4Q53A

Crystal structure of a duf4783 family protein (bacuni_04292) from bacteroides uniformis atcc 8492 at 1.27 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
107
Chain Sequence
b'NVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNFFRKVQNKYVIHQIRIDKTDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACUNI_04292) from Bacteroides uniformis ATCC 8492 at 1.27 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
total genus 28
structure length 107
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4q53A00
3FGYA 4LGQA 5CK6A 3NBRA 1STDA 3FZWA 4J9AA 4XBYA 1DMMA 3H3HA 1GYBA 1TUHA 3EF8A 5CF2A 3FSDA 4HM4B 1ZO2A 2GXFA 1O7MB 3KKGA 1ASKA 2Z76A 2OWPA 3MSOA 1CQSA 1JKGA 3GZYB 3H51A 2BMOB 1JB4A 4HM2B 1OHPA 1HKXA 3GZXB 2RFRA 2K54A 3MG3A 4HM8B 3DZLA 5G2GA 3B7CA 1OPYA 1O7HB 3OV4A 1JKGB 1Z1SA 3B4OA 2YFLB 4HJLB 2CHCA 3SEDA 4HKVB 1DMNA 1JB5A 1GY5A 3OWSA 3CPOA 1E3RA 3JUPA 3SOYA 3EJVA 5IENA 3HZPA 5AEUB 1OH0A 3DUKA 2Z77A 6STDA 1OF5A 3FF2A 4H3UA 1S5AA 2XSOB 4R1KA 3EN1B 2UX0A 4ORLA 1W00A 3F7XA 4HM3B 4GB5A 1EA2A 1W02A 3DMCA 4LEHA 2GEXA 1ISKA 4CDLA 2F98A 1OF5B 3F8HA 5JPPA 2B24B 4PEJA 3NXJA 3F8XA 5IG4A 4R9KA 2F99A 2W2CA 3CNMA 5IG0A 2HMOB 5AEWB 1E97A 3KE7A 5FW5A 1O7GB 3EHCA 1BUQA 2F86B 3UNLA 3MYTA 5AIGA 2GBWB 2BMRB 1OGZA 3ROBA 1U5OA 1JB2A 4XBTA 2A15A 1QJGA 3G16A 1OUNA 4HM7B 3OXAA 2BMQB 3MHEA 4XDVA 4OUQA 1W01A 3VSYA 4J8TA 3T8NA 3JUMA 2QIYA 1Q42A 2XSHB 2JQ5A 4K1UA 1ZX2A 3F9SA 3S5CA 5EVHA 1GS3A 1UUVB 1UUWB 1OCVA 4HM1B 2HMNB 1JN5A 3F14A 3GZBA 4L8PA 3OWYA 4MJDA 4FCMA 4HM6B 3HK4A 2IMJA 5D82A 3JUQA 4XM4A 1IDPA 3STDA 4WYKA 4R9LA 4XDWA 5D83A 1K41A 1GY6A 3DXOA 3WMDA 3UJMA 1JN5B 2Z7AA 1OHSA 3DM8A 5DREA 3CU3A 3EQQB 1SJWA 1GY7A 1W6YA 3CNXA 4KVHA 4WYKB 2CKFB 1WQLB 5KP1A 4OVMA 5AIFA 2GBXB 3E99A 5IG3A 3VGNA 3K0ZA 3EC9A 3GWRA 3RGAA 2QGUA 2STDA 2HMKB 3A76A 4RZMA 4STDA 1OGXA 3OX9A 2HMJB 2XRXB 5CXOA 2YFIB 1VZZA 1O7WB 3GZRA 5CF1A 1QMAA 3HX8A 1NWWA 4Q53A 4HZBB 2HMMB 3B4PA 3LZAA 3EX9A 2GEYA 5IEPA 3LYGA 4L8OA 1ULJB 3FF0A 2BNGA 5D81A 8CHOA 3GRDA 5TGNA 2RGQA 4X2OA 3BB9A 5STDA 3OWUA 5BVBA 4XB5A 3G0KA 5DRVA 4X2HA 3SOAA 3K7CA 1EG9B 2PZVA 4LMIA 5BXQA 2XR8B 5HGRA 2B1XB 5KP3A 4XBXA 3KSPA 3I0YA 4WWUC 4HVNA 3BLZA 4U13A 1E3VA 1O7NB 3M8CA 3EBYA 3FKAA 1O7PB 1Q40A 1ULIB 4HM0B 1TP6A 3NV0A 1DMQA 2R4IA 3ECFA 5AIIA 3ER7A 3MG2A 3D9RA 3F7SA 5AIHA 5CLKA 4HZ9B 1NDOB 5AI1A 2YFJB 1Q40B 3MKIA 4K1VA 3JUNA 3JUOA 1OHOA 3NM2A 3NV0B 3G8ZA 1C7HA 4L7KA 2INXA 4WP5A 3FLJA 4FCJA 3EBTA 1NU3A 3MG1A 2RCDA 3EN8A 3KZTA 3NHXA 4IIAA 5IG5A 1A2KA 7STDA 5IERA 3T8UA 3NUVA 5IF6A 3IPTA 3B8LA 3Q90A 1AR0A 3FH1A 3F40A 2I9WA 5IEOA 3RGRA 5KP4A 4I4KA 4N3VA 4HM5B 2HMLB 5JPUA
chains in the Genus database with same CATH superfamily
2GU1A 3G6E3 2IUKA 3FGYA 2UGIA 1YIJ3 1YHQ3 1GD4A 4LGQA 1BNSA 2W9PA 1DVCA 5CK6A 1KC84 3NBRA 1STDA 3FZWA 2XEPA 2WOFA 1SPUA 4J9AA 3WOFB 4XBYA 1VQL3 1DMMA 1Q9EA 3H3HA 3KSED 1W2B2 1GYBA 1TUHA 3JVCA 1IVWA 1VQO3 3AMOA 3EF8A 2FGTA 5CF2A 3FSDA 4HM4B 1IT7A 1ZO2A 2GXFA 2XF3A 1O7MB 1D6ZA 1ROVA 2XH9A 2W04A 2ZDJA 1PY3A 1BVIA 3KKGA 1KQS2 1ASKA 1RCKA 4KFEA 2CFWA 5M19A 1B2XA 4RNZA 3MWZA 2Z76A 1KSIA 1TRQA 4EXRA 1NB3I 1RGFA 2OWPA 3MSOA 1WMNA 1CQSA 1IQXA 1DE3A 1JKGA 1LNHA 3AHWA 2BMOB 2KXGA 3GZYB 1AY7A 3H51A 3K5TA 4MMXB 1RSNA 3BNCA 1VQ63 1JB4A 1W4NA 1B2ZA 1LOWA 1BNIA 4FMCA 4HM2B 2CG1A 1X1YA 3KIIA 1I2GA 1UGHI 1BAOA 4O8SA 1OHPA 1HKXA 3GZXB 1AVLA 2BU4A 3KFQC 2RFRA 2BT3A 1BGSA 2K54A 3MG3A 2J8XB 4HM8B 3RDEA 1FW7A 1YJ93 3DZLA 5G2GA 1K9M4 3B7CA 5ELJA 3DH2A 1OPYA 1O7HB 3OV4A 2OOVC 3WR2A 1JKGB 1UI8A 1Z1SA 3B4OA 2YFLB 1JRQA 4HJLB 3PXMA 1I0XA 5EQLA 1VQ83 1QAKA 4ZM8A 2XGLA 2W03A 2CHCA 3SEDA 1I3IA 1R4YA 1DVDA 4HKVB 1LQGC 1DMNA 3AHSA 4KFFA 5EEOA 2QEX3 1JB5A 1T3BA 2XFSA 3SLUA 1FGQA 1M9GA 1JJ22 3LMLA 3X3YA 1Y4KA 1GY5A 3CPOA 1AVKA 3OWSA 1FUSA 1E3RA 1LQMB 2KAAA 3JUPA 2OOVA 3WOEB 4AEQA 3SOYA 3EJVA 1RTUA 3QK9A 3S29A 2HOHA 3HZPA 5IENA 3CC43 2SARA 5AEUB 1OH0A 2H0HA 3DUKA 4RBNA 1N8QA 2Z77A 1YIT3 6STDA 2O9UX 1OF5A 3FF2A 3SYUA 4H61A 4H3UA 5IW9A 2E2VA 4MEIA 5JBSA 1RGKA 1S5AA 2E2TA 1OACA 1TRPA 1CEWI 1BRKA 2WGQA 1X1WA 3V99A 1Q7HA 3CCU3 1JBTA 2BIRA 3RNTA 2XSOB 4R1KA 4TX4A 1IU7A 2UX0A 3EN1B 1W00A 4FMBA 2ZL8A 4ORLA 2XGNA 1ZS7A 3GAXA 3S28A 3F7XA 4HM3B 4GB5A 2V1LA 1EA2A 1RGLA 2CIUA 4IPBA 1W02A 3DMCA 4LEHA 2GEXA 1ISKA 3IJEB 4CDLA 2P0XA 2F98A 1OF5B 3F8HA 1L5GB 1CYVA 1BSEA 2KRTA 4IT7A 1LOXA 3FG4A 2YX9A 2GSPA 3D3LA 2F5WA 1IV7A 2LQVA 3D4AA 5JPPA 4J5GA 2IUJA 3LTBA 3CC73 1AV4A 4N6NB 7RNTA 2B24B 1S723 4PEJA 3PCRA 2H0IA 1YJW3 3X42A 2CWVA 3NXJA 3F8XA 3A5EA 5IG4A 1BRJA 4R9KA 3LTDA 2KF6A 2D1WA 1TFOA 1BRNL 4EYCA 1FUWA 2F99A 1QAFA 2W2CA 3CNMA 1IYYA 4O2HA 3EE1A 1CYUA 1LNIA 5IG0A 4RNYA 1FA3A 3AGOA 1PFPA 1HYFA 2HMOB 5AEWB 1UW1A 3PZWA 3LTAA 1VQN3 1E97A 2RNTA 5AYRB 1PU4A 3KE7A 5FW5A 1O7GB 1R4CA 3S67A 3LT9A 2W56A 2P38A 3EHCA 3LXUX 1BUQA 1BRHA 2F86B 2AAEA 3UNLA 3U1WA 2KF4A 3PYJA 3MYTA 5AIGA 1VQQA 3HOHA 4CJNA 6RNTA 1RMSA 4J5KA 1IT8A 2Y74A 5GSPA 2GBWB 1RDSA 1JZDA 2BMRB 2P0MA 1OGZA 4N6UA 1KD14 1IK3A 2CFKA 3ROBA 1LRAA 1MGRA 3V92A 1I0VA 1RGGA 1D6YA 1LOYA 2W56B 3HI7A 1VQP3 1U5OA 3Q2PA 5M18A 1JB2A 3U97A 4XBTA 1HZ1A 4K61A 2A15A 1QJGA 4N6OB 3I563 3G16A 1OUNA 4HM7B 1VQK3 2Q07A 1IVVA 3PGBA 3OXAA 4JF8A 1STFI 2BMQB 3MHEA 3AMOB 4XDVA 2P05A 2M7OA 4OUQA 1W01A 4MMZB 3DY5A 3KN4A 2OCTA 3VSYA 1BNJA 4J8TA 3JUMA 3T8NA 2QIYA 1I70A 2CX0A 3WA2X 2CWTA 1YJN3 2IY2A 1Q42A 1JNQA 3N8BA 1DYUA 1PYLA 2CH9A 1UUGB 2XSHB 3NQYA 3G4S3 2IA7A 2JQ5A 1SIHA 4K1UA 3CCM3 4KZ1A 1RHLA 1W5ZA 1QVF2 1G02A 4HBRA 1ZX2A 3K9MC 3F9SA 5FGOA 3S5CA 3GSPA 4JRFA 2K3DA 5EVHA 1RN7A 2FXTA 1LXEA 2H0GA 1GOUA 1FGTA 5I97A 1GS3A 4R4KA 1UUVB 1FGOA 1UUWB 1OCVA 3DGNA 2OTL3 3WHOA 4HM1B 1LVNA 7GSPA 1KWIA 1VQ53 1BRIA 4GHOA 1YVSA 1QALA 1M1XB 1US1A 1IVXA 1MWUA 2HMNB 4BTWA 1JN5A 3WDGB 1W6CA 3F14A 1EQKA 4KFDA 2OTJ3 3GZBA 1K734 1N8R4 1MWTA 2GU3A 3OWYA 4L8PA 1IQ8A 2ML6A 1RLSA 3L0RA 1G0TA 4FCMA 4HM6B 4MJDA 3HK4A 3X40A 1RGAA 1WMOA 2IMJA 4FR9A 5D82A 1BNRA 1NJI4 3JUQA 1BOXA 4N6V0 4XM4A 5G1LA 1DETA 1IDPA 1ROAA 3STDA 1RKYA 4WYKA 4R9LA 1SQWA 1I8VA 1ZGXA 1K41A 3EB8A 1GY6A 4XDWA 5D83A 4EW5A 3DXOA 3CD63 2MC8A 4BU4A 2CX1A 1JV2B 3WMDA 3UJMA 5BIRA 1JN5B 1IQYA 1RJOA 2Z7AA 1V57A 1Q864 1OHSA 1BNEA 1EEJA 3DM8A 2C4BA 3HIGA 4FMDA 1MGWA 5DREA 3CU3A 2CFLA 3EQQB 3LH4A 4AKYA 3HIIA 1SJWA 2AADA 1GY7A 1W6YA 4LSOA 2WGOA 3CCE3 2CG0A 1GSPA 3AGNA 3PS8A 2C11A 3CNXA 1BSDA 4N6MA 3CCV3 1QVG2 4BL3A 4KVHA 3K63A 4WYKB 5AYSC 3SXXA 3CCJ3 2CKFB 1GMRA 4NREA 3ZG5A 1WQLB 5KP1A 4OVMA 1M904 5AIFA 2GBXB 1V74A 2W6JH 1F8NA 3E99A 3LTCA 3G713 1A67A 2OQEA 5IG3A 1B20A 1YGWA 1N5HA 3VGNA 1VQ43 4MMYB 5G1KA 3K0ZA 1I2FA 3EC9A 3GWRA 3RGAA 1GOYA 1T2HA 2QGUA 2STDA 1HU9A 1JZOA 2HMKB 1C54A 3A76A 3X3XA 1CH0A 1T5YA 4RZMA 4STDA 1UCLA 3BIRA 3CCQ3 1OGXA 4HOHA 1RCLA 3OX9A 4WFOA 2HMJB 1Q824 1RGEA 2RBIA 1TIJA 2XRXB 2PNCA 3N9HA 3WODG 5CXOA 3BNEA 1B2MA 1BSAA 4BL2A 4R80A 3X41A 1FGRA 1VZZA 1O7WB 1T2IA 2YFIB 1BSBA 2Z6BA 4BIRA 1GOVA 3GZRA 1QMAA 5CF1A 2K0MA 1D6UA 1B2UA 3HX8A 3IMAB 3QRDA 1NWWA 4EV5A 1EUIC 4LYLB 4OK0A 3S27A 1JBSA 1BNFA 2UUGC 2KF3A 4BTXA 1BUJA 1RGHA 3X3ZA 4Q53A 6GSPA 3CXC2 4DKIA 3UL6A 4CPKA 4HZBB 2HMMB 3B4PA 3NM7A 4FMAA 3FCSB 3TDGA 4O3VA 3LZAA 3EX9A 2GEYA 5IEPA 3FG3A 3LYGA 4L8OA 3N54B 1RN4A 1UGIA 1ULJB 2W9QA 2BO9B 4FCZA 4NHFA 1K8A4 3FF0A 1GMQA 3CME3 3T0UA 3DGLA 1YI23 2BNGA 1MWRA 8RNTA 2MF7A 4I5QA 1RNTA 1W7CA 5D81A 3DGOA 8CHOA 3DGMA 1AQZA 3GRDA 5A0OB 2L1SA 2SBLA 5TGNA 2W0QA 1GD3A 1UCKA 2FNQA 4K90B 1RRHA 1N5PA 4NPBA 5RNTA 3D79A 2RGQA 1I2EA 2XFTA 1UI7A 2QA43 4X2OA 4GL6A 2F4YA 1FYSA 1Q7Y4 1B21A 2LYXA 4EBGA 1B27A 3BB9A 1UDII 5STDA 1SIIA 1B2SA 3OWUA 5BVBA 1FUTA 2WOHA 3G0KA 1V58A 3NQZA 4XB5A 5ELUA 5DRVA 4X2HA 3SOAA 2Y73A 3K7CA 3CPW2 1W6GA 2CC3A 2F5MA 4KT3B 1EG9B 2PZVA 4LMIA 5BXQA 3PCSA 2XR8B 5HGRA 2B1XB 2WO0A 3DGYA 2BHMA 5KP3A 3OW22 4XBXA 3KSPA 3J7Yd 3I0YA 3CCL3 1VQM3 1MOLA 4HVNA 4WWUC 1VQ93 4EV2A 1SARA 2CWUA 2ZHXB 3SX1A 3URPA 5HOHA 1X1UA 1K28A 2JDIH 3BNBA 3NX0A 5LC7A 1A90A 1A2VA 1BIRA 3BLZA 3O8YA 4U13A 2L4VA 4G1MB 2R41A 3Q1CA 2P09A 1E3VA 1N9EA 1TTOA 1O7NB 1I3FA 3M8CA 3WA3A 3EBYA 3UL5A 3Q3FA 5LC6A 3FKAA 1O7PB 1Q40A 1TU5A 1ULIB 4HM0B 1YGEA 1TP6A 5M1AA 3BU4A 3NV0A 3FG1A 1RRLA 1U8CB 2KCDA 1JBRA 1DMQA 2R4IA 3ECFA 5AIIA 3ALAA 3ER7A 3LOYA 4AKZA 4EC6A 1YNVX 3MG2A 1VQ73 1M1K4 3D9RA 4WHAA 1Q814 3D5GA 3F7SA 5AIHA 3ZG0A 5CLKA 4HZ9B 1NDOB 5AI1A 1BSCA 9RNTA 4RNTA 2C10A 2YFJB 3CC23 1N9JA 1Q40B 3MKIA 3V98A 2ZA4A 4K1VA 4N6TA 4N6LA 1X1XA 2OQEC 3NBJA 1WNHA 3JUNA 3JUOA 1OHOA 3NM2A 3NV0B 1BRGA 3G8ZA 1C7HA 4L7KA 1IV9A 1A2PA 3SVAA 4QWTA 1RN1A 3CMA3 1BU4A 1RGCA 2INXA 4WP5A 1YVBI 3FLJA 4FCJA 3EBTA 2RSXA 3ZFZA 1W2ZA 1NU3A 3MG1A 4HYZA 1IVUA 2CFGA 3CCR3 2RCDA 3BNDA 2CK3H 2CW9A 3NBBA 1FGMA 2IYJA 1WMPA 3EN8A 1TFKA 1BNGA 3MPHA 3KZTA 3VF1A 1J2BA 3NHXA 4IIAA 2CFDA 2F56A 2D42A 4BTYA 5IG5A 1A2KA 4HAAA 3UB1A 1TJDA 1FZUA 1UCIA 7STDA 5IERA 1EKMA 4LZIA 3T8UA 3NUVA 5IF6A 1RNBA 3D5IA 3CCS3 2O3OA 1NO3A 3IPTA 3B8LA 3I553 4O02B 2ML5A 3Q90A 1AR0A 1MNLA 1LOVA 4CCVA 4GSPA 2KF5A 3KCHA 3LT8A 1NNVA 3FH1A 1BRSA 3F40A 2I9WA 5BU4A 1GMPA 5IEOA 1NB5I 3RGRA 1BANA 1WTHA 4ILFA 1G96A 4I4KA 4N3VA 5KP4A 4HM5B 1MWSA 2HMLB 2E2UA 5JPUA 1UCJA 1B3SA
chains in the Genus database with same CATH topology
2GU1A 3G6E3 2IUKA 3FGYA 1YIJ3 1YHQ3 1GD4A 4LGQA 2W9PA 1DVCA 5CK6A 1KC84 3NBRA 1STDA 3FZWA 2XEPA 2WOFA 1SPUA 4J9AA 3WOFB 4XBYA 1VQL3 1DMMA 3H3HA 3KSED 1W2B2 1GYBA 1TUHA 3JVCA 1IVWA 1VQO3 3AMOA 3EF8A 2FGTA 5CF2A 3FSDA 4HM4B 1IT7A 1ZO2A 2GXFA 2XF3A 1O7MB 1D6ZA 1ROVA 2XH9A 2W04A 2ZDJA 1KQS2 3KKGA 1ASKA 4KFEA 2CFWA 4RNZA 3MWZA 2Z76A 1KSIA 4EXRA 1NB3I 2OWPA 3MSOA 1WMNA 1CQSA 1IQXA 1JKGA 1LNHA 3GZYB 2BMOB 2KXGA 3H51A 3K5TA 4MMXB 3BNCA 1VQ63 1JB4A 1W4NA 4FMCA 4HM2B 2CG1A 3KIIA 4O8SA 1OHPA 1HKXA 3GZXB 1AVLA 3KFQC 2RFRA 2BT3A 2K54A 3MG3A 3RDEA 4HM8B 1YJ93 3DZLA 5G2GA 1K9M4 3B7CA 5ELJA 1OPYA 1O7HB 3OV4A 2OOVC 1JKGB 1UI8A 1Z1SA 3B4OA 2YFLB 1JRQA 4HJLB 3PXMA 5EQLA 1VQ83 1QAKA 4ZM8A 2XGLA 2W03A 2CHCA 3SEDA 1DVDA 4HKVB 4KFFA 1DMNA 5EEOA 2QEX3 1JB5A 2XFSA 3SLUA 1FGQA 1M9GA 1JJ22 3LMLA 3X3YA 1Y4KA 1GY5A 3CPOA 1AVKA 3OWSA 3WOEB 1E3RA 2OOVA 1QVF2 3JUPA 4AEQA 3SOYA 3EJVA 3S29A 3QK9A 5IENA 3HZPA 3CC43 5AEUB 1OH0A 3DUKA 4RBNA 1N8QA 2Z77A 1YIT3 6STDA 2O9UX 1OF5A 3FF2A 4H61A 4H3UA 5IW9A 2E2VA 4MEIA 5JBSA 1S5AA 2E2TA 1OACA 1CEWI 2WGQA 3V99A 3CCU3 2XSOB 4R1KA 4TX4A 1IU7A 2UX0A 3EN1B 1W00A 4FMBA 2ZL8A 4ORLA 2XGNA 3GAXA 3S28A 3F7XA 4HM3B 4GB5A 2V1LA 1EA2A 4IPBA 2CIUA 1W02A 3DMCA 4LEHA 2GEXA 1ISKA 3IJEB 4CDLA 2P0XA 2F98A 1OF5B 3F8HA 1L5GB 1CYVA 2KRTA 4IT7A 1LOXA 3FG4A 2YX9A 3D3LA 1IV7A 2LQVA 5JPPA 2IUJA 3LTBA 3CC73 1AV4A 4N6NB 1S723 2B24B 4PEJA 3PCRA 1YJW3 3X42A 2CWVA 3NXJA 3F8XA 5IG4A 4R9KA 3LTDA 2D1WA 1TFOA 4EYCA 1FUWA 2F99A 1QAFA 2W2CA 3CNMA 4O2HA 3EE1A 1CYUA 5IG0A 4RNYA 1FA3A 1PFPA 2HMOB 5AEWB 1UW1A 3PZWA 3LTAA 1VQN3 1E97A 5AYRB 1PU4A 3KE7A 5FW5A 1O7GB 1R4CA 3S67A 3LT9A 2W56A 2P38A 3EHCA 3LXUX 1BUQA 2F86B 3UNLA 3U1WA 3PYJA 3MYTA 5AIGA 1IT8A 2Y74A 2GBWB 2BMRB 2P0MA 1OGZA 4N6UA 1KD14 1IK3A 2CFKA 3ROBA 3V92A 2W56B 1D6YA 3HI7A 1VQP3 1U5OA 3Q2PA 1JB2A 3U97A 4XBTA 4K61A 2A15A 1QJGA 4N6OB 3I563 3G16A 1OUNA 4HM7B 1VQK3 2Q07A 1IVVA 3PGBA 3OXAA 4JF8A 1STFI 2BMQB 3MHEA 3AMOB 4XDVA 2P05A 2M7OA 4OUQA 1W01A 4MMZB 3DY5A 3KN4A 2OCTA 3VSYA 4J8TA 3T8NA 3JUMA 2QIYA 3WA2X 2CWTA 1YJN3 1Q42A 1JNQA 3N8BA 1DYUA 2CH9A 2XSHB 3NQYA 3G4S3 2IA7A 2JQ5A 1SIHA 4K1UA 3CCM3 4KZ1A 1W5ZA 4HBRA 1ZX2A 3K9MC 3F9SA 5FGOA 3S5CA 4JRFA 5EVHA 1RN7A 2FXTA 1LXEA 1FGTA 5I97A 1GS3A 4R4KA 1UUVB 1FGOA 1UUWB 1OCVA 3DGNA 2OTL3 4HM1B 1LVNA 1KWIA 1VQ53 1QALA 1M1XB 1US1A 1IVXA 2HMNB 4BTWA 1JN5A 3WDGB 1W6CA 3F14A 1EQKA 4KFDA 2OTJ3 3GZBA 1K734 1N8R4 2GU3A 3OWYA 4L8PA 1IQ8A 2ML6A 3L0RA 4FCMA 4HM6B 4MJDA 3HK4A 3X40A 4FR9A 1WMOA 2IMJA 5D82A 1NJI4 3JUQA 4N6V0 4XM4A 1IDPA 3STDA 1ROAA 1RKYA 4WYKA 4R9LA 1SQWA 3EB8A 4XDWA 1K41A 5D83A 1GY6A 3DXOA 3CD63 2MC8A 1JV2B 3WMDA 3UJMA 1JN5B 1IQYA 1RJOA 2Z7AA 1Q864 1OHSA 3DM8A 3HIGA 4FMDA 5DREA 3CU3A 2CFLA 3EQQB 3LH4A 4AKYA 3HIIA 1SJWA 1GY7A 1W6YA 4LSOA 2WGOA 3CCE3 2CG0A 3PS8A 2C11A 3CNXA 4N6MA 3CCV3 1QVG2 4KVHA 3K63A 4WYKB 5AYSC 3SXXA 3CCJ3 2CKFB 4NREA 1WQLB 5KP1A 4OVMA 1M904 5AIFA 2GBXB 1V74A 2W6JH 1F8NA 3E99A 3LTCA 3G713 1A67A 2OQEA 5IG3A 1N5HA 3VGNA 1VQ43 4MMYB 3K0ZA 3EC9A 3GWRA 3RGAA 2QGUA 2STDA 1HU9A 2HMKB 3A76A 3X3XA 1T5YA 4RZMA 4STDA 3CCQ3 1OGXA 3OX9A 4WFOA 2HMJB 1Q824 1TIJA 2XRXB 2PNCA 3N9HA 3WODG 5CXOA 3BNEA 4R80A 3X41A 1FGRA 2Z6BA 1O7WB 1VZZA 2YFIB 3GZRA 5CF1A 1QMAA 2K0MA 1D6UA 3HX8A 3IMAB 3QRDA 1NWWA 4EV5A 4OK0A 3S27A 4BTXA 3X3ZA 4Q53A 3CXC2 3UL6A 4HZBB 2HMMB 3B4PA 3NM7A 4FMAA 3FCSB 3TDGA 4O3VA 3LZAA 3EX9A 2GEYA 5IEPA 3FG3A 3LYGA 4L8OA 3N54B 1ULJB 2W9QA 2BO9B 4FCZA 4NHFA 1K8A4 3FF0A 3CME3 3T0UA 3DGLA 1YI23 2BNGA 2MF7A 1W7CA 5D81A 8CHOA 3DGOA 3DGMA 3GRDA 5A0OB 2SBLA 5TGNA 2W0QA 1GD3A 2FNQA 4K90B 1RRHA 1N5PA 2RGQA 2XFTA 1UI7A 2QA43 4X2OA 4GL6A 1Q7Y4 2LYXA 4EBGA 3BB9A 5STDA 1SIIA 3OWUA 5BVBA 4XB5A 2WOHA 3G0KA 3NQZA 5ELUA 5DRVA 4X2HA 3SOAA 2Y73A 3K7CA 3CPW2 1W6GA 2CC3A 1EG9B 2PZVA 4LMIA 5BXQA 3PCSA 2XR8B 5HGRA 2B1XB 2WO0A 2BHMA 5KP3A 3OW22 4XBXA 3KSPA 3J7Yd 3I0YA 3CCL3 1VQM3 1MOLA 4HVNA 4WWUC 1VQ93 4EV2A 2CWUA 3SX1A 2JDIH 1K28A 3BNBA 3NX0A 1A90A 5LC7A 1A2VA 3BLZA 3O8YA 4U13A 2L4VA 4G1MB 3Q1CA 2P09A 1E3VA 1N9EA 3WA3A 1O7NB 3M8CA 3EBYA 3UL5A 5LC6A 3FKAA 1O7PB 1Q40A 1TU5A 1ULIB 4HM0B 1YGEA 1TP6A 3NV0A 3FG1A 1RRLA 1U8CB 2KCDA 1DMQA 2R4IA 3ECFA 5AIIA 3ALAA 3ER7A 3LOYA 4AKZA 4EC6A 1M1K4 3MG2A 1VQ73 3D9RA 4WHAA 1Q814 3F7SA 5AIHA 5CLKA 4HZ9B 1NDOB 5AI1A 2C10A 2YFJB 3CC23 1N9JA 1Q40B 3MKIA 3V98A 4K1VA 4N6TA 4N6LA 2OQEC 3NBJA 1WNHA 3JUNA 3JUOA 1OHOA 3NM2A 3NV0B 3G8ZA 1C7HA 4L7KA 1IV9A 3SVAA 4QWTA 3CMA3 2INXA 4WP5A 1YVBI 3FLJA 4FCJA 3EBTA 2RSXA 1W2ZA 1NU3A 3MG1A 4HYZA 1IVUA 2CFGA 3CCR3 2RCDA 3BNDA 2CK3H 2CW9A 3NBBA 1FGMA 3EN8A 1WMPA 1TFKA 3MPHA 3KZTA 3VF1A 1J2BA 3NHXA 4IIAA 2CFDA 4BTYA 2D42A 5IG5A 1A2KA 3UB1A 7STDA 5IERA 1EKMA 4LZIA 3T8UA 3NUVA 5IF6A 3CCS3 2O3OA 1NO3A 3IPTA 3B8LA 3I553 4O02B 2ML5A 3Q90A 1AR0A 1MNLA 4CCVA 3LT8A 3FH1A 3F40A 2I9WA 5IEOA 1NB5I 3RGRA 1WTHA 5KP4A 1G96A 4I4KA 4N3VA 4HM5B 2HMLB 2E2UA 5JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGY A;  4LGQ A;  5CK6 A;  3NBR A;  1STD A;  3FZW A;  4J9A A;  4XBY A;  1DMM A;  3H3H A;  1GYB A;  1TUH A;  3EF8 A;  5CF2 A;  3FSD A;  4HM4 B;  1ZO2 A;  2GXF A;  1O7M B;  3KKG A;  1ASK A;  2Z76 A;  2OWP A;  3MSO A;  1CQS A;  1JKG A;  3GZY B;  3H51 A;  2BMO B;  1JB4 A;  4HM2 B;  1OHP A;  1HKX A;  3GZX B;  2RFR A;  2K54 A;  3MG3 A;  4HM8 B;  3DZL A;  5G2G A;  3B7C A;  1OPY A;  1O7H B;  3OV4 A;  1JKG B;  1Z1S A;  3B4O A;  2YFL B;  4HJL B;  2CHC A;  3SED A;  4HKV B;  1DMN A;  1JB5 A;  1GY5 A;  3OWS A;  3CPO A;  1E3R A;  3JUP A;  3SOY A;  3EJV A;  5IEN A;  3HZP A;  5AEU B;  1OH0 A;  3DUK A;  2Z77 A;  6STD A;  1OF5 A;  3FF2 A;  4H3U A;  1S5A A;  2XSO B;  4R1K A;  3EN1 B;  2UX0 A;  4ORL A;  1W00 A;  3F7X A;  4HM3 B;  4GB5 A;  1EA2 A;  1W02 A;  3DMC A;  4LEH A;  2GEX A;  1ISK A;  4CDL A;  2F98 A;  1OF5 B;  3F8H A;  5JPP A;  2B24 B;  4PEJ A;  3NXJ A;  3F8X A;  5IG4 A;  4R9K A;  2F99 A;  2W2C A;  3CNM A;  5IG0 A;  2HMO B;  5AEW B;  1E97 A;  3KE7 A;  5FW5 A;  1O7G B;  3EHC A;  1BUQ A;  2F86 B;  3UNL A;  3MYT A;  5AIG A;  2GBW B;  2BMR B;  1OGZ A;  3ROB A;  1U5O A;  1JB2 A;  4XBT A;  2A15 A;  1QJG A;  3G16 A;  1OUN A;  4HM7 B;  3OXA A;  2BMQ B;  3MHE A;  4XDV A;  4OUQ A;  1W01 A;  3VSY A;  4J8T A;  3T8N A;  3JUM A;  2QIY A;  1Q42 A;  2XSH B;  2JQ5 A;  4K1U A;  1ZX2 A;  3F9S A;  3S5C A;  5EVH A;  1GS3 A;  1UUV B;  1UUW B;  1OCV A;  4HM1 B;  2HMN B;  1JN5 A;  3F14 A;  3GZB A;  4L8P A;  3OWY A;  4MJD A;  4FCM A;  4HM6 B;  3HK4 A;  2IMJ A;  5D82 A;  3JUQ A;  4XM4 A;  1IDP A;  3STD A;  4WYK A;  4R9L A;  4XDW A;  5D83 A;  1K41 A;  1GY6 A;  3DXO A;  3WMD A;  3UJM A;  1JN5 B;  2Z7A A;  1OHS A;  3DM8 A;  5DRE A;  3CU3 A;  3EQQ B;  1SJW A;  1GY7 A;  1W6Y A;  3CNX A;  4KVH A;  4WYK B;  2CKF B;  1WQL B;  5KP1 A;  4OVM A;  5AIF A;  2GBX B;  3E99 A;  5IG3 A;  3VGN A;  3K0Z A;  3EC9 A;  3GWR A;  3RGA A;  2QGU A;  2STD A;  2HMK B;  3A76 A;  4RZM A;  4STD A;  1OGX A;  3OX9 A;  2HMJ B;  2XRX B;  5CXO A;  2YFI B;  1VZZ A;  1O7W B;  3GZR A;  5CF1 A;  1QMA A;  3HX8 A;  1NWW A;  4Q53 A;  4HZB B;  2HMM B;  3B4P A;  3LZA A;  3EX9 A;  2GEY A;  5IEP A;  3LYG A;  4L8O A;  1ULJ B;  3FF0 A;  2BNG A;  5D81 A;  8CHO A;  3GRD A;  5TGN A;  2RGQ A;  4X2O A;  3BB9 A;  5STD A;  3OWU A;  5BVB A;  4XB5 A;  3G0K A;  5DRV A;  4X2H A;  3SOA A;  3K7C A;  1EG9 B;  2PZV A;  4LMI A;  5BXQ A;  2XR8 B;  5HGR A;  2B1X B;  5KP3 A;  4XBX A;  3KSP A;  3I0Y A;  4WWU C;  4HVN A;  3BLZ A;  4U13 A;  1E3V A;  1O7N B;  3M8C A;  3EBY A;  3FKA A;  1O7P B;  1Q40 A;  1ULI B;  4HM0 B;  1TP6 A;  3NV0 A;  1DMQ A;  2R4I A;  3ECF A;  5AII A;  3ER7 A;  3MG2 A;  3D9R A;  3F7S A;  5AIH A;  5CLK A;  4HZ9 B;  1NDO B;  5AI1 A;  2YFJ B;  1Q40 B;  3MKI A;  4K1V A;  3JUN A;  3JUO A;  1OHO A;  3NM2 A;  3NV0 B;  3G8Z A;  1C7H A;  4L7K A;  2INX A;  4WP5 A;  3FLJ A;  4FCJ A;  3EBT A;  1NU3 A;  3MG1 A;  2RCD A;  3EN8 A;  3KZT A;  3NHX A;  4IIA A;  5IG5 A;  1A2K A;  7STD A;  5IER A;  3T8U A;  3NUV A;  5IF6 A;  3IPT A;  3B8L A;  3Q90 A;  1AR0 A;  3FH1 A;  3F40 A;  2I9W A;  5IEO A;  3RGR A;  5KP4 A;  4I4K A;  4N3V A;  4HM5 B;  2HML B;  5JPU A; 
#chains in the Genus database with same CATH topology
 2GU1 A;  3G6E 3;  2IUK A;  3FGY A;  2UGI A;  1YIJ 3;  1YHQ 3;  1GD4 A;  4LGQ A;  1BNS A;  2W9P A;  1DVC A;  5CK6 A;  1KC8 4;  3NBR A;  1STD A;  3FZW A;  2XEP A;  2WOF A;  1SPU A;  4J9A A;  3WOF B;  4XBY A;  1VQL 3;  1DMM A;  1Q9E A;  3H3H A;  3KSE D;  1W2B 2;  1GYB A;  1TUH A;  3JVC A;  1IVW A;  1VQO 3;  3AMO A;  3EF8 A;  2FGT A;  5CF2 A;  3FSD A;  4HM4 B;  1IT7 A;  1ZO2 A;  2GXF A;  2XF3 A;  1O7M B;  1D6Z A;  1ROV A;  2XH9 A;  2W04 A;  2ZDJ A;  1PY3 A;  1BVI A;  3KKG A;  1KQS 2;  1ASK A;  1RCK A;  4KFE A;  2CFW A;  5M19 A;  1B2X A;  4RNZ A;  3MWZ A;  2Z76 A;  1KSI A;  1TRQ A;  4EXR A;  1NB3 I;  1RGF A;  2OWP A;  3MSO A;  1WMN A;  1CQS A;  1IQX A;  1DE3 A;  1JKG A;  1LNH A;  3AHW A;  2BMO B;  2KXG A;  3GZY B;  1AY7 A;  3H51 A;  3K5T A;  4MMX B;  1RSN A;  3BNC A;  1VQ6 3;  1JB4 A;  1W4N A;  1B2Z A;  1LOW A;  1BNI A;  4FMC A;  4HM2 B;  2CG1 A;  1X1Y A;  3KII A;  1I2G A;  1UGH I;  1BAO A;  4O8S A;  1OHP A;  1HKX A;  3GZX B;  1AVL A;  2BU4 A;  3KFQ C;  2RFR A;  2BT3 A;  1BGS A;  2K54 A;  3MG3 A;  2J8X B;  4HM8 B;  3RDE A;  1FW7 A;  1YJ9 3;  3DZL A;  5G2G A;  1K9M 4;  3B7C A;  5ELJ A;  3DH2 A;  1OPY A;  1O7H B;  3OV4 A;  2OOV C;  3WR2 A;  1JKG B;  1UI8 A;  1Z1S A;  3B4O A;  2YFL B;  1JRQ A;  4HJL B;  3PXM A;  1I0X A;  5EQL A;  1VQ8 3;  1QAK A;  4ZM8 A;  2XGL A;  2W03 A;  2CHC A;  3SED A;  1I3I A;  1R4Y A;  1DVD A;  4HKV B;  1LQG C;  1DMN A;  3AHS A;  4KFF A;  5EEO A;  2QEX 3;  1JB5 A;  1T3B A;  2XFS A;  3SLU A;  1FGQ A;  1M9G A;  1JJ2 2;  3LML A;  3X3Y A;  1Y4K A;  1GY5 A;  3CPO A;  1AVK A;  3OWS A;  1FUS A;  1E3R A;  1LQM B;  2KAA A;  3JUP A;  2OOV A;  3WOE B;  4AEQ A;  3SOY A;  3EJV A;  1RTU A;  3QK9 A;  3S29 A;  2HOH A;  3HZP A;  5IEN A;  3CC4 3;  2SAR A;  5AEU B;  1OH0 A;  2H0H A;  3DUK A;  4RBN A;  1N8Q A;  2Z77 A;  1YIT 3;  6STD A;  2O9U X;  1OF5 A;  3FF2 A;  3SYU A;  4H61 A;  4H3U A;  5IW9 A;  2E2V A;  4MEI A;  5JBS A;  1RGK A;  1S5A A;  2E2T A;  1OAC A;  1TRP A;  1CEW I;  1BRK A;  2WGQ A;  1X1W A;  3V99 A;  1Q7H A;  3CCU 3;  1JBT A;  2BIR A;  3RNT A;  2XSO B;  4R1K A;  4TX4 A;  1IU7 A;  2UX0 A;  3EN1 B;  1W00 A;  4FMB A;  2ZL8 A;  4ORL A;  2XGN A;  1ZS7 A;  3GAX A;  3S28 A;  3F7X A;  4HM3 B;  4GB5 A;  2V1L A;  1EA2 A;  1RGL A;  2CIU A;  4IPB A;  1W02 A;  3DMC A;  4LEH A;  2GEX A;  1ISK A;  3IJE B;  4CDL A;  2P0X A;  2F98 A;  1OF5 B;  3F8H A;  1L5G B;  1CYV A;  1BSE A;  2KRT A;  4IT7 A;  1LOX A;  3FG4 A;  2YX9 A;  2GSP A;  3D3L A;  2F5W A;  1IV7 A;  2LQV A;  3D4A A;  5JPP A;  4J5G A;  2IUJ A;  3LTB A;  3CC7 3;  1AV4 A;  4N6N B;  7RNT A;  2B24 B;  1S72 3;  4PEJ A;  3PCR A;  2H0I A;  1YJW 3;  3X42 A;  2CWV A;  3NXJ A;  3F8X A;  3A5E A;  5IG4 A;  1BRJ A;  4R9K A;  3LTD A;  2KF6 A;  2D1W A;  1TFO A;  1BRN L;  4EYC A;  1FUW A;  2F99 A;  1QAF A;  2W2C A;  3CNM A;  1IYY A;  4O2H A;  3EE1 A;  1CYU A;  1LNI A;  5IG0 A;  4RNY A;  1FA3 A;  3AGO A;  1PFP A;  1HYF A;  2HMO B;  5AEW B;  1UW1 A;  3PZW A;  3LTA A;  1VQN 3;  1E97 A;  2RNT A;  5AYR B;  1PU4 A;  3KE7 A;  5FW5 A;  1O7G B;  1R4C A;  3S67 A;  3LT9 A;  2W56 A;  2P38 A;  3EHC A;  3LXU X;  1BUQ A;  1BRH A;  2F86 B;  2AAE A;  3UNL A;  3U1W A;  2KF4 A;  3PYJ A;  3MYT A;  5AIG A;  1VQQ A;  3HOH A;  4CJN A;  6RNT A;  1RMS A;  4J5K A;  1IT8 A;  2Y74 A;  5GSP A;  2GBW B;  1RDS A;  1JZD A;  2BMR B;  2P0M A;  1OGZ A;  4N6U A;  1KD1 4;  1IK3 A;  2CFK A;  3ROB A;  1LRA A;  1MGR A;  3V92 A;  1I0V A;  1RGG A;  1D6Y A;  1LOY A;  2W56 B;  3HI7 A;  1VQP 3;  1U5O A;  3Q2P A;  5M18 A;  1JB2 A;  3U97 A;  4XBT A;  1HZ1 A;  4K61 A;  2A15 A;  1QJG A;  4N6O B;  3I56 3;  3G16 A;  1OUN A;  4HM7 B;  1VQK 3;  2Q07 A;  1IVV A;  3PGB A;  3OXA A;  4JF8 A;  1STF I;  2BMQ B;  3MHE A;  3AMO B;  4XDV A;  2P05 A;  2M7O A;  4OUQ A;  1W01 A;  4MMZ B;  3DY5 A;  3KN4 A;  2OCT A;  3VSY A;  1BNJ A;  4J8T A;  3JUM A;  3T8N A;  2QIY A;  1I70 A;  2CX0 A;  3WA2 X;  2CWT A;  1YJN 3;  2IY2 A;  1Q42 A;  1JNQ A;  3N8B A;  1DYU A;  1PYL A;  2CH9 A;  1UUG B;  2XSH B;  3NQY A;  3G4S 3;  2IA7 A;  2JQ5 A;  1SIH A;  4K1U A;  3CCM 3;  4KZ1 A;  1RHL A;  1W5Z A;  1QVF 2;  1G02 A;  4HBR A;  1ZX2 A;  3K9M C;  3F9S A;  5FGO A;  3S5C A;  3GSP A;  4JRF A;  2K3D A;  5EVH A;  1RN7 A;  2FXT A;  1LXE A;  2H0G A;  1GOU A;  1FGT A;  5I97 A;  1GS3 A;  4R4K A;  1UUV B;  1FGO A;  1UUW B;  1OCV A;  3DGN A;  2OTL 3;  3WHO A;  4HM1 B;  1LVN A;  7GSP A;  1KWI A;  1VQ5 3;  1BRI A;  4GHO A;  1YVS A;  1QAL A;  1M1X B;  1US1 A;  1IVX A;  1MWU A;  2HMN B;  4BTW A;  1JN5 A;  3WDG B;  1W6C A;  3F14 A;  1EQK A;  4KFD A;  2OTJ 3;  3GZB A;  1K73 4;  1N8R 4;  1MWT A;  2GU3 A;  3OWY A;  4L8P A;  1IQ8 A;  2ML6 A;  1RLS A;  3L0R A;  1G0T A;  4FCM A;  4HM6 B;  4MJD A;  3HK4 A;  3X40 A;  1RGA A;  1WMO A;  2IMJ A;  4FR9 A;  5D82 A;  1BNR A;  1NJI 4;  3JUQ A;  1BOX A;  4N6V 0;  4XM4 A;  5G1L A;  1DET A;  1IDP A;  1ROA A;  3STD A;  1RKY A;  4WYK A;  4R9L A;  1SQW A;  1I8V A;  1ZGX A;  1K41 A;  3EB8 A;  1GY6 A;  4XDW A;  5D83 A;  4EW5 A;  3DXO A;  3CD6 3;  2MC8 A;  4BU4 A;  2CX1 A;  1JV2 B;  3WMD A;  3UJM A;  5BIR A;  1JN5 B;  1IQY A;  1RJO A;  2Z7A A;  1V57 A;  1Q86 4;  1OHS A;  1BNE A;  1EEJ A;  3DM8 A;  2C4B A;  3HIG A;  4FMD A;  1MGW A;  5DRE A;  3CU3 A;  2CFL A;  3EQQ B;  3LH4 A;  4AKY A;  3HII A;  1SJW A;  2AAD A;  1GY7 A;  1W6Y A;  4LSO A;  2WGO A;  3CCE 3;  2CG0 A;  1GSP A;  3AGN A;  3PS8 A;  2C11 A;  3CNX A;  1BSD A;  4N6M A;  3CCV 3;  1QVG 2;  4BL3 A;  4KVH A;  3K63 A;  4WYK B;  5AYS C;  3SXX A;  3CCJ 3;  2CKF B;  1GMR A;  4NRE A;  3ZG5 A;  1WQL B;  5KP1 A;  4OVM A;  1M90 4;  5AIF A;  2GBX B;  1V74 A;  2W6J H;  1F8N A;  3E99 A;  3LTC A;  3G71 3;  1A67 A;  2OQE A;  5IG3 A;  1B20 A;  1YGW A;  1N5H A;  3VGN A;  1VQ4 3;  4MMY B;  5G1K A;  3K0Z A;  1I2F A;  3EC9 A;  3GWR A;  3RGA A;  1GOY A;  1T2H A;  2QGU A;  2STD A;  1HU9 A;  1JZO A;  2HMK B;  1C54 A;  3A76 A;  3X3X A;  1CH0 A;  1T5Y A;  4RZM A;  4STD A;  1UCL A;  3BIR A;  3CCQ 3;  1OGX A;  4HOH A;  1RCL A;  3OX9 A;  4WFO A;  2HMJ B;  1Q82 4;  1RGE A;  2RBI A;  1TIJ A;  2XRX B;  2PNC A;  3N9H A;  3WOD G;  5CXO A;  3BNE A;  1B2M A;  1BSA A;  4BL2 A;  4R80 A;  3X41 A;  1FGR A;  1VZZ A;  1O7W B;  1T2I A;  2YFI B;  1BSB A;  2Z6B A;  4BIR A;  1GOV A;  3GZR A;  1QMA A;  5CF1 A;  2K0M A;  1D6U A;  1B2U A;  3HX8 A;  3IMA B;  3QRD A;  1NWW A;  4EV5 A;  1EUI C;  4LYL B;  4OK0 A;  3S27 A;  1JBS A;  1BNF A;  2UUG C;  2KF3 A;  4BTX A;  1BUJ A;  1RGH A;  3X3Z A;  4Q53 A;  6GSP A;  3CXC 2;  4DKI A;  3UL6 A;  4CPK A;  4HZB B;  2HMM B;  3B4P A;  3NM7 A;  4FMA A;  3FCS B;  3TDG A;  4O3V A;  3LZA A;  3EX9 A;  2GEY A;  5IEP A;  3FG3 A;  3LYG A;  4L8O A;  3N54 B;  1RN4 A;  1UGI A;  1ULJ B;  2W9Q A;  2BO9 B;  4FCZ A;  4NHF A;  1K8A 4;  3FF0 A;  1GMQ A;  3CME 3;  3T0U A;  3DGL A;  1YI2 3;  2BNG A;  1MWR A;  8RNT A;  2MF7 A;  4I5Q A;  1RNT A;  1W7C A;  5D81 A;  3DGO A;  8CHO A;  3DGM A;  1AQZ A;  3GRD A;  5A0O B;  2L1S A;  2SBL A;  5TGN A;  2W0Q A;  1GD3 A;  1UCK A;  2FNQ A;  4K90 B;  1RRH A;  1N5P A;  4NPB A;  5RNT A;  3D79 A;  2RGQ A;  1I2E A;  2XFT A;  1UI7 A;  2QA4 3;  4X2O A;  4GL6 A;  2F4Y A;  1FYS A;  1Q7Y 4;  1B21 A;  2LYX A;  4EBG A;  1B27 A;  3BB9 A;  1UDI I;  5STD A;  1SII A;  1B2S A;  3OWU A;  5BVB A;  1FUT A;  2WOH A;  3G0K A;  1V58 A;  3NQZ A;  4XB5 A;  5ELU A;  5DRV A;  4X2H A;  3SOA A;  2Y73 A;  3K7C A;  3CPW 2;  1W6G A;  2CC3 A;  2F5M A;  4KT3 B;  1EG9 B;  2PZV A;  4LMI A;  5BXQ A;  3PCS A;  2XR8 B;  5HGR A;  2B1X B;  2WO0 A;  3DGY A;  2BHM A;  5KP3 A;  3OW2 2;  4XBX A;  3KSP A;  3J7Y d;  3I0Y A;  3CCL 3;  1VQM 3;  1MOL A;  4HVN A;  4WWU C;  1VQ9 3;  4EV2 A;  1SAR A;  2CWU A;  2ZHX B;  3SX1 A;  3URP A;  5HOH A;  1X1U A;  1K28 A;  2JDI H;  3BNB A;  3NX0 A;  5LC7 A;  1A90 A;  1A2V A;  1BIR A;  3BLZ A;  3O8Y A;  4U13 A;  2L4V A;  4G1M B;  2R41 A;  3Q1C A;  2P09 A;  1E3V A;  1N9E A;  1TTO A;  1O7N B;  1I3F A;  3M8C A;  3WA3 A;  3EBY A;  3UL5 A;  3Q3F A;  5LC6 A;  3FKA A;  1O7P B;  1Q40 A;  1TU5 A;  1ULI B;  4HM0 B;  1YGE A;  1TP6 A;  5M1A A;  3BU4 A;  3NV0 A;  3FG1 A;  1RRL A;  1U8C B;  2KCD A;  1JBR A;  1DMQ A;  2R4I A;  3ECF A;  5AII A;  3ALA A;  3ER7 A;  3LOY A;  4AKZ A;  4EC6 A;  1YNV X;  3MG2 A;  1VQ7 3;  1M1K 4;  3D9R A;  4WHA A;  1Q81 4;  3D5G A;  3F7S A;  5AIH A;  3ZG0 A;  5CLK A;  4HZ9 B;  1NDO B;  5AI1 A;  1BSC A;  9RNT A;  4RNT A;  2C10 A;  2YFJ B;  3CC2 3;  1N9J A;  1Q40 B;  3MKI A;  3V98 A;  2ZA4 A;  4K1V A;  4N6T A;  4N6L A;  1X1X A;  2OQE C;  3NBJ A;  1WNH A;  3JUN A;  3JUO A;  1OHO A;  3NM2 A;  3NV0 B;  1BRG A;  3G8Z A;  1C7H A;  4L7K A;  1IV9 A;  1A2P A;  3SVA A;  4QWT A;  1RN1 A;  3CMA 3;  1BU4 A;  1RGC A;  2INX A;  4WP5 A;  1YVB I;  3FLJ A;  4FCJ A;  3EBT A;  2RSX A;  3ZFZ A;  1W2Z A;  1NU3 A;  3MG1 A;  4HYZ A;  1IVU A;  2CFG A;  3CCR 3;  2RCD A;  3BND A;  2CK3 H;  2CW9 A;  3NBB A;  1FGM A;  2IYJ A;  1WMP A;  3EN8 A;  1TFK A;  1BNG A;  3MPH A;  3KZT A;  3VF1 A;  1J2B A;  3NHX A;  4IIA A;  2CFD A;  2F56 A;  2D42 A;  4BTY A;  5IG5 A;  1A2K A;  4HAA A;  3UB1 A;  1TJD A;  1FZU A;  1UCI A;  7STD A;  5IER A;  1EKM A;  4LZI A;  3T8U A;  3NUV A;  5IF6 A;  1RNB A;  3D5I A;  3CCS 3;  2O3O A;  1NO3 A;  3IPT A;  3B8L A;  3I55 3;  4O02 B;  2ML5 A;  3Q90 A;  1AR0 A;  1MNL A;  1LOV A;  4CCV A;  4GSP A;  2KF5 A;  3KCH A;  3LT8 A;  1NNV A;  3FH1 A;  1BRS A;  3F40 A;  2I9W A;  5BU4 A;  1GMP A;  5IEO A;  1NB5 I;  3RGR A;  1BAN A;  1WTH A;  4ILF A;  1G96 A;  4I4K A;  4N3V A;  5KP4 A;  4HM5 B;  1MWS A;  2HML B;  2E2U A;  5JPU A;  1UCJ A;  1B3S A; 
#chains in the Genus database with same CATH homology
 2GU1 A;  3G6E 3;  2IUK A;  3FGY A;  1YIJ 3;  1YHQ 3;  1GD4 A;  4LGQ A;  2W9P A;  1DVC A;  5CK6 A;  1KC8 4;  3NBR A;  1STD A;  3FZW A;  2XEP A;  2WOF A;  1SPU A;  4J9A A;  3WOF B;  4XBY A;  1VQL 3;  1DMM A;  3H3H A;  3KSE D;  1W2B 2;  1GYB A;  1TUH A;  3JVC A;  1IVW A;  1VQO 3;  3AMO A;  3EF8 A;  2FGT A;  5CF2 A;  3FSD A;  4HM4 B;  1IT7 A;  1ZO2 A;  2GXF A;  2XF3 A;  1O7M B;  1D6Z A;  1ROV A;  2XH9 A;  2W04 A;  2ZDJ A;  1KQS 2;  3KKG A;  1ASK A;  4KFE A;  2CFW A;  4RNZ A;  3MWZ A;  2Z76 A;  1KSI A;  4EXR A;  1NB3 I;  2OWP A;  3MSO A;  1WMN A;  1CQS A;  1IQX A;  1JKG A;  1LNH A;  3GZY B;  2BMO B;  2KXG A;  3H51 A;  3K5T A;  4MMX B;  3BNC A;  1VQ6 3;  1JB4 A;  1W4N A;  4FMC A;  4HM2 B;  2CG1 A;  3KII A;  4O8S A;  1OHP A;  1HKX A;  3GZX B;  1AVL A;  3KFQ C;  2RFR A;  2BT3 A;  2K54 A;  3MG3 A;  3RDE A;  4HM8 B;  1YJ9 3;  3DZL A;  5G2G A;  1K9M 4;  3B7C A;  5ELJ A;  1OPY A;  1O7H B;  3OV4 A;  2OOV C;  1JKG B;  1UI8 A;  1Z1S A;  3B4O A;  2YFL B;  1JRQ A;  4HJL B;  3PXM A;  5EQL A;  1VQ8 3;  1QAK A;  4ZM8 A;  2XGL A;  2W03 A;  2CHC A;  3SED A;  1DVD A;  4HKV B;  4KFF A;  1DMN A;  5EEO A;  2QEX 3;  1JB5 A;  2XFS A;  3SLU A;  1FGQ A;  1M9G A;  1JJ2 2;  3LML A;  3X3Y A;  1Y4K A;  1GY5 A;  3CPO A;  1AVK A;  3OWS A;  3WOE B;  1E3R A;  2OOV A;  1QVF 2;  3JUP A;  4AEQ A;  3SOY A;  3EJV A;  3S29 A;  3QK9 A;  5IEN A;  3HZP A;  3CC4 3;  5AEU B;  1OH0 A;  3DUK A;  4RBN A;  1N8Q A;  2Z77 A;  1YIT 3;  6STD A;  2O9U X;  1OF5 A;  3FF2 A;  4H61 A;  4H3U A;  5IW9 A;  2E2V A;  4MEI A;  5JBS A;  1S5A A;  2E2T A;  1OAC A;  1CEW I;  2WGQ A;  3V99 A;  3CCU 3;  2XSO B;  4R1K A;  4TX4 A;  1IU7 A;  2UX0 A;  3EN1 B;  1W00 A;  4FMB A;  2ZL8 A;  4ORL A;  2XGN A;  3GAX A;  3S28 A;  3F7X A;  4HM3 B;  4GB5 A;  2V1L A;  1EA2 A;  4IPB A;  2CIU A;  1W02 A;  3DMC A;  4LEH A;  2GEX A;  1ISK A;  3IJE B;  4CDL A;  2P0X A;  2F98 A;  1OF5 B;  3F8H A;  1L5G B;  1CYV A;  2KRT A;  4IT7 A;  1LOX A;  3FG4 A;  2YX9 A;  3D3L A;  1IV7 A;  2LQV A;  5JPP A;  2IUJ A;  3LTB A;  3CC7 3;  1AV4 A;  4N6N B;  1S72 3;  2B24 B;  4PEJ A;  3PCR A;  1YJW 3;  3X42 A;  2CWV A;  3NXJ A;  3F8X A;  5IG4 A;  4R9K A;  3LTD A;  2D1W A;  1TFO A;  4EYC A;  1FUW A;  2F99 A;  1QAF A;  2W2C A;  3CNM A;  4O2H A;  3EE1 A;  1CYU A;  5IG0 A;  4RNY A;  1FA3 A;  1PFP A;  2HMO B;  5AEW B;  1UW1 A;  3PZW A;  3LTA A;  1VQN 3;  1E97 A;  5AYR B;  1PU4 A;  3KE7 A;  5FW5 A;  1O7G B;  1R4C A;  3S67 A;  3LT9 A;  2W56 A;  2P38 A;  3EHC A;  3LXU X;  1BUQ A;  2F86 B;  3UNL A;  3U1W A;  3PYJ A;  3MYT A;  5AIG A;  1IT8 A;  2Y74 A;  2GBW B;  2BMR B;  2P0M A;  1OGZ A;  4N6U A;  1KD1 4;  1IK3 A;  2CFK A;  3ROB A;  3V92 A;  2W56 B;  1D6Y A;  3HI7 A;  1VQP 3;  1U5O A;  3Q2P A;  1JB2 A;  3U97 A;  4XBT A;  4K61 A;  2A15 A;  1QJG A;  4N6O B;  3I56 3;  3G16 A;  1OUN A;  4HM7 B;  1VQK 3;  2Q07 A;  1IVV A;  3PGB A;  3OXA A;  4JF8 A;  1STF I;  2BMQ B;  3MHE A;  3AMO B;  4XDV A;  2P05 A;  2M7O A;  4OUQ A;  1W01 A;  4MMZ B;  3DY5 A;  3KN4 A;  2OCT A;  3VSY A;  4J8T A;  3T8N A;  3JUM A;  2QIY A;  3WA2 X;  2CWT A;  1YJN 3;  1Q42 A;  1JNQ A;  3N8B A;  1DYU A;  2CH9 A;  2XSH B;  3NQY A;  3G4S 3;  2IA7 A;  2JQ5 A;  1SIH A;  4K1U A;  3CCM 3;  4KZ1 A;  1W5Z A;  4HBR A;  1ZX2 A;  3K9M C;  3F9S A;  5FGO A;  3S5C A;  4JRF A;  5EVH A;  1RN7 A;  2FXT A;  1LXE A;  1FGT A;  5I97 A;  1GS3 A;  4R4K A;  1UUV B;  1FGO A;  1UUW B;  1OCV A;  3DGN A;  2OTL 3;  4HM1 B;  1LVN A;  1KWI A;  1VQ5 3;  1QAL A;  1M1X B;  1US1 A;  1IVX A;  2HMN B;  4BTW A;  1JN5 A;  3WDG B;  1W6C A;  3F14 A;  1EQK A;  4KFD A;  2OTJ 3;  3GZB A;  1K73 4;  1N8R 4;  2GU3 A;  3OWY A;  4L8P A;  1IQ8 A;  2ML6 A;  3L0R A;  4FCM A;  4HM6 B;  4MJD A;  3HK4 A;  3X40 A;  4FR9 A;  1WMO A;  2IMJ A;  5D82 A;  1NJI 4;  3JUQ A;  4N6V 0;  4XM4 A;  1IDP A;  3STD A;  1ROA A;  1RKY A;  4WYK A;  4R9L A;  1SQW A;  3EB8 A;  4XDW A;  1K41 A;  5D83 A;  1GY6 A;  3DXO A;  3CD6 3;  2MC8 A;  1JV2 B;  3WMD A;  3UJM A;  1JN5 B;  1IQY A;  1RJO A;  2Z7A A;  1Q86 4;  1OHS A;  3DM8 A;  3HIG A;  4FMD A;  5DRE A;  3CU3 A;  2CFL A;  3EQQ B;  3LH4 A;  4AKY A;  3HII A;  1SJW A;  1GY7 A;  1W6Y A;  4LSO A;  2WGO A;  3CCE 3;  2CG0 A;  3PS8 A;  2C11 A;  3CNX A;  4N6M A;  3CCV 3;  1QVG 2;  4KVH A;  3K63 A;  4WYK B;  5AYS C;  3SXX A;  3CCJ 3;  2CKF B;  4NRE A;  1WQL B;  5KP1 A;  4OVM A;  1M90 4;  5AIF A;  2GBX B;  1V74 A;  2W6J H;  1F8N A;  3E99 A;  3LTC A;  3G71 3;  1A67 A;  2OQE A;  5IG3 A;  1N5H A;  3VGN A;  1VQ4 3;  4MMY B;  3K0Z A;  3EC9 A;  3GWR A;  3RGA A;  2QGU A;  2STD A;  1HU9 A;  2HMK B;  3A76 A;  3X3X A;  1T5Y A;  4RZM A;  4STD A;  3CCQ 3;  1OGX A;  3OX9 A;  4WFO A;  2HMJ B;  1Q82 4;  1TIJ A;  2XRX B;  2PNC A;  3N9H A;  3WOD G;  5CXO A;  3BNE A;  4R80 A;  3X41 A;  1FGR A;  2Z6B A;  1O7W B;  1VZZ A;  2YFI B;  3GZR A;  5CF1 A;  1QMA A;  2K0M A;  1D6U A;  3HX8 A;  3IMA B;  3QRD A;  1NWW A;  4EV5 A;  4OK0 A;  3S27 A;  4BTX A;  3X3Z A;  4Q53 A;  3CXC 2;  3UL6 A;  4HZB B;  2HMM B;  3B4P A;  3NM7 A;  4FMA A;  3FCS B;  3TDG A;  4O3V A;  3LZA A;  3EX9 A;  2GEY A;  5IEP A;  3FG3 A;  3LYG A;  4L8O A;  3N54 B;  1ULJ B;  2W9Q A;  2BO9 B;  4FCZ A;  4NHF A;  1K8A 4;  3FF0 A;  3CME 3;  3T0U A;  3DGL A;  1YI2 3;  2BNG A;  2MF7 A;  1W7C A;  5D81 A;  8CHO A;  3DGO A;  3DGM A;  3GRD A;  5A0O B;  2SBL A;  5TGN A;  2W0Q A;  1GD3 A;  2FNQ A;  4K90 B;  1RRH A;  1N5P A;  2RGQ A;  2XFT A;  1UI7 A;  2QA4 3;  4X2O A;  4GL6 A;  1Q7Y 4;  2LYX A;  4EBG A;  3BB9 A;  5STD A;  1SII A;  3OWU A;  5BVB A;  4XB5 A;  2WOH A;  3G0K A;  3NQZ A;  5ELU A;  5DRV A;  4X2H A;  3SOA A;  2Y73 A;  3K7C A;  3CPW 2;  1W6G A;  2CC3 A;  1EG9 B;  2PZV A;  4LMI A;  5BXQ A;  3PCS A;  2XR8 B;  5HGR A;  2B1X B;  2WO0 A;  2BHM A;  5KP3 A;  3OW2 2;  4XBX A;  3KSP A;  3J7Y d;  3I0Y A;  3CCL 3;  1VQM 3;  1MOL A;  4HVN A;  4WWU C;  1VQ9 3;  4EV2 A;  2CWU A;  3SX1 A;  2JDI H;  1K28 A;  3BNB A;  3NX0 A;  1A90 A;  5LC7 A;  1A2V A;  3BLZ A;  3O8Y A;  4U13 A;  2L4V A;  4G1M B;  3Q1C A;  2P09 A;  1E3V A;  1N9E A;  3WA3 A;  1O7N B;  3M8C A;  3EBY A;  3UL5 A;  5LC6 A;  3FKA A;  1O7P B;  1Q40 A;  1TU5 A;  1ULI B;  4HM0 B;  1YGE A;  1TP6 A;  3NV0 A;  3FG1 A;  1RRL A;  1U8C B;  2KCD A;  1DMQ A;  2R4I A;  3ECF A;  5AII A;  3ALA A;  3ER7 A;  3LOY A;  4AKZ A;  4EC6 A;  1M1K 4;  3MG2 A;  1VQ7 3;  3D9R A;  4WHA A;  1Q81 4;  3F7S A;  5AIH A;  5CLK A;  4HZ9 B;  1NDO B;  5AI1 A;  2C10 A;  2YFJ B;  3CC2 3;  1N9J A;  1Q40 B;  3MKI A;  3V98 A;  4K1V A;  4N6T A;  4N6L A;  2OQE C;  3NBJ A;  1WNH A;  3JUN A;  3JUO A;  1OHO A;  3NM2 A;  3NV0 B;  3G8Z A;  1C7H A;  4L7K A;  1IV9 A;  3SVA A;  4QWT A;  3CMA 3;  2INX A;  4WP5 A;  1YVB I;  3FLJ A;  4FCJ A;  3EBT A;  2RSX A;  1W2Z A;  1NU3 A;  3MG1 A;  4HYZ A;  1IVU A;  2CFG A;  3CCR 3;  2RCD A;  3BND A;  2CK3 H;  2CW9 A;  3NBB A;  1FGM A;  3EN8 A;  1WMP A;  1TFK A;  3MPH A;  3KZT A;  3VF1 A;  1J2B A;  3NHX A;  4IIA A;  2CFD A;  4BTY A;  2D42 A;  5IG5 A;  1A2K A;  3UB1 A;  7STD A;  5IER A;  1EKM A;  4LZI A;  3T8U A;  3NUV A;  5IF6 A;  3CCS 3;  2O3O A;  1NO3 A;  3IPT A;  3B8L A;  3I55 3;  4O02 B;  2ML5 A;  3Q90 A;  1AR0 A;  1MNL A;  4CCV A;  3LT8 A;  3FH1 A;  3F40 A;  2I9W A;  5IEO A;  1NB5 I;  3RGR A;  1WTH A;  5KP4 A;  1G96 A;  4I4K A;  4N3V A;  4HM5 B;  2HML B;  2E2U A;  5JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...