70 A;  3F7X A;  1LOV A;  2XFT A;  4HM1 B;  2F5M A;  4CDL A;  3WR2 A;  5TGN A;  4EYC A;  2WGQ A;  3KSE D;  3U1W A;  1Q86 4;  5DRV A;  3Q1C A;  1WNH A;  4RBN A;  2W56 B;  3SED A;  3VSY A;  3CCL 3;  1FUW A;  2XSH B;  2BT3 A;  1IK3 A;  3NQZ A;  1GS3 A;  1R4C A;  3GWR A;  4HM3 B;  1SIH A;  4IT7 A;  3BNE A;  4HVN A;  1X1U A;  2A15 A;  1I3I A;  2RNT A;  2SBL A;  3STD A;  3X3Z A;  2HMN B;  3X42 A;  4BIR A;  1RMS A;  1CH0 A;  2RGQ A;  4CPK A;  1AVL A;  1SJW A;  2PNC A;  1JZD A;  4FCJ A;  3HX8 A;  3PCR A;  4O2H A;  1VQL 3;  2F99 A;  4NHF A;  1RCL A;  1RDS A;  3HZP A;  3SYU A;  1I2F A;  3EN1 B;  1GOU A;  1O7N B;  1QAK A;  2W03 A;  1V57 A;  4HM4 B;  4LGQ A;  2CWU A;  2MC8 A;  2HMJ B;  3V98 A;  4EV2 A;  5AEU B;  2F5W A;  3CXC 2;  2CFG A;  2GSP A;  3NM2 A;  5CXO A;  5M1A A;  3CD6 3;  3T8N A;  3ROB A;  3RDE A;  3CCR 3;  1MWS A;  1ULI B;  3HK4 A;  3JUP A;  3NBJ A;  3X3Y A;  1EQK A;  2WOH A;  3FKA A;  1WQL B;  3RNT A;  3AGN A;  4HAA A;  1RN7 A;  2OQE C;  1B3S A;  1Q40 A;  3CCM 3;  2E2T A;  1IQY A;  1BNE A;  2YX9 A;  3B7C A;  1UUG B;  2CG0 A;  1UI8 A;  3CNX A;  3JUM A;  3NXJ A;  4XDW A;  1DVD A;  2M7O A;  2GEY A;  1RN4 A;  3HI7 A;  2QEX 3;  2BHM A;  3D9R A;  3ECF A;  2CIU A;  2GBX B;  1UGH I;  4GHO A;  1O7H B;  1IQ8 A;  3N54 B;  1X1X A;  2INX A;  1G02 A;  3Q2P A;  4RNY A;  5D82 A;  1LXE A;  1YGE A;  1PU4 A;  1FA3 A;  3S5C A;  3D5G A;  1KD1 4;  1OHS A;  1RGH A;  3FF0 A;  5JPU A;  3FG4 A;  2C11 A;  2W9Q A;  3G71 3;  1NO3 A;  1BSB A;  4XBY A;  3SLU A;  5CF2 A;  3VGN A;  2JQ5 A;  5IG5 A;  2LQV A;  1UCI A;  3I56 3;  1RRH A;  2XGL A;  3HIG A;  3RGA A;  2XEP A;  1HKX A;  4HYZ A;  5IF6 A;  3K63 A;  3ZFZ A;  1DMM A;  2GEX A;  2O9U X;  2CX0 A;  2Y74 A;  1MWU A;  1STD A;  1TP6 A;  2I9W A;  2WOF A;  2OQE A;  1QVG 2;  3CPO A;  2BO9 B;  3DGM A;  3BIR A;  3DXO A;  2P0M A;  1DVC A;  3LOY A;  1A90 A;  4FMA A;  4BTY A;  2IYJ A;  2W2C A;  5KP1 A;  3A76 A;  3G16 A;  2KF4 A;  2CWT A;  1T3B A;  8CHO A;  1YJ9 3;  1I8V A;  1VZZ A;  4L8P A;  3UB1 A;  4FCM A;  5CF1 A;  4HM0 B;  1BNG A;  1DMN A;  4OK0 A;  5G2G A;  3BND A;  1BVI A;  2XF3 A;  1YI2 3;  4G1M B;  4XB5 A;  4EW5 A;  1JN5 A;  1M9G A;  2K0M A;  1D6U A;  3ALA A;  3LTC A;  5D83 A;  2H0G A;  1VQ5 3;  4X2O A;  1BNI A;  1LNH A;  1NDO B;  3F7S A;  1TIJ A;  5EEO A;  1B2S A;  7STD A;  2YFI B;  5I97 A;  2BIR A;  3MWZ A;  4LZI A;  1YVB I;  1FYS A;  1UCK A;  3SXX A;  3L0R A;  2CFD A;  1K41 A;  1WTH A;  2KRT A;  2YFL B;  1IU7 A;  3K0Z A;  1QMA A;  3FLJ A;  2W9P A;  4LYL B;  5KP4 A;  1BSD A;  1B27 A;  1CEW I;  1KWI A;  1RKY A;  1VQ4 3;  1VQP 3;  5IG3 A;  1JN5 B;  2OTL 3;  2CHC A;  2HOH A;  4JF8 A;  3EQQ B;  3CNM A;  3NV0 B;  2ML5 A;  4HZB B;  1O7W B;  1O7M B;  3CPW 2;  4O3V A;  1IV9 A;  1JKG A;  3I0Y A;  1BRH A;  1GD3 A;  2GXF A;  4MEI A;  5RNT A;  1W2Z A;  1GMQ A;  1N8Q A;  2XH9 A;  4HOH A;  1OF5 B;  1AR0 A;  1RLS A;  3A5E A;  1D6Y A;  1W6C A;  1MWT A;  2BMO B;  1RHL A;  1JB5 A;  3SOY A;  3S27 A;  4O8S A;  2KF5 A;  1TRQ A;  1VQ8 3;  2XSO B;  1BRG A;  4ILF A;  3MKI A;  1SPU A;  2F4Y A;  3LTD A;  1TU5 A;  3AGO A;  1O7G B;  4R1K A;  1X1W A;  1TFO A;  5JPP A;  1UI7 A;  4MMZ B;  1W00 A;  4KZ1 A;  2OCT A;  4HZ9 B;  1W7C A;  1JKG B;  1YJW 3;  1VQ9 3;  1S72 3;  5LC7 A;  1E3R A;  2AAD A;  4HBR A;  2E2V A;  4GSP A;  5AIG A;  5KP3 A;  4FMB A;  1W6G A;  1FZU A;  1I2E A;  4IIA A;  1M1X B;  3OX9 A;  1B2U A;  2P0X A;  3FSD A;  3CMA 3;  1FW7 A;  4KFD A;  5BU4 A;  2B1X B;  1Q7H A;  1GY6 A;  3FZW A;  5M19 A;  1E97 A;  5AII A;  4KT3 B;  1US1 A;  1TJD A;  4BTW A;  3GRD A;  1BNR A;  2CWV A;  6GSP A;  1I0X A;  1MGW A;  2E2U A;  1GMR A;  2B24 B;  3G4S 3;  3UL5 A;  4LMI A;  3LML A;  1EKM A;  5FW5 A;  1LNI A;  3CCV 3;  1RNT A;  1D6Z A;  1OHO A;  1AQZ A;  4FMC A;  2QIY A;  1AVK A;  2BNG A;  3F40 A;  1MGR A;  2OOV C;  1W02 A;  1B2Z A;  4U13 A;  2CG1 A;  4WYK A;  1BSA A;  2P38 A;  1I2G A;  1A2V A;  3EBY A;  4L8O A;  1Q81 4;  1F8N A;  5AYS C;  2Z77 A;  3CCE 3;  1IYY A;  1UDI I;  1B20 A;  3V99 A;  1A2P A;  1TTO A;  2K54 A;  1T2I A;  1V74 A;  4FMD A;  3DGN A;  2W6J H;  1C54 A;  2OWP A;  3D5I A;  3KKG A;  3LXU X;  3I55 3;  5IEP A;  1UCJ A;  2CC3 A;  2CK3 H;  3B4O A;  3WA3 A;  3WOD G;  1RJO A;  1ZS7 A;  4MJD A;  1QAL A;  5CLK A;  2F86 B;  5G1K A;  1RRL A;  1ZX2 A;  1C7H A;  2HML B;  5IG4 A;  1OPY A;  1VQK 3;  1Q9E A;  4L7K A;  3K5T A;  3FH1 A;  3AHS A;  1S5A A;  3KSP A;  3X40 A;  1O7P B;  1OGZ A;  5IEN A;  3IPT A;  1JBR A;  1YHQ 3;  4WYK B;  1MNL A;  1BSC A;  2L1S A;  3KN4 A;  3T0U A;  1JBS A;  1LVN A;  3LZA A;  5AIF A;  2R4I A;  5EVH A;  2KCD A;  3OXA A;  4K1U A;  2FXT A;  1RGG A;  4MMX B;  3X41 A;  1BUQ A;  2HMO B;  1RNB A;  1RSN A;  2CKF B;  2RFR A;  3FCS B;  4XBX A;  3LTA A;  4J9A A;  1STF I;  3IMA B;  4XDV A;  1OHP A;  2OOV A;  1SAR A;  1VQ6 3;  3NX0 A;  1G0T A;  1PYL A;  2HMM B;  5IW9 A;  3NUV A;  4GB5 A;  4HM8 B;  3EX9 A;  3G6E 3;  1N5H A;  2R41 A;  3H3H A;  1SII A;  3FGY A;  2FGT A;  2CW9 A;  2Z7A A;  3K7C A;  3CME 3;  1N8R 4;  4ZM8 A;  1JZO A;  3KFQ C;  4CCV A;  1JB4 A;  3WOF B;  1BNS A;  4STD A;  1E3V A;  3ZG5 A;  1GOV A;  4K1V A;  1UUW B;  3DUK A;  2H0H A;  4OVM A;  2CFL A;  4FCZ A;  2UUG C;  2KXG A;  1RGK A;  2ZHX B;  3DGO A;  1EEJ A;  4WP5 A;  2W0Q A;  2LYX A;  3NV0 A;  4GL6 A;  6RNT A;  1OGX A;  1TFK A;  3DY5 A;  1K73 4;  3MG2 A;  1JBT A;  5AEW B;  3EE1 A;  4XM4 A;  2RSX A;  1W4N A;  2O3O A;  5G1L A;  3B4P A;  1OF5 A;  3V92 A;  2K3D A;  1PY3 A;  4BL2 A;  1B2M A;  1JNQ A;  2BMR B;  4KFF A;  1W2B 2;  1BUJ A;  3N8B A;  3BNB A;  1BAO A;  3DZL A;  5JBS A;  3VF1 A;  3MPH A;  4HM5 B;  1GMP A;  1LOW A;  3OWU A;  3Q90 A;  2KF3 A;  7GSP A;  1LQM B;  1X1Y A;  5A0O B;  1OAC A;  4N3V A;  4J5G A;  5EQL A;  3PS8 A;  4TX4 A;  4N6V 0;  2WGO A;  1WMP A;  2GU3 A;  2IUJ A;  7RNT A;  1W6Y A;  2Z76 A;  2IUK A;  1BRK A;  3JUQ A;  2BMQ B;  2MF7 A;  1EUI C;  1GOY A;  1RN1 A;  4NRE A;  3X3X A;  1NWW A;  5AYR B;  3UL6 A;  4WFO A;  4EC6 A;  3MYT A;  1KC8 4;  2QGU A;  1N5P A;  3SVA A;  1SQW A;  2H0I A;  1VQO 3;  2GU1 A;  2D42 A;  5IER A;  3GZR A;  1IVU A;  2GBW B;  1OH0 A;  1JRQ A;  3GAX A;  1OCV A;  1BAN A;  3CC2 3;  4R9K A;  2F98 A;  2L4V A;  1EG9 B;  1FGO A;  3F8H A;  3FF2 A;  1R4Y A;  4HJL B;  3WDG B;  1BRS A;  2BU4 A;  1ROA A;  3MG1 A;  4QWT A;  3WOE B;  1GSP A;  2PZV A;  4N6M A;  4RNZ A;  4HM6 B;  1NB5 I;  3JUN A;  1ZO2 A;  4HM2 B;  1BU4 A;  1UUV B;  2CH9 A;  2IY2 A;  3BNC A;  2Z6B A;  3IJE B;  1RGC A;  2XFS A;  3KII A;  2C4B A;  2ZDJ A;  3KZT A;  3MSO A;  3UNL A;  2V1L A;  1A2K A;  1YJN 3;  3OWY A;  2STD A;  2OTJ 3;  3CC4 3;  4FR9 A;  3CCJ 3;  1FUS A;  1IV7 A;  5GSP A;  1IVX A;  1CYV A;  1ULJ B;  1BIR A;  1ZGX A;  1DYU A;  2HMK B;  3F14 A;  1RGF A;  4HM7 B;  3JUO A;  4H61 A;  4BU4 A;  3LT9 A;  1VQQ A;  3BLZ A;  1GY7 A;  3PXM A;  1VQ7 3;  1T5Y A;  4OUQ A;  2YFJ B;  3U97 A;  3F8X A;  4PEJ A;  4EV5 A;  3J7Y d;  1IVW A;  1L5G B;  1YNV X;  8RNT A;  3URP A;  1Y4K A;  1MWR A;  3NBB A;  1IQX A;  4RNT A;  4XBT A;  3HOH A;  3O8Y A;  4J5K A;  3PZW A;  4NPB A;  3DGL A;  3NM7 A;  1FGM A;  3S67 A;  1Q42 A;  1YIT 3;  3ZG0 A;  1WMN A;  5HGR A;  1B2X A;  1BNF A;  2C10 A;  1AY7 A;  3F9S A;  4JRF A;  3OWS A;  3AHW A;  4N6T A;  3LH4 A;  4O02 B;  5BVB A;  3S29 A;  3CC7 3;  3PCS A;  5LC6 A;  3FG1 A;  1QJG A;  1JB2 A;  2W04 A;  1OUN A;  3BU4 A;  3ER7 A;  3GZX B;  3JVC A;  5STD A;  4AEQ A;  3EC9 A;  1K8A 4;  3K9M C;  1TRP A;  2UGI A;  1LOX A;  1YVS A;  4I5Q A;  3D79 A;  5IG0 A;  1DMQ A;  3EHC A;  3B8L A;  3BB9 A;  4H3U A;  1YGW A;  1K9M 4;  3OV4 A;  1G96 A;  1Z1S A;  1FUT A;  1BRI A;  1AV4 A;  2KAA A;  4KVH A;  1W5Z A;  3EJV A;  1B21 A;  1GY5 A;  5BIR A;  4LSO A;  3WMD A;  1UGI A;  2UX0 A;  3AMO A;  4X2H A;  4BL3 A;  1M1K 4;  1JJ2 2;  4RZM A;  1CQS A;  1RGA A;  3EBT A;  4N6L A;  5ELU A;  1DET A;  2F56 A;  4AKZ A;  1FGT A;  1RGE A;  3N9H A;  1HU9 A;  1PFP A;  1DE3 A;  1K28 A;  9RNT A;  3T8U A;  2P09 A;  3WHO A;  1WMO A;  1V58 A;  1IT7 A;  3HII A;  3MG3 A;  1ISK A;  1Q40 B;  1BSE A;  3KE7 A;  4N6N B;  1LQG C;  1KQS 2;  1MOL A;  1RCK A;  2JDI H;  3TDG A;  3M8C A;  1J2B A;  3RGR A;  1QAF A;  3G0K A;  1NU3 A;  1TUH A;  4AKY A;  3QK9 A;  4N6O B;  1NJI 4;  2Q07 A;  1LRA A;  1LOY A;  4ORL A;  3CU3 A;  3UJM A;  1HYF A;  4CJN A;  4R80 A;  3AMO B;  3EB8 A;  3SOA A;  3EN8 A;  2XGN A;  1RTU A;  3Q3F A;  5M18 A;  3LT8 A;  6STD A;  3H51 A;  1N9E A;  1U5O A;  3PGB A;  1T2H A;  2RBI A;  1IVV A;  2P05 A;  1UW1 A;  1HZ1 A;  4N6U A;  1NNV A;  2AAE A;  4HKV B;  5AI1 A;  3NQY A;  1N9J A;  1VQM 3;  3FG3 A;  1NB3 I;  1ROV A;  2CX1 A;  4J8T A;  2IMJ A;  1M90 4;  4IPB A;  4EXR A;  1IDP A;  3DGY A;  2Y73 A;  5FGO A;  2XR8 B;  1EA2 A;  5IEO A;  3DH2 A;  3CCU 3;  2ZA4 A;  3OW2 2;  1VQN 3;  3LTB A;  4DKI A;  5HOH A;  1RGL A;  4WWU C;  5BXQ A;  2IA7 A;  5CK6 A;  2CFW A;  3NBR A;  4R4K A;  1YIJ 3;  3DM8 A;  5D81 A;  1ASK A;  4I4K A;  3G8Z A;  1FGQ A;  3EF8 A;  3LYG A;  2CFK A;  3PYJ A;  1I0V A;  4Q53 A;  1GYB A;  1A67 A;  5DRE A;  3D4A A;  2XRX B;  3CCQ 3;  3WA2 X;  2ZL8 A;  4R9L A;  2RCD A;  3GSP A;  1Q7Y 4;  1Q82 4;  2ML6 A;  1BGS A;  1CYU A;  2FNQ A;  5AIH A;  3S28 A;  4K90 B;  4LEH A;  1KSI A;  2W56 A;  3GZY B;  3GZB A;  1BNJ A;  2KF6 A;  3KCH A;  3SX1 A;  5ELJ A;  3DMC A;  4KFE A;  4BTX A;  1GD4 A;  3NHX A;  3CCS 3;  4EBG A;  3E99 A;  4MMY B;  1QVF 2;  1BRJ A;  3MHE A;  2QA4 3;  1BOX A;  3QRD A;  1BRN L;  1W01 A;  2D1W A; 
#chains in the Genus database with same CATH homology
 1JV2 B;  4K61 A;  1FGR A;  4WHA A;  1IT8 A;  2WO0 A;  1U8C B;  3D3L A;  3F7X A;  2XFT A;  4HM1 B;  4CDL A;  5TGN A;  4EYC A;  2WGQ A;  3KSE D;  3U1W A;  1Q86 4;  5DRV A;  3Q1C A;  1WNH A;  4RBN A;  2W56 B;  3SED A;  3VSY A;  3CCL 3;  1FUW A;  2XSH B;  2BT3 A;  1IK3 A;  3NQZ A;  1GS3 A;  1R4C A;  3GWR A;  4HM3 B;  1SIH A;  4IT7 A;  3BNE A;  4HVN A;  2SBL A;  2A15 A;  3STD A;  3X3Z A;  2HMN B;  3X42 A;  2RGQ A;  1AVL A;  1SJW A;  2PNC A;  4FCJ A;  4O2H A;  3HX8 A;  3PCR A;  1VQL 3;  2F99 A;  4NHF A;  3HZP A;  3EN1 B;  1QAK A;  1O7N B;  4HM4 B;  2W03 A;  4LGQ A;  2MC8 A;  3V98 A;  2CWU A;  4EV2 A;  2HMJ B;  5AEU B;  1VQ8 3;  3CXC 2;  2CFG A;  3NM2 A;  5CXO A;  3CD6 3;  3T8N A;  3ROB A;  3RDE A;  3CCR 3;  1ULI B;  3HK4 A;  3JUP A;  3NBJ A;  3X3Y A;  1EQK A;  2WOH A;  3FKA A;  1WQL B;  1RN7 A;  2OQE C;  1Q40 A;  3CCM 3;  2E2T A;  1IQY A;  2YX9 A;  3B7C A;  2CG0 A;  1UI8 A;  3CNX A;  3JUM A;  3NXJ A;  4XDW A;  1DVD A;  2M7O A;  2GEY A;  2QEX 3;  3HI7 A;  2BHM A;  3D9R A;  3ECF A;  2CIU A;  2GBX B;  1O7H B;  1IQ8 A;  3N54 B;  2INX A;  3Q2P A;  4RNY A;  5D82 A;  1LXE A;  1YGE A;  1PU4 A;  1FA3 A;  3S5C A;  1KD1 4;  1OHS A;  3FF0 A;  5JPU A;  3FG4 A;  2C11 A;  2W9Q A;  3G71 3;  1NO3 A;  4XBY A;  3SLU A;  5CF2 A;  3VGN A;  2JQ5 A;  5IG5 A;  2LQV A;  3I56 3;  1RRH A;  2XGL A;  3HIG A;  3RGA A;  2XEP A;  1HKX A;  4HYZ A;  5IF6 A;  3K63 A;  1DMM A;  2GEX A;  2O9U X;  2Y74 A;  1STD A;  1TP6 A;  2I9W A;  2WOF A;  2OQE A;  1QVG 2;  3CPO A;  2BO9 B;  3DGM A;  3DXO A;  2P0M A;  1DVC A;  3LOY A;  1A90 A;  4FMA A;  4BTY A;  2W2C A;  5KP1 A;  3A76 A;  3G16 A;  2CWT A;  8CHO A;  1YJ9 3;  1VZZ A;  3UB1 A;  4L8P A;  4FCM A;  5CF1 A;  4HM0 B;  1DMN A;  4OK0 A;  5G2G A;  3BND A;  2XF3 A;  1YI2 3;  4G1M B;  4XB5 A;  1JN5 A;  1M9G A;  2K0M A;  1D6U A;  3ALA A;  3LTC A;  5D83 A;  1VQ5 3;  4X2O A;  1LNH A;  3F7S A;  1NDO B;  1TIJ A;  5EEO A;  7STD A;  2YFI B;  5I97 A;  3MWZ A;  4LZI A;  1YVB I;  3SXX A;  3L0R A;  2CFD A;  1K41 A;  1WTH A;  2KRT A;  2YFL B;  1IU7 A;  3K0Z A;  1QMA A;  3FLJ A;  2W9P A;  5KP4 A;  1KWI A;  1CEW I;  1VQ4 3;  1RKY A;  1VQP 3;  5IG3 A;  1JN5 B;  2OTL 3;  2CHC A;  4JF8 A;  3EQQ B;  3CNM A;  3NV0 B;  2ML5 A;  4HZB B;  1O7W B;  1O7M B;  3CPW 2;  4O3V A;  1IV9 A;  1JKG A;  3I0Y A;  1GD3 A;  2GXF A;  4MEI A;  1W2Z A;  2XH9 A;  1N8Q A;  1OF5 B;  1AR0 A;  1D6Y A;  1W6C A;  2BMO B;  1JB5 A;  3SOY A;  3S27 A;  4O8S A;  2XSO B;  3MKI A;  1SPU A;  3LTD A;  1TU5 A;  1O7G B;  4R1K A;  1TFO A;  5JPP A;  1UI7 A;  4MMZ B;  1W00 A;  4KZ1 A;  2OCT A;  4HZ9 B;  1W7C A;  1JKG B;  1YJW 3;  1VQ9 3;  1S72 3;  5LC7 A;  1E3R A;  4HBR A;  2E2V A;  5AIG A;  5KP3 A;  4FMB A;  1W6G A;  4IIA A;  1M1X B;  3OX9 A;  2P0X A;  3FSD A;  3CMA 3;  4KFD A;  2B1X B;  3FZW A;  1GY6 A;  1E97 A;  5AII A;  1US1 A;  4BTW A;  3GRD A;  2CWV A;  2E2U A;  2B24 B;  3G4S 3;  3UL5 A;  4LMI A;  3LML A;  1EKM A;  5FW5 A;  3CCV 3;  1D6Z A;  1OHO A;  4FMC A;  2QIY A;  1AVK A;  2BNG A;  3F40 A;  2OOV C;  1W02 A;  4U13 A;  2CG1 A;  4WYK A;  2P38 A;  1A2V A;  3EBY A;  4L8O A;  1Q81 4;  1F8N A;  5AYS C;  2Z77 A;  3CCE 3;  3V99 A;  2K54 A;  1V74 A;  4FMD A;  3DGN A;  2W6J H;  2OWP A;  3KKG A;  3LXU X;  3I55 3;  5IEP A;  2CC3 A;  2CK3 H;  3B4O A;  3WA3 A;  3WOD G;  1RJO A;  4MJD A;  5CLK A;  1QAL A;  5IG4 A;  2F86 B;  1RRL A;  1ZX2 A;  1C7H A;  2HML B;  1OPY A;  1VQK 3;  4L7K A;  3K5T A;  3FH1 A;  1S5A A;  3KSP A;  3X40 A;  1O7P B;  1OGZ A;  5IEN A;  3IPT A;  1YHQ 3;  4WYK B;  1MNL A;  3KN4 A;  3T0U A;  1LVN A;  3LZA A;  5AIF A;  2R4I A;  5EVH A;  2KCD A;  3OXA A;  4K1U A;  2FXT A;  3X41 A;  4MMX B;  1BUQ A;  2HMO B;  2CKF B;  2RFR A;  3FCS B;  4XBX A;  3LTA A;  4J9A A;  1STF I;  3IMA B;  4XDV A;  1OHP A;  2OOV A;  1VQ6 3;  3NX0 A;  2HMM B;  5IW9 A;  3NUV A;  4GB5 A;  4HM8 B;  3EX9 A;  3G6E 3;  1N5H A;  3H3H A;  1SII A;  3FGY A;  2FGT A;  2CW9 A;  2Z7A A;  3K7C A;  3CME 3;  1N8R 4;  4ZM8 A;  3KFQ C;  4CCV A;  1JB4 A;  3WOF B;  4STD A;  1E3V A;  4K1V A;  1UUW B;  3DUK A;  4OVM A;  2CFL A;  4FCZ A;  2KXG A;  3DGO A;  4WP5 A;  2W0Q A;  2LYX A;  3NV0 A;  4GL6 A;  1OGX A;  1TFK A;  3DY5 A;  1K73 4;  3MG2 A;  5AEW B;  3EE1 A;  4XM4 A;  2RSX A;  1W4N A;  2O3O A;  3B4P A;  1OF5 A;  3V92 A;  1JNQ A;  2BMR B;  4KFF A;  1W2B 2;  3N8B A;  3BNB A;  3DZL A;  5JBS A;  3VF1 A;  3MPH A;  4HM5 B;  3OWU A;  3Q90 A;  5A0O B;  1OAC A;  4N3V A;  5EQL A;  3PS8 A;  4TX4 A;  4N6V 0;  2WGO A;  1WMP A;  2GU3 A;  2IUJ A;  1W6Y A;  2Z76 A;  2IUK A;  3JUQ A;  2BMQ B;  2MF7 A;  4NRE A;  3X3X A;  1NWW A;  5AYR B;  3UL6 A;  4WFO A;  4EC6 A;  3MYT A;  1KC8 4;  2QGU A;  1N5P A;  3SVA A;  1SQW A;  1VQO 3;  2GU1 A;  2D42 A;  5IER A;  3GZR A;  1IVU A;  2GBW B;  1OH0 A;  1JRQ A;  3GAX A;  1OCV A;  3CC2 3;  4R9K A;  2F98 A;  2L4V A;  1EG9 B;  1FGO A;  3F8H A;  3FF2 A;  3WDG B;  4HJL B;  1ROA A;  3MG1 A;  4QWT A;  3WOE B;  2PZV A;  1NB5 I;  4N6M A;  4RNZ A;  4HM6 B;  3JUN A;  1ZO2 A;  4HM2 B;  1K9M 4;  1UUV B;  2CH9 A;  3BNC A;  3IJE B;  2Z6B A;  3KII A;  2XFS A;  2ZDJ A;  3KZT A;  3MSO A;  3UNL A;  2V1L A;  1A2K A;  1YJN 3;  3OWY A;  2STD A;  2OTJ 3;  3CC4 3;  4FR9 A;  3CCJ 3;  1IV7 A;  1IVX A;  1CYV A;  1ULJ B;  2HMK B;  3F14 A;  1DYU A;  4HM7 B;  3JUO A;  4H61 A;  3LT9 A;  3PXM A;  3BLZ A;  1GY7 A;  1VQ7 3;  1T5Y A;  4OUQ A;  2YFJ B;  3U97 A;  3F8X A;  4PEJ A;  4EV5 A;  3J7Y d;  1IVW A;  1L5G B;  1Y4K A;  3NBB A;  1IQX A;  4XBT A;  3O8Y A;  3PZW A;  3DGL A;  3NM7 A;  1FGM A;  3S67 A;  1Q42 A;  1YIT 3;  1WMN A;  5HGR A;  2C10 A;  3F9S A;  4JRF A;  3OWS A;  4N6T A;  3LH4 A;  4O02 B;  5BVB A;  3S29 A;  3CC7 3;  3PCS A;  5LC6 A;  3FG1 A;  1QJG A;  1JB2 A;  2W04 A;  1OUN A;  3ER7 A;  3GZX B;  5STD A;  3JVC A;  4AEQ A;  3EC9 A;  1K8A 4;  3K9M C;  1LOX A;  5IG0 A;  1DMQ A;  3EHC A;  3B8L A;  3BB9 A;  4H3U A;  3OV4 A;  1G96 A;  1Z1S A;  1AV4 A;  4KVH A;  1W5Z A;  3EJV A;  1GY5 A;  4LSO A;  3WMD A;  2UX0 A;  4X2H A;  3AMO A;  1M1K 4;  1JJ2 2;  4RZM A;  1CQS A;  3EBT A;  4N6L A;  4AKZ A;  5ELU A;  1FGT A;  3N9H A;  1HU9 A;  1PFP A;  1K28 A;  3T8U A;  2P09 A;  1WMO A;  1IT7 A;  3HII A;  3MG3 A;  1ISK A;  1Q40 B;  3KE7 A;  4N6N B;  1KQS 2;  1MOL A;  2JDI H;  3TDG A;  3M8C A;  1J2B A;  3RGR A;  1QAF A;  3G0K A;  1NU3 A;  1TUH A;  4AKY A;  3QK9 A;  4N6O B;  1NJI 4;  2Q07 A;  4ORL A;  3UJM A;  3CU3 A;  4R80 A;  3AMO B;  3EB8 A;  3SOA A;  3EN8 A;  2XGN A;  3LT8 A;  6STD A;  3H51 A;  1N9E A;  1U5O A;  3PGB A;  1IVV A;  2P05 A;  1UW1 A;  4N6U A;  4HKV B;  5AI1 A;  3NQY A;  1N9J A;  1VQM 3;  3FG3 A;  1NB3 I;  1ROV A;  4J8T A;  2IMJ A;  1M90 4;  4IPB A;  4EXR A;  1IDP A;  5FGO A;  2Y73 A;  2XR8 B;  1EA2 A;  5IEO A;  3CCU 3;  1VQN 3;  3OW2 2;  3LTB A;  4WWU C;  5BXQ A;  2IA7 A;  5CK6 A;  2CFW A;  3NBR A;  4R4K A;  1YIJ 3;  3DM8 A;  5D81 A;  1ASK A;  4I4K A;  3G8Z A;  1FGQ A;  3EF8 A;  3LYG A;  2CFK A;  3PYJ A;  4Q53 A;  1GYB A;  1A67 A;  5DRE A;  2XRX B;  3CCQ 3;  3WA2 X;  2ZL8 A;  4R9L A;  2RCD A;  1Q7Y 4;  1Q82 4;  2ML6 A;  1CYU A;  2FNQ A;  5AIH A;  3S28 A;  4K90 B;  4LEH A;  1KSI A;  2W56 A;  3GZY B;  3GZB A;  3SX1 A;  5ELJ A;  3DMC A;  4KFE A;  4BTX A;  1GD4 A;  3NHX A;  3CCS 3;  4EBG A;  3E99 A;  4MMY B;  1QVF 2;  3MHE A;  2QA4 3;  3QRD A;  1W01 A;  2D1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...