4Q53A

Crystal structure of a duf4783 family protein (bacuni_04292) from bacteroides uniformis atcc 8492 at 1.27 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
107
Chain Sequence
b'NVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNFFRKVQNKYVIHQIRIDKTDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACUNI_04292) from Bacteroides uniformis ATCC 8492 at 1.27 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Structural genomics, unknown function
total genus 28
structure length 107
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4q53A00
1GY7A 4J8TA 1E3VA 3FLJA 3MKIA 3B8LA 2GXFA 1O7HB 5CLKA 3GZYB 2A15A 3UJMA 3CPOA 1ZO2A 1JKGB 3DZLA 3VGNA 3CU3A 2GEXA 2HMKB 3EJVA 3NV0B 1A2KA 3FSDA 2XR8B 3NV0A 4H3UA 3JUNA 3S5CA 3GWRA 1DMQA 2PZVA 1OHOA 4R9LA 2B24B 1O7WB 3NBRA 1OHPA 4XB5A 3SEDA 1OUNA 3FZWA 2BMQB 5KP3A 3F9SA 2QIYA 3OV4A 3JUQA 2BNGA 3H51A 5BXQA 5IF6A 4R1KA 4HJLB 5KP4A 3F7XA 3ROBA 3F14A 4HZ9B 5STDA 2F99A 5IEPA 2YFIB 4HM4B 2GEYA 5AIHA 2K54A 5HGRA 4HM1B 2R4IA 3NM2A 3H3HA 1UUWB 4K1UA 3OWUA 3Q90A 4U13A 3MSOA 2CKFB 3F40A 3FKAA 4N3VA 3NUVA 4MJDA 5D82A 3WMDA 3A76A 3EBYA 1C7HA 3SOAA 1EA2A 3B4PA 2GBWB 4WYKB 2RCDA 1TP6A 1O7MB 3STDA 5BVBA 4WYKA 1DMMA 3OWYA 2INXA 4HM6B 3OXAA 3OX9A 1O7PB 3DXOA 1HKXA 3D9RA 4HZBB 3T8UA 3JUPA 4K1VA 3UNLA 3ER7A 1OH0A 2HMOB 3EQQB 2HMJB 4IIAA 4OVMA 1W6YA 1EG9B 5CF2A 4WP5A 1WQLB 1W01A 4GB5A 2Z76A 4CDLA 1UUVB 5FW5A 2OWPA 3HK4A 4LMIA 1VZZA 4LGQA 3NXJA 1ULIB 3LYGA 1OGXA 4XBXA 4STDA 4FCJA 5AI1A 2XSOB 4HM5B 3FF2A 1Q42A 3DM8A 1ZX2A 5CXOA 3B7CA 4XBTA 5IG0A 3EC9A 3G8ZA 4J9AA 1W02A 3SOYA 3G0KA 3EBTA 3F8XA 5IG5A 5DRVA 4RZMA 3KKGA 4OUQA 5EVHA 1Z1SA 5TGNA 4X2HA 1AR0A 1CQSA 4I4KA 3MG3A 1E97A 3MYTA 3KE7A 3EN8A 3HX8A 5IERA 3M8CA 3IPTA 3MHEA 1JN5A 3GRDA 5AIFA 5IEOA 2JQ5A 3G16A 2QGUA 8CHOA 2CHCA 1GYBA 3T8NA 1GY5A 3I0YA 1Q40B 1JB5A 2W2CA 2GBXB 1NU3A 1Q40A 4WWUC 4XBYA 1GS3A 1OHSA 2RGQA 3OWSA 3F7SA 3KSPA 1ISKA 3EN1B 1IDPA 2BMRB 4HM0B 5G2GA 4L7KA 1GY6A 3RGAA 1DMNA 1NDOB 1ULJB 1JKGA 3NHXA 3K0ZA 3F8HA 1NWWA 1BUQA 1STDA 3GZXB 3DUKA 5D83A 3EX9A 5DREA 4XDVA 3FH1A 1S5AA 4KVHA 7STDA 3DMCA 4HM7B 3BB9A 1ASKA 1JB4A 3LZAA 2HMNB 3E99A 3K7CA 1E3RA 2HMLB 2F86B 3MG2A 4XM4A 4ORLA 4X2OA 3MG1A 5AIIA 2YFLB 1OGZA 4Q53A 3EHCA 4LEHA 4HKVB 2XSHB 1JB2A 2UX0A 2RFRA 4HM3B 1TUHA 5IENA 4L8OA 3FF0A 2STDA 3RGRA 4HM2B 4L8PA 1SJWA 2BMOB 4PEJA 2Z77A 1OPYA 3GZRA 3JUMA 5JPUA 5KP1A 2XRXB 1JN5B 3ECFA 3CNMA 3KZTA 2YFJB 2HMMB 5CF1A 3GZBA 5JPPA 1W00A 1QMAA 3VSYA 1OCVA 5D81A 4HVNA 4FCMA 4R9KA 3BLZA 5IG3A 1O7NB 5AEWB 5IG4A 2F98A 2Z7AA 1U5OA 3JUOA 5AEUB 4HM8B 3EF8A 2IMJA 3HZPA 6STDA 3CNXA 2B1XB 5CK6A 3FGYA 1QJGA 1K41A 2I9WA 1O7GB 3B4OA 1OF5B 4XDWA 1OF5A 5AIGA
chains in the Genus database with same CATH superfamily
1GY7A 3BNCA 1E3VA 4J8TA 3FLJA 1UCKA 1YI23 1YIT3 2WO0A 2XFTA 3MKIA 3B8LA 5M19A 2GXFA 2KRTA 2KXGA 3CCS3 1O7HB 5M18A 2Q07A 5CLKA 2ZA4A 3GZYB 1DE3A 4GHOA 3CXC2 2KF6A 2A15A 1BSAA 3UJMA 3CPOA 1K734 1A2VA 3WOEB 1ZO2A 3EE1A 1JJ22 1JKGB 3D5IA 2L1SA 5HOHA 3CC23 1B3SA 2F5WA 1TFKA 4FMAA 2ML6A 3DZLA 3LOYA 3DY5A 4N6V0 1QVG2 1YVSA 3VGNA 4N6LA 3CU3A 3CCJ3 1KD14 1DVDA 1I2GA 2GEXA 1X1WA 1BSBA 2HMKB 3EJVA 3J7Yd 1M9GA 1TRQA 1RJOA 3NV0B 3X42A 1UGIA 2CWUA 1KC84 1A2KA 2XH9A 3FSDA 5LC7A 1WMNA 2XR8B 3NV0A 4H3UA 1G02A 1STFI 3DH2A 3JUNA 3WOFB 3S5CA 4CJNA 3GWRA 3CD63 1IQ8A 1BNEA 1DMQA 1MGWA 2PZVA 2XGNA 2CWTA 7GSPA 1OHOA 3TDGA 4R9LA 2B24B 2WOHA 3MWZA 1O7WB 3NBRA 2GU3A 1RNTA 3QRDA 1OHPA 1L5GB 1I3IA 1UCIA 4XB5A 1FUSA 3SEDA 3UL6A 1CYUA 1PYLA 2WOFA 4HAAA 1OUNA 1RGKA 3FZWA 3X3XA 2ZL8A 1V57A 2BMQB 5KP3A 2P0XA 3WR2A 4JRFA 3UB1A 1CEWI 3K5TA 2QIYA 3D3LA 3OV4A 4KFEA 3JUQA 2BNGA 1TJDA 1BVIA 1RN7A 3H51A 5BXQA 5IF6A 1NNVA 1AVKA 4R1KA 1FYSA 3NQYA 3PYJA 1NJI4 1C54A 2R41A 3D5GA 1A67A 3AHSA 4HJLB 1N5PA 5KP4A 3LTAA 3CMA3 1BIRA 1W6GA 2JDIH 3AGOA 3F7XA 4BTWA 3X40A 3NBBA 1RRLA 1EUIC 2AADA 2H0HA 1FZUA 2P0MA 3N9HA 1KSIA 2HOHA 1MOLA 1UCLA 2L4VA 4RBNA 2ZHXB 3F14A 3ROBA 3S29A 1QVF2 1GMPA 3K9MC 4HZ9B 1N8R4 3V98A 3QK9A 5STDA 2F99A 2KCDA 5IEPA 2CH9A 2YFIB 4LZIA 4HM4B 1Q814 4WFOA 1BRIA 3LTDA 1FGMA 3S28A 1X1YA 4TX4A 3AHWA 1RLSA 3PCRA 2CIUA 2GEYA 4K90B 5AIHA 3LH4A 2K54A 5HGRA 4HM1B 1Q824 1VQ43 3RNTA 1VQ53 3DGMA 2RSXA 5AIGA 3CME3 1TTOA 3D79A 3D4AA 2R4IA 2MC8A 1VQK3 2ZDJA 4FR9A 3NM2A 3H3HA 1UUWB 1WMOA 4K1UA 3U1WA 4HOHA 3OWUA 3Q90A 1DETA 3ALAA 4U13A 3MSOA 1FGQA 2CKFB 1MGRA 2CG0A 3F40A 2XEPA 2W03A 1V74A 3FKAA 4K61A 2D1WA 2CFDA 3NUVA 2CX0A 4N3VA 2CG1A 1YJW3 1EEJA 1BNSA 1QAKA 3T0UA 4R4KA 4MJDA 1BSCA 5D82A 3WMDA 1AVLA 3A76A 1MWSA 3EBYA 1VQ63 3JVCA 1C7HA 1RTUA 1WNHA 2KF5A 1AV4A 3SOAA 1UUGB 1GMRA 1I2FA 1EA2A 3O8YA 4FMDA 3HI7A 1YVBI 3B4PA 2GBWB 1CYVA 4RNYA 1B2ZA 2P09A 1IT8A 6GSPA 3HIGA 3UL5A 4KT3B 1BNJA 4WYKB 4KZ1A 2RCDA 1TP6A 2W0QA 1O7MB 3STDA 5BVBA 4WYKA 2KF3A 1DMMA 1LOWA 3OWYA 2INXA 4HM6B 2W56B 3OXAA 1U8CB 1JRQA 2W56A 3N8BA 3OX9A 1O7PB 3NM7A 1BSDA 3DXOA 2K0MA 4LYLB 1BOXA 3IMAB 4CPKA 1HKXA 2CC3A 2RNTA 1RGLA 3D9RA 2RBIA 1HU9A 4HZBB 3JUPA 3T8UA 4BL3A 4IPBA 1BNGA 1I0VA 4K1VA 3UNLA 1EQKA 2P38A 3ER7A 1AY7A 1OH0A 2HMOB 3EQQB 2HMJB 4IIAA 1BAOA 4ZM8A 2OQEC 1BRGA 3N54B 4OVMA 2BHMA 4BL2A 1VQP3 3SVAA 1BNRA 4NHFA 1WTHA 1W6YA 1R4CA 1EG9B 5JBSA 9RNTA 1NB5I 5CF2A 2OTJ3 4WP5A 3LT8A 1WQLB 3WHOA 1W2ZA 4MMZB 1W01A 4GB5A 2J8XB 3WODG 3BNEA 2XFSA 3Q1CA 2Z76A 4CDLA 1DYUA 1UUVB 5FW5A 4EXRA 2OWPA 3HK4A 4LMIA 1VZZA 1M904 4LGQA 1YGEA 3NXJA 1T2HA 1ULIB 1CH0A 1OGXA 1BGSA 1OACA 3LYGA 4N6TA 2CFKA 4XBXA 1IV7A 1SARA 4STDA 4FCJA 5AI1A 1W6CA 2IYJA 2W6JH 2XSOB 4LSOA 4MMXB 2Y73A 1SIHA 1RGGA 1N8QA 1YJ93 4HM5B 2C4BA 3FF2A 1Q42A 2F4YA 4DKIA 1UDII 1X1XA 4IT7A 3DM8A 4ILFA 3AMOA 1ZX2A 5CXOA 2OCTA 3B7CA 3V92A 3G6E3 1SQWA 4XBTA 1BNIA 1EKMA 4HBRA 4O3VA 1VQQA 5IG0A 1LXEA 3EC9A 2UUGC 1W02A 2Y74A 3G8ZA 4GSPA 4J9AA 3SOYA 1VQ93 2O9UX 3G0KA 1I8VA 4N6UA 3G4S3 3EBTA 1IYYA 3F8XA 2SBLA 5IG5A 1LNIA 1BU4A 3SXXA 2BU4A 4HYZA 1GOYA 1SIIA 3NQZA 2CFWA 3SYUA 2IY2A 1IU7A 1G0TA 2KF4A 4RNZA 1RRHA 1BRHA 4I5QA 3ZFZA 3DGNA 5DRVA 1YIJ3 4RZMA 4EYCA 1LQMB 3KKGA 3KN4A 1NO3A 4OUQA 3Q2PA 5EVHA 1IT7A 1GD4A 1Z1SA 1YGWA 3HOHA 2BO9B 3LXUX 3URPA 1RDSA 5TGNA 4X2HA 1AR0A 1CQSA 4I4KA 2ML5A 3MG3A 1TU5A 1IQXA 4WHAA 1E97A 2K3DA 3MYTA 3CCV3 1K28A 3KE7A 4AKYA 1VQN3 1B27A 1BUJA 3EN8A 4GL6A 1VQL3 2F56A 3ZG0A 4EBGA 2KAAA 3HX8A 2F5MA 5IERA 2E2UA 5AIFA 3M8CA 1QAFA 3IPTA 3MHEA 1MWUA 1JN5A 1JV2B 1RN1A 1B2SA 1ROVA 1M1XB 1I0XA 2IUKA 3GRDA 1UCJA 3HIIA 3PZWA 1RN4A 5IEOA 2CFGA 1KQS2 1F8NA 4FMCA 2JQ5A 3FG3A 5LC6A 3G16A 2CWVA 2QGUA 1RGFA 3NX0A 1Q9EA 4NREA 8CHOA 2CHCA 4BTYA 1AQZA 4N6MA 1RKYA 1SPUA 2OQEA 1V58A 1T2IA 2V1LA 1JZDA 1MWRA 1GYBA 3FG1A 2CK3H 3T8NA 2XGLA 3DGOA 1GY5A 3I0YA 5ELJA 1Q864 3WA2X 4EV5A 4N6OB 3I563 3G713 2UGIA 5M1AA 1Q40B 1JB5A 2W2CA 3KIIA 4FMBA 4EC6A 2GBXB 1NU3A 1JNQA 1MNLA 1Q40A 1S723 4WWUC 3LMLA 4XBYA 2OOVA 2H0GA 3I553 1GS3A 1OHSA 3X41A 1IVUA 5EEOA 4NPBA 1PU4A 3FCSB 2RGQA 4EW5A 1B2XA 1QALA 3OWSA 3BIRA 3F7SA 3KSPA 3U97A 5BU4A 1M1K4 3EB8A 2CX1A 1ISKA 4MMYB 3CCU3 3EN1B 1I3FA 1R4YA 1IDPA 1W2B2 3AGNA 3PS8A 4J5GA 2FNQA 2BMRB 4BU4A 4HM0B 1PY3A 5G2GA 5I97A 4L7KA 3CPW2 1GY6A 3SLUA 3RGAA 2M7OA 3PGBA 1DMNA 1NDOB 1VQO3 2FXTA 2IA7A 1X1UA 1YJN3 1ULJB 2PNCA 3NBJA 1JKGA 1RCKA 1US1A 2P05A 1FGRA 3K0ZA 3NHXA 1D6UA 1A2PA 1NWWA 1TIJA 2YX9A 3F8HA 1STDA 2SARA 1LQGC 3L0RA 1JBSA 3CC43 1BUQA 3GZXB 1LRAA 3DUKA 5D83A 2CW9A 2OOVC 1IK3A 1DVCA 1GOVA 5G1LA 5A0OB 1IVWA 3SX1A 3EX9A 1GD3A 2WGQA 1FUWA 5DREA 3CCQ3 2D42A 4XDVA 3FH1A 1S5AA 8RNTA 4KVHA 3CCR3 1IVXA 1K8A4 3BNDA 1FGOA 7STDA 1B2UA 3DMCA 4HM7B 1LOVA 3BB9A 1ASKA 4BTXA 1GSPA 3AMOB 5AYSC 1JB4A 3LZAA 2HMNB 1RGHA 3E99A 4FCZA 3K7CA 1E3RA 2HMLB 1UGHI 2F86B 1WMPA 3MG2A 4XM4A 1LNHA 3BU4A 1GMQA 5EQLA 2AAEA 3KFQC 2MF7A 1IV9A 4CCVA 1VQ73 4MEIA 4ORLA 1LVNA 1LOXA 2GU1A 4O2HA 1B2MA 4X2OA 4EV2A 3MG1A 5GSPA 1UI8A 2W9QA 4G1MB 5IW9A 1JBRA 1Q7HA 2LYXA 5AIIA 3V99A 2YFLB 3FG4A 2FGTA 1OGZA 1IVVA 1ZGXA 4Q53A 1HYFA 3EHCA 3PXMA 5G1KA 2C10A 4BIRA 1BNFA 3CCE3 4LEHA 2QEX3 3X3ZA 1RNBA 3LTBA 1RGAA 3CCL3 3LT9A 1RCLA 2W04A 4HKVB 1PFPA 1W5ZA 2XSHB 3IJEB 2W9PA 5AYRB 2IUJA 1T3BA 1JB2A 1K9M4 2UX0A 2BIRA 4JF8A 2RFRA 4RNTA 3ZG5A 3OW22 1J2BA 1N9JA 3KSED 5BIRA 1Y4KA 3DGLA 4HM3B 4KFDA 1TUHA 4H61A 5IENA 1HZ1A 5RNTA 4L8OA 2BT3A 3BNBA 3FF0A 4QWTA 2STDA 1N5HA 2E2VA 4HM2B 4L8PA 1RHLA 3A5EA 3RGRA 1VQ83 1SJWA 1RGCA 5ELUA 1I2EA 1G96A 1JBTA 2BMOB 1RMSA 4PEJA 2Z77A 1OPYA 2E2TA 3GZRA 3S27A 3JUMA 3WDGB 1D6ZA 3CC73 1D6YA 1W7CA 3CCM3 5JPUA 1FW7A 6RNTA 1Q7Y4 1TRPA 1TFOA 1GOUA 1YNVX 4AEQA 5KP1A 2XRXB 1JN5B 3ECFA 3CNMA 4R80A 4O02B 3S67A 3KZTA 2XF3A 1I70A 1MWTA 2HMMB 2YFJB 5CF1A 1FA3A 1RSNA 3GZBA 1W00A 5JPPA 3PCSA 3VF1A 2Z6BA 3Q3FA 1QMAA 3VSYA 1BRNL 1OCVA 1KWIA 2H0IA 3MPHA 5D81A 1BANA 1B21A 4HVNA 4FCMA 4R9KA 2C11A 3BLZA 2CFLA 3GAXA 1A90A 4N6NB 1ZS7A 3LTCA 5IG3A 1NB3I 1O7NB 5AEWB 5IG4A 7RNTA 2F98A 1UI7A 1FUTA 2Z7AA 3X3YA 1UW1A 4OK0A 1U5OA 3JUOA 1FGTA 1BRKA 4J5KA 1RGEA 2LQVA 2WGOA 4AKZA 5AEUB 1IQYA 3EF8A 1W4NA 4HM8B 4KFFA 1BSEA 2IMJA 1VQM3 1ROAA 3HZPA 1B20A 1BRJA 3KCHA 4O8SA 2O3OA 3CNXA 2B1XB 6STDA 3WA3A 1YHQ3 2QA43 5CK6A 3FGYA 1QJGA 1K41A 1JZOA 2GSPA 1O7GB 2I9WA 3B4OA 1T5YA 1OF5B 4XDWA 5FGOA 1N9EA 3RDEA 2OTL3 1LOYA 1OF5A 1BRSA 3GSPA 3DGYA 3K63A 3F9SA
chains in the Genus database with same CATH topology
1GY7A 3BNCA 1E3VA 4J8TA 3FLJA 1YIT3 1YI23 2WO0A 2XFTA 3MKIA 3B8LA 2GXFA 2KRTA 2KXGA 3CCS3 1O7HB 2Q07A 5CLKA 3GZYB 3CXC2 2A15A 3UJMA 3CPOA 1K734 1A2VA 3WOEB 1ZO2A 3EE1A 1JJ22 1JKGB 3CC23 1TFKA 4FMAA 2ML6A 3DZLA 3LOYA 3DY5A 4N6V0 1QVG2 3VGNA 4N6LA 3CU3A 3CCJ3 1KD14 1DVDA 2GEXA 2HMKB 3EJVA 3J7Yd 1M9GA 1RJOA 3NV0B 3X42A 1KC84 2CWUA 1A2KA 2XH9A 3FSDA 5LC7A 1WMNA 2XR8B 3NV0A 4H3UA 1STFI 3WOFB 3JUNA 3S5CA 3GWRA 3CD63 1IQ8A 1DMQA 2XGNA 2PZVA 2CWTA 1OHOA 3TDGA 4R9LA 2B24B 2WOHA 3MWZA 1O7WB 3NBRA 2GU3A 3QRDA 1OHPA 1L5GB 4XB5A 3SEDA 3UL6A 1CYUA 2WOFA 1OUNA 3X3XA 3FZWA 2ZL8A 2BMQB 5KP3A 2P0XA 4JRFA 3UB1A 1CEWI 3K5TA 2QIYA 3D3LA 3OV4A 3JUQA 2BNGA 1RN7A 3H51A 5BXQA 5IF6A 1AVKA 4R1KA 3NQYA 3PYJA 1NJI4 1A67A 4HJLB 1N5PA 5KP4A 3LTAA 3CMA3 1W6GA 2JDIH 3F7XA 4BTWA 3X40A 3NBBA 1RRLA 2P0MA 3N9HA 1KSIA 1MOLA 4RBNA 2L4VA 3ROBA 3F14A 3S29A 1QVF2 4HZ9B 3K9MC 1N8R4 3V98A 3QK9A 5STDA 2F99A 2KCDA 5IEPA 2CH9A 2YFIB 4LZIA 4HM4B 1Q814 4WFOA 3LTDA 1FGMA 3S28A 4TX4A 3PCRA 2CIUA 2GEYA 4K90B 5AIHA 3LH4A 2K54A 5HGRA 4HM1B 1Q824 1VQ43 1VQ53 3DGMA 2RSXA 5AIGA 3CME3 2R4IA 2MC8A 1VQK3 2ZDJA 4FR9A 3NM2A 3H3HA 1UUWB 1WMOA 4K1UA 3U1WA 3OWUA 3Q90A 3ALAA 4U13A 3MSOA 1FGQA 2CKFB 2CG0A 3F40A 2XEPA 2W03A 1V74A 3FKAA 4K61A 2D1WA 2CFDA 3NUVA 4N3VA 2CG1A 1YJW3 3T0UA 1QAKA 4R4KA 4MJDA 5D82A 3WMDA 1AVLA 3A76A 1VQ63 3EBYA 3JVCA 1C7HA 1WNHA 1AV4A 3SOAA 1EA2A 3O8YA 4FMDA 3HI7A 1YVBI 3B4PA 2GBWB 1CYVA 4RNYA 2P09A 1IT8A 3HIGA 4WYKB 4KZ1A 2RCDA 1TP6A 2W0QA 1O7MB 3STDA 5BVBA 4WYKA 1DMMA 3OWYA 2INXA 4HM6B 2W56B 3OXAA 1U8CB 1JRQA 2W56A 3N8BA 3OX9A 1O7PB 3NM7A 3DXOA 2K0MA 3IMAB 1HKXA 2CC3A 3D9RA 4HZBB 1HU9A 3T8UA 3JUPA 4IPBA 4K1VA 3UNLA 1EQKA 2P38A 3ER7A 1OH0A 2HMOB 3EQQB 2HMJB 4IIAA 4ZM8A 2OQEC 3N54B 4OVMA 2BHMA 1VQP3 3SVAA 4NHFA 1WTHA 1W6YA 1R4CA 1EG9B 5JBSA 1NB5I 5CF2A 2OTJ3 4WP5A 3LT8A 1WQLB 1W2ZA 4MMZB 1W01A 4GB5A 3WODG 3BNEA 2XFSA 3Q1CA 2Z76A 4CDLA 1DYUA 1UUVB 5FW5A 4EXRA 2OWPA 3HK4A 4LMIA 1VZZA 1M904 4LGQA 1YGEA 3NXJA 1ULIB 3LYGA 1OGXA 1OACA 4N6TA 2CFKA 4XBXA 1IV7A 4STDA 4FCJA 5AI1A 1W6CA 2XSOB 2W6JH 4LSOA 4MMXB 2Y73A 1SIHA 1N8QA 1YJ93 4HM5B 3FF2A 1Q42A 4IT7A 3DM8A 3AMOA 1ZX2A 5CXOA 2OCTA 3B7CA 3V92A 3G6E3 1SQWA 4XBTA 1EKMA 4HBRA 4O3VA 5IG0A 1LXEA 3EC9A 2Y74A 1W02A 3G8ZA 4J9AA 1VQ93 3SOYA 2O9UX 3G0KA 4N6UA 3G4S3 3EBTA 3F8XA 2SBLA 5IG5A 3SXXA 4HYZA 1SIIA 3NQZA 2CFWA 1IU7A 4RNZA 1RRHA 3DGNA 5DRVA 1YIJ3 4RZMA 4EYCA 3KKGA 3KN4A 1NO3A 4OUQA 3Q2PA 5EVHA 1IT7A 1GD4A 1Z1SA 2BO9B 3LXUX 5TGNA 4X2HA 1AR0A 1CQSA 4I4KA 2ML5A 3MG3A 1TU5A 1IQXA 4WHAA 1E97A 3MYTA 3CCV3 1K28A 3KE7A 4AKYA 1VQN3 3EN8A 4GL6A 1VQL3 4EBGA 3HX8A 5IERA 2E2UA 3M8CA 1QAFA 3IPTA 3MHEA 1JN5A 1JV2B 1ROVA 3GRDA 4KFEA 1M1XB 2IUKA 3HIIA 3PZWA 5AIFA 5IEOA 3UL5A 2CFGA 1KQS2 1F8NA 4FMCA 2JQ5A 3FG3A 5LC6A 3G16A 2CWVA 2QGUA 3NX0A 4NREA 8CHOA 2CHCA 4BTYA 4N6MA 1RKYA 1SPUA 2OQEA 2V1LA 1GYBA 3FG1A 2CK3H 3T8NA 2XGLA 3DGOA 1GY5A 3I0YA 5ELJA 1Q864 3WA2X 4EV5A 4N6OB 3I563 3G713 1Q40B 1JB5A 2W2CA 3KIIA 4FMBA 4EC6A 2GBXB 1NU3A 1JNQA 1MNLA 1Q40A 1S723 4WWUC 3LMLA 4XBYA 2OOVA 3I553 1GS3A 1OHSA 3X41A 1IVUA 5EEOA 1PU4A 3FCSB 2RGQA 1QALA 3OWSA 1M1K4 3F7SA 3KSPA 3U97A 3EB8A 1ISKA 4MMYB 3CCU3 3EN1B 1IDPA 1W2B2 3PS8A 2FNQA 2BMRB 5I97A 4HM0B 3CPW2 5G2GA 4L7KA 1GY6A 3SLUA 3RGAA 2M7OA 3PGBA 1DMNA 1NDOB 1VQO3 2FXTA 2IA7A 1YJN3 1ULJB 2PNCA 3NBJA 1JKGA 1US1A 2P05A 1FGRA 3K0ZA 3NHXA 1D6UA 3F8HA 1NWWA 1TIJA 2YX9A 3CC43 1STDA 1BUQA 3L0RA 3GZXB 3DUKA 5D83A 2OOVC 2CW9A 1IK3A 1DVCA 5A0OB 1IVWA 3SX1A 3EX9A 1GD3A 2WGQA 1FUWA 5DREA 3CCQ3 2D42A 4XDVA 3FH1A 1S5AA 4KVHA 3CCR3 1IVXA 1K8A4 3BNDA 1FGOA 7STDA 3DMCA 4HM7B 3BB9A 1ASKA 4BTXA 3AMOB 5AYSC 1JB4A 3LZAA 2HMNB 3E99A 4FCZA 3K7CA 1E3RA 2HMLB 2F86B 3MG2A 1WMPA 4XM4A 1LNHA 5EQLA 3KFQC 2MF7A 1IV9A 4CCVA 1VQ73 4MEIA 4ORLA 1LVNA 1LOXA 2GU1A 4O2HA 4X2OA 4EV2A 3MG1A 1UI8A 2W9QA 4G1MB 5IW9A 2LYXA 5AIIA 3V99A 2YFLB 3FG4A 2FGTA 1OGZA 1IVVA 4Q53A 3EHCA 3PXMA 2C10A 3CCE3 4LEHA 2QEX3 3X3ZA 3LTBA 3CCL3 3LT9A 2W04A 4HKVB 1PFPA 1W5ZA 2XSHB 3IJEB 2W9PA 5AYRB 2IUJA 1JB2A 1K9M4 2UX0A 4JF8A 2RFRA 3OW22 1J2BA 1N9JA 3KSED 1Y4KA 3DGLA 4HM3B 4KFDA 1TUHA 4H61A 5IENA 4L8OA 2BT3A 3BNBA 3FF0A 4QWTA 2STDA 1N5HA 2E2VA 4HM2B 4L8PA 3RGRA 1VQ83 1SJWA 5ELUA 1G96A 2BMOB 4PEJA 2Z77A 1OPYA 2E2TA 3GZRA 3S27A 3JUMA 3WDGB 1D6ZA 3CC73 1D6YA 1W7CA 3CCM3 5JPUA 1Q7Y4 1TFOA 4AEQA 5KP1A 2XRXB 1JN5B 3ECFA 3CNMA 4R80A 4O02B 3S67A 3KZTA 2XF3A 2HMMB 2YFJB 1FA3A 5CF1A 3GZBA 5JPPA 1W00A 3PCSA 3VF1A 2Z6BA 1QMAA 3VSYA 1OCVA 1KWIA 3MPHA 5D81A 4HVNA 4FCMA 4R9KA 2C11A 3BLZA 2CFLA 3GAXA 1A90A 4N6NB 3LTCA 5IG3A 1NB3I 1O7NB 5AEWB 5IG4A 2F98A 1UI7A 2Z7AA 3X3YA 1UW1A 4OK0A 1U5OA 3JUOA 1FGTA 4AKZA 2LQVA 2WGOA 5AEUB 1IQYA 3EF8A 1W4NA 4HM8B 4KFFA 2IMJA 1VQM3 1ROAA 3HZPA 4O8SA 2O3OA 3CNXA 2B1XB 6STDA 3WA3A 1YHQ3 2QA43 5CK6A 3FGYA 1QJGA 1K41A 2I9WA 1O7GB 3B4OA 1T5YA 1OF5B 4XDWA 5FGOA 1N9EA 3RDEA 2OTL3 1OF5A 3K63A 3F9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY7 A;  4J8T A;  1E3V A;  3FLJ A;  3MKI A;  3B8L A;  2GXF A;  1O7H B;  5CLK A;  3GZY B;  2A15 A;  3UJM A;  3CPO A;  1ZO2 A;  1JKG B;  3DZL A;  3VGN A;  3CU3 A;  2GEX A;  2HMK B;  3EJV A;  3NV0 B;  1A2K A;  3FSD A;  2XR8 B;  3NV0 A;  4H3U A;  3JUN A;  3S5C A;  3GWR A;  1DMQ A;  2PZV A;  1OHO A;  4R9L A;  2B24 B;  1O7W B;  3NBR A;  1OHP A;  4XB5 A;  3SED A;  1OUN A;  3FZW A;  2BMQ B;  5KP3 A;  3F9S A;  2QIY A;  3OV4 A;  3JUQ A;  2BNG A;  3H51 A;  5BXQ A;  5IF6 A;  4R1K A;  4HJL B;  5KP4 A;  3F7X A;  3ROB A;  3F14 A;  4HZ9 B;  5STD A;  2F99 A;  5IEP A;  2YFI B;  4HM4 B;  2GEY A;  5AIH A;  2K54 A;  5HGR A;  4HM1 B;  2R4I A;  3NM2 A;  3H3H A;  1UUW B;  4K1U A;  3OWU A;  3Q90 A;  4U13 A;  3MSO A;  2CKF B;  3F40 A;  3FKA A;  4N3V A;  3NUV A;  4MJD A;  5D82 A;  3WMD A;  3A76 A;  3EBY A;  1C7H A;  3SOA A;  1EA2 A;  3B4P A;  2GBW B;  4WYK B;  2RCD A;  1TP6 A;  1O7M B;  3STD A;  5BVB A;  4WYK A;  1DMM A;  3OWY A;  2INX A;  4HM6 B;  3OXA A;  3OX9 A;  1O7P B;  3DXO A;  1HKX A;  3D9R A;  4HZB B;  3T8U A;  3JUP A;  4K1V A;  3UNL A;  3ER7 A;  1OH0 A;  2HMO B;  3EQQ B;  2HMJ B;  4IIA A;  4OVM A;  1W6Y A;  1EG9 B;  5CF2 A;  4WP5 A;  1WQL B;  1W01 A;  4GB5 A;  2Z76 A;  4CDL A;  1UUV B;  5FW5 A;  2OWP A;  3HK4 A;  4LMI A;  1VZZ A;  4LGQ A;  3NXJ A;  1ULI B;  3LYG A;  1OGX A;  4XBX A;  4STD A;  4FCJ A;  5AI1 A;  2XSO B;  4HM5 B;  3FF2 A;  1Q42 A;  3DM8 A;  1ZX2 A;  5CXO A;  3B7C A;  4XBT A;  5IG0 A;  3EC9 A;  3G8Z A;  4J9A A;  1W02 A;  3SOY A;  3G0K A;  3EBT A;  3F8X A;  5IG5 A;  5DRV A;  4RZM A;  3KKG A;  4OUQ A;  5EVH A;  1Z1S A;  5TGN A;  4X2H A;  1AR0 A;  1CQS A;  4I4K A;  3MG3 A;  1E97 A;  3MYT A;  3KE7 A;  3EN8 A;  3HX8 A;  5IER A;  3M8C A;  3IPT A;  3MHE A;  1JN5 A;  3GRD A;  5AIF A;  5IEO A;  2JQ5 A;  3G16 A;  2QGU A;  8CHO A;  2CHC A;  1GYB A;  3T8N A;  1GY5 A;  3I0Y A;  1Q40 B;  1JB5 A;  2W2C A;  2GBX B;  1NU3 A;  1Q40 A;  4WWU C;  4XBY A;  1GS3 A;  1OHS A;  2RGQ A;  3OWS A;  3F7S A;  3KSP A;  1ISK A;  3EN1 B;  1IDP A;  2BMR B;  4HM0 B;  5G2G A;  4L7K A;  1GY6 A;  3RGA A;  1DMN A;  1NDO B;  1ULJ B;  1JKG A;  3NHX A;  3K0Z A;  3F8H A;  1NWW A;  1BUQ A;  1STD A;  3GZX B;  3DUK A;  5D83 A;  3EX9 A;  5DRE A;  4XDV A;  3FH1 A;  1S5A A;  4KVH A;  7STD A;  3DMC A;  4HM7 B;  3BB9 A;  1ASK A;  1JB4 A;  3LZA A;  2HMN B;  3E99 A;  3K7C A;  1E3R A;  2HML B;  2F86 B;  3MG2 A;  4XM4 A;  4ORL A;  4X2O A;  3MG1 A;  5AII A;  2YFL B;  1OGZ A;  4Q53 A;  3EHC A;  4LEH A;  4HKV B;  2XSH B;  1JB2 A;  2UX0 A;  2RFR A;  4HM3 B;  1TUH A;  5IEN A;  4L8O A;  3FF0 A;  2STD A;  3RGR A;  4HM2 B;  4L8P A;  1SJW A;  2BMO B;  4PEJ A;  2Z77 A;  1OPY A;  3GZR A;  3JUM A;  5JPU A;  5KP1 A;  2XRX B;  1JN5 B;  3ECF A;  3CNM A;  3KZT A;  2YFJ B;  2HMM B;  5CF1 A;  3GZB A;  5JPP A;  1W00 A;  1QMA A;  3VSY A;  1OCV A;  5D81 A;  4HVN A;  4FCM A;  4R9K A;  3BLZ A;  5IG3 A;  1O7N B;  5AEW B;  5IG4 A;  2F98 A;  2Z7A A;  1U5O A;  3JUO A;  5AEU B;  4HM8 B;  3EF8 A;  2IMJ A;  3HZP A;  6STD A;  3CNX A;  2B1X B;  5CK6 A;  3FGY A;  1QJG A;  1K41 A;  2I9W A;  1O7G B;  3B4O A;  1OF5 B;  4XDW A;  1OF5 A;  5AIG A; 
#chains in the Genus database with same CATH topology
 1GY7 A;  3BNC A;  1E3V A;  4J8T A;  3FLJ A;  1UCK A;  1YI2 3;  1YIT 3;  2WO0 A;  2XFT A;  3MKI A;  3B8L A;  5M19 A;  2GXF A;  2KRT A;  2KXG A;  3CCS 3;  1O7H B;  5M18 A;  2Q07 A;  5CLK A;  2ZA4 A;  3GZY B;  1DE3 A;  4GHO A;  3CXC 2;  2KF6 A;  2A15 A;  1BSA A;  3UJM A;  3CPO A;  1K73 4;  1A2V A;  3WOE B;  1ZO2 A;  3EE1 A;  1JJ2 2;  1JKG B;  3D5I A;  2L1S A;  5HOH A;  3CC2 3;  1B3S A;  2F5W A;  1TFK A;  4FMA A;  2ML6 A;  3DZL A;  3LOY A;  3DY5 A;  4N6V 0;  1QVG 2;  1YVS A;  3VGN A;  4N6L A;  3CU3 A;  3CCJ 3;  1KD1 4;  1DVD A;  1I2G A;  2GEX A;  1X1W A;  1BSB A;  2HMK B;  3EJV A;  3J7Y d;  1M9G A;  1TRQ A;  1RJO A;  3NV0 B;  3X42 A;  1UGI A;  2CWU A;  1KC8 4;  1A2K A;  2XH9 A;  3FSD A;  5LC7 A;  1WMN A;  2XR8 B;  3NV0 A;  4H3U A;  1G02 A;  1STF I;  3DH2 A;  3JUN A;  3WOF B;  3S5C A;  4CJN A;  3GWR A;  3CD6 3;  1IQ8 A;  1BNE A;  1DMQ A;  1MGW A;  2PZV A;  2XGN A;  2CWT A;  7GSP A;  1OHO A;  3TDG A;  4R9L A;  2B24 B;  2WOH A;  3MWZ A;  1O7W B;  3NBR A;  2GU3 A;  1RNT A;  3QRD A;  1OHP A;  1L5G B;  1I3I A;  1UCI A;  4XB5 A;  1FUS A;  3SED A;  3UL6 A;  1CYU A;  1PYL A;  2WOF A;  4HAA A;  1OUN A;  1RGK A;  3FZW A;  3X3X A;  2ZL8 A;  1V57 A;  2BMQ B;  5KP3 A;  2P0X A;  3WR2 A;  4JRF A;  3UB1 A;  1CEW I;  3K5T A;  2QIY A;  3D3L A;  3OV4 A;  4KFE A;  3JUQ A;  2BNG A;  1TJD A;  1BVI A;  1RN7 A;  3H51 A;  5BXQ A;  5IF6 A;  1NNV A;  1AVK A;  4R1K A;  1FYS A;  3NQY A;  3PYJ A;  1NJI 4;  1C54 A;  2R41 A;  3D5G A;  1A67 A;  3AHS A;  4HJL B;  1N5P A;  5KP4 A;  3LTA A;  3CMA 3;  1BIR A;  1W6G A;  2JDI H;  3AGO A;  3F7X A;  4BTW A;  3X40 A;  3NBB A;  1RRL A;  1EUI C;  2AAD A;  2H0H A;  1FZU A;  2P0M A;  3N9H A;  1KSI A;  2HOH A;  1MOL A;  1UCL A;  2L4V A;  4RBN A;  2ZHX B;  3F14 A;  3ROB A;  3S29 A;  1QVF 2;  1GMP A;  3K9M C;  4HZ9 B;  1N8R 4;  3V98 A;  3QK9 A;  5STD A;  2F99 A;  2KCD A;  5IEP A;  2CH9 A;  2YFI B;  4LZI A;  4HM4 B;  1Q81 4;  4WFO A;  1BRI A;  3LTD A;  1FGM A;  3S28 A;  1X1Y A;  4TX4 A;  3AHW A;  1RLS A;  3PCR A;  2CIU A;  2GEY A;  4K90 B;  5AIH A;  3LH4 A;  2K54 A;  5HGR A;  4HM1 B;  1Q82 4;  1VQ4 3;  3RNT A;  1VQ5 3;  3DGM A;  2RSX A;  5AIG A;  3CME 3;  1TTO A;  3D79 A;  3D4A A;  2R4I A;  2MC8 A;  1VQK 3;  2ZDJ A;  4FR9 A;  3NM2 A;  3H3H A;  1UUW B;  1WMO A;  4K1U A;  3U1W A;  4HOH A;  3OWU A;  3Q90 A;  1DET A;  3ALA A;  4U13 A;  3MSO A;  1FGQ A;  2CKF B;  1MGR A;  2CG0 A;  3F40 A;  2XEP A;  2W03 A;  1V74 A;  3FKA A;  4K61 A;  2D1W A;  2CFD A;  3NUV A;  2CX0 A;  4N3V A;  2CG1 A;  1YJW 3;  1EEJ A;  1BNS A;  1QAK A;  3T0U A;  4R4K A;  4MJD A;  1BSC A;  5D82 A;  3WMD A;  1AVL A;  3A76 A;  1MWS A;  3EBY A;  1VQ6 3;  3JVC A;  1C7H A;  1RTU A;  1WNH A;  2KF5 A;  1AV4 A;  3SOA A;  1UUG B;  1GMR A;  1I2F A;  1EA2 A;  3O8Y A;  4FMD A;  3HI7 A;  1YVB I;  3B4P A;  2GBW B;  1CYV A;  4RNY A;  1B2Z A;  2P09 A;  1IT8 A;  6GSP A;  3HIG A;  3UL5 A;  4KT3 B;  1BNJ A;  4WYK B;  4KZ1 A;  2RCD A;  1TP6 A;  2W0Q A;  1O7M B;  3STD A;  5BVB A;  4WYK A;  2KF3 A;  1DMM A;  1LOW A;  3OWY A;  2INX A;  4HM6 B;  2W56 B;  3OXA A;  1U8C B;  1JRQ A;  2W56 A;  3N8B A;  3OX9 A;  1O7P B;  3NM7 A;  1BSD A;  3DXO A;  2K0M A;  4LYL B;  1BOX A;  3IMA B;  4CPK A;  1HKX A;  2CC3 A;  2RNT A;  1RGL A;  3D9R A;  2RBI A;  1HU9 A;  4HZB B;  3JUP A;  3T8U A;  4BL3 A;  4IPB A;  1BNG A;  1I0V A;  4K1V A;  3UNL A;  1EQK A;  2P38 A;  3ER7 A;  1AY7 A;  1OH0 A;  2HMO B;  3EQQ B;  2HMJ B;  4IIA A;  1BAO A;  4ZM8 A;  2OQE C;  1BRG A;  3N54 B;  4OVM A;  2BHM A;  4BL2 A;  1VQP 3;  3SVA A;  1BNR A;  4NHF A;  1WTH A;  1W6Y A;  1R4C A;  1EG9 B;  5JBS A;  9RNT A;  1NB5 I;  5CF2 A;  2OTJ 3;  4WP5 A;  3LT8 A;  1WQL B;  3WHO A;  1W2Z A;  4MMZ B;  1W01 A;  4GB5 A;  2J8X B;  3WOD G;  3BNE A;  2XFS A;  3Q1C A;  2Z76 A;  4CDL A;  1DYU A;  1UUV B;  5FW5 A;  4EXR A;  2OWP A;  3HK4 A;  4LMI A;  1VZZ A;  1M90 4;  4LGQ A;  1YGE A;  3NXJ A;  1T2H A;  1ULI B;  1CH0 A;  1OGX A;  1BGS A;  1OAC A;  3LYG A;  4N6T A;  2CFK A;  4XBX A;  1IV7 A;  1SAR A;  4STD A;  4FCJ A;  5AI1 A;  1W6C A;  2IYJ A;  2W6J H;  2XSO B;  4LSO A;  4MMX B;  2Y73 A;  1SIH A;  1RGG A;  1N8Q A;  1YJ9 3;  4HM5 B;  2C4B A;  3FF2 A;  1Q42 A;  2F4Y A;  4DKI A;  1UDI I;  1X1X A;  4IT7 A;  3DM8 A;  4ILF A;  3AMO A;  1ZX2 A;  5CXO A;  2OCT A;  3B7C A;  3V92 A;  3G6E 3;  1SQW A;  4XBT A;  1BNI A;  1EKM A;  4HBR A;  4O3V A;  1VQQ A;  5IG0 A;  1LXE A;  3EC9 A;  2UUG C;  1W02 A;  2Y74 A;  3G8Z A;  4GSP A;  4J9A A;  3SOY A;  1VQ9 3;  2O9U X;  3G0K A;  1I8V A;  4N6U A;  3G4S 3;  3EBT A;  1IYY A;  3F8X A;  2SBL A;  5IG5 A;  1LNI A;  1BU4 A;  3SXX A;  2BU4 A;  4HYZ A;  1GOY A;  1SII A;  3NQZ A;  2CFW A;  3SYU A;  2IY2 A;  1IU7 A;  1G0T A;  2KF4 A;  4RNZ A;  1RRH A;  1BRH A;  4I5Q A;  3ZFZ A;  3DGN A;  5DRV A;  1YIJ 3;  4RZM A;  4EYC A;  1LQM B;  3KKG A;  3KN4 A;  1NO3 A;  4OUQ A;  3Q2P A;  5EVH A;  1IT7 A;  1GD4 A;  1Z1S A;  1YGW A;  3HOH A;  2BO9 B;  3LXU X;  3URP A;  1RDS A;  5TGN A;  4X2H A;  1AR0 A;  1CQS A;  4I4K A;  2ML5 A;  3MG3 A;  1TU5 A;  1IQX A;  4WHA A;  1E97 A;  2K3D A;  3MYT A;  3CCV 3;  1K28 A;  3KE7 A;  4AKY A;  1VQN 3;  1B27 A;  1BUJ A;  3EN8 A;  4GL6 A;  1VQL 3;  2F56 A;  3ZG0 A;  4EBG A;  2KAA A;  3HX8 A;  2F5M A;  5IER A;  2E2U A;  5AIF A;  3M8C A;  1QAF A;  3IPT A;  3MHE A;  1MWU A;  1JN5 A;  1JV2 B;  1RN1 A;  1B2S A;  1ROV A;  1M1X B;  1I0X A;  2IUK A;  3GRD A;  1UCJ A;  3HII A;  3PZW A;  1RN4 A;  5IEO A;  2CFG A;  1KQS 2;  1F8N A;  4FMC A;  2JQ5 A;  3FG3 A;  5LC6 A;  3G16 A;  2CWV A;  2QGU A;  1RGF A;  3NX0 A;  1Q9E A;  4NRE A;  8CHO A;  2CHC A;  4BTY A;  1AQZ A;  4N6M A;  1RKY A;  1SPU A;  2OQE A;  1V58 A;  1T2I A;  2V1L A;  1JZD A;  1MWR A;  1GYB A;  3FG1 A;  2CK3 H;  3T8N A;  2XGL A;  3DGO A;  1GY5 A;  3I0Y A;  5ELJ A;  1Q86 4;  3WA2 X;  4EV5 A;  4N6O B;  3I56 3;  3G71 3;  2UGI A;  5M1A A;  1Q40 B;  1JB5 A;  2W2C A;  3KII A;  4FMB A;  4EC6 A;  2GBX B;  1NU3 A;  1JNQ A;  1MNL A;  1Q40 A;  1S72 3;  4WWU C;  3LML A;  4XBY A;  2OOV A;  2H0G A;  3I55 3;  1GS3 A;  1OHS A;  3X41 A;  1IVU A;  5EEO A;  4NPB A;  1PU4 A;  3FCS B;  2RGQ A;  4EW5 A;  1B2X A;  1QAL A;  3OWS A;  3BIR A;  3F7S A;  3KSP A;  3U97 A;  5BU4 A;  1M1K 4;  3EB8 A;  2CX1 A;  1ISK A;  4MMY B;  3CCU 3;  3EN1 B;  1I3F A;  1R4Y A;  1IDP A;  1W2B 2;  3AGN A;  3PS8 A;  4J5G A;  2FNQ A;  2BMR B;  4BU4 A;  4HM0 B;  1PY3 A;  5G2G A;  5I97 A;  4L7K A;  3CPW 2;  1GY6 A;  3SLU A;  3RGA A;  2M7O A;  3PGB A;  1DMN A;  1NDO B;  1VQO 3;  2FXT A;  2IA7 A;  1X1U A;  1YJN 3;  1ULJ B;  2PNC A;  3NBJ A;  1JKG A;  1RCK A;  1US1 A;  2P05 A;  1FGR A;  3K0Z A;  3NHX A;  1D6U A;  1A2P A;  1NWW A;  1TIJ A;  2YX9 A;  3F8H A;  1STD A;  2SAR A;  1LQG C;  3L0R A;  1JBS A;  3CC4 3;  1BUQ A;  3GZX B;  1LRA A;  3DUK A;  5D83 A;  2CW9 A;  2OOV C;  1IK3 A;  1DVC A;  1GOV A;  5G1L A;  5A0O B;  1IVW A;  3SX1 A;  3EX9 A;  1GD3 A;  2WGQ A;  1FUW A;  5DRE A;  3CCQ 3;  2D42 A;  4XDV A;  3FH1 A;  1S5A A;  8RNT A;  4KVH A;  3CCR 3;  1IVX A;  1K8A 4;  3BND A;  1FGO A;  7STD A;  1B2U A;  3DMC A;  4HM7 B;  1LOV A;  3BB9 A;  1ASK A;  4BTX A;  1GSP A;  3AMO B;  5AYS C;  1JB4 A;  3LZA A;  2HMN B;  1RGH A;  3E99 A;  4FCZ A;  3K7C A;  1E3R A;  2HML B;  1UGH I;  2F86 B;  1WMP A;  3MG2 A;  4XM4 A;  1LNH A;  3BU4 A;  1GMQ A;  5EQL A;  2AAE A;  3KFQ C;  2MF7 A;  1IV9 A;  4CCV A;  1VQ7 3;  4MEI A;  4ORL A;  1LVN A;  1LOX A;  2GU1 A;  4O2H A;  1B2M A;  4X2O A;  4EV2 A;  3MG1 A;  5GSP A;  1UI8 A;  2W9Q A;  4G1M B;  5IW9 A;  1JBR A;  1Q7H A;  2LYX A;  5AII A;  3V99 A;  2YFL B;  3FG4 A;  2FGT A;  1OGZ A;  1IVV A;  1ZGX A;  4Q53 A;  1HYF A;  3EHC A;  3PXM A;  5G1K A;  2C10 A;  4BIR A;  1BNF A;  3CCE 3;  4LEH A;  2QEX 3;  3X3Z A;  1RNB A;  3LTB A;  1RGA A;  3CCL 3;  3LT9 A;  1RCL A;  2W04 A;  4HKV B;  1PFP A;  1W5Z A;  2XSH B;  3IJE B;  2W9P A;  5AYR B;  2IUJ A;  1T3B A;  1JB2 A;  1K9M 4;  2UX0 A;  2BIR A;  4JF8 A;  2RFR A;  4RNT A;  3ZG5 A;  3OW2 2;  1J2B A;  1N9J A;  3KSE D;  5BIR A;  1Y4K A;  3DGL A;  4HM3 B;  4KFD A;  1TUH A;  4H61 A;  5IEN A;  1HZ1 A;  5RNT A;  4L8O A;  2BT3 A;  3BNB A;  3FF0 A;  4QWT A;  2STD A;  1N5H A;  2E2V A;  4HM2 B;  4L8P A;  1RHL A;  3A5E A;  3RGR A;  1VQ8 3;  1SJW A;  1RGC A;  5ELU A;  1I2E A;  1G96 A;  1JBT A;  2BMO B;  1RMS A;  4PEJ A;  2Z77 A;  1OPY A;  2E2T A;  3GZR A;  3S27 A;  3JUM A;  3WDG B;  1D6Z A;  3CC7 3;  1D6Y A;  1W7C A;  3CCM 3;  5JPU A;  1FW7 A;  6RNT A;  1Q7Y 4;  1TRP A;  1TFO A;  1GOU A;  1YNV X;  4AEQ A;  5KP1 A;  2XRX B;  1JN5 B;  3ECF A;  3CNM A;  4R80 A;  4O02 B;  3S67 A;  3KZT A;  2XF3 A;  1I70 A;  1MWT A;  2HMM B;  2YFJ B;  5CF1 A;  1FA3 A;  1RSN A;  3GZB A;  1W00 A;  5JPP A;  3PCS A;  3VF1 A;  2Z6B A;  3Q3F A;  1QMA A;  3VSY A;  1BRN L;  1OCV A;  1KWI A;  2H0I A;  3MPH A;  5D81 A;  1BAN A;  1B21 A;  4HVN A;  4FCM A;  4R9K A;  2C11 A;  3BLZ A;  2CFL A;  3GAX A;  1A90 A;  4N6N B;  1ZS7 A;  3LTC A;  5IG3 A;  1NB3 I;  1O7N B;  5AEW B;  5IG4 A;  7RNT A;  2F98 A;  1UI7 A;  1FUT A;  2Z7A A;  3X3Y A;  1UW1 A;  4OK0 A;  1U5O A;  3JUO A;  1FGT A;  1BRK A;  4J5K A;  1RGE A;  2LQV A;  2WGO A;  4AKZ A;  5AEU B;  1IQY A;  3EF8 A;  1W4N A;  4HM8 B;  4KFF A;  1BSE A;  2IMJ A;  1VQM 3;  1ROA A;  3HZP A;  1B20 A;  1BRJ A;  3KCH A;  4O8S A;  2O3O A;  3CNX A;  2B1X B;  6STD A;  3WA3 A;  1YHQ 3;  2QA4 3;  5CK6 A;  3FGY A;  1QJG A;  1K41 A;  1JZO A;  2GSP A;  1O7G B;  2I9W A;  3B4O A;  1T5Y A;  1OF5 B;  4XDW A;  5FGO A;  1N9E A;  3RDE A;  2OTL 3;  1LOY A;  1OF5 A;  1BRS A;  3GSP A;  3DGY A;  3K63 A;  3F9S A; 
#chains in the Genus database with same CATH homology
 1GY7 A;  3BNC A;  1E3V A;  4J8T A;  3FLJ A;  1YIT 3;  1YI2 3;  2WO0 A;  2XFT A;  3MKI A;  3B8L A;  2GXF A;  2KRT A;  2KXG A;  3CCS 3;  1O7H B;  2Q07 A;  5CLK A;  3GZY B;  3CXC 2;  2A15 A;  3UJM A;  3CPO A;  1K73 4;  1A2V A;  3WOE B;  1ZO2 A;  3EE1 A;  1JJ2 2;  1JKG B;  3CC2 3;  1TFK A;  4FMA A;  2ML6 A;  3DZL A;  3LOY A;  3DY5 A;  4N6V 0;  1QVG 2;  3VGN A;  4N6L A;  3CU3 A;  3CCJ 3;  1KD1 4;  1DVD A;  2GEX A;  2HMK B;  3EJV A;  3J7Y d;  1M9G A;  1RJO A;  3NV0 B;  3X42 A;  1KC8 4;  2CWU A;  1A2K A;  2XH9 A;  3FSD A;  5LC7 A;  1WMN A;  2XR8 B;  3NV0 A;  4H3U A;  1STF I;  3WOF B;  3JUN A;  3S5C A;  3GWR A;  3CD6 3;  1IQ8 A;  1DMQ A;  2XGN A;  2PZV A;  2CWT A;  1OHO A;  3TDG A;  4R9L A;  2B24 B;  2WOH A;  3MWZ A;  1O7W B;  3NBR A;  2GU3 A;  3QRD A;  1OHP A;  1L5G B;  4XB5 A;  3SED A;  3UL6 A;  1CYU A;  2WOF A;  1OUN A;  3X3X A;  3FZW A;  2ZL8 A;  2BMQ B;  5KP3 A;  2P0X A;  4JRF A;  3UB1 A;  1CEW I;  3K5T A;  2QIY A;  3D3L A;  3OV4 A;  3JUQ A;  2BNG A;  1RN7 A;  3H51 A;  5BXQ A;  5IF6 A;  1AVK A;  4R1K A;  3NQY A;  3PYJ A;  1NJI 4;  1A67 A;  4HJL B;  1N5P A;  5KP4 A;  3LTA A;  3CMA 3;  1W6G A;  2JDI H;  3F7X A;  4BTW A;  3X40 A;  3NBB A;  1RRL A;  2P0M A;  3N9H A;  1KSI A;  1MOL A;  4RBN A;  2L4V A;  3ROB A;  3F14 A;  3S29 A;  1QVF 2;  4HZ9 B;  3K9M C;  1N8R 4;  3V98 A;  3QK9 A;  5STD A;  2F99 A;  2KCD A;  5IEP A;  2CH9 A;  2YFI B;  4LZI A;  4HM4 B;  1Q81 4;  4WFO A;  3LTD A;  1FGM A;  3S28 A;  4TX4 A;  3PCR A;  2CIU A;  2GEY A;  4K90 B;  5AIH A;  3LH4 A;  2K54 A;  5HGR A;  4HM1 B;  1Q82 4;  1VQ4 3;  1VQ5 3;  3DGM A;  2RSX A;  5AIG A;  3CME 3;  2R4I A;  2MC8 A;  1VQK 3;  2ZDJ A;  4FR9 A;  3NM2 A;  3H3H A;  1UUW B;  1WMO A;  4K1U A;  3U1W A;  3OWU A;  3Q90 A;  3ALA A;  4U13 A;  3MSO A;  1FGQ A;  2CKF B;  2CG0 A;  3F40 A;  2XEP A;  2W03 A;  1V74 A;  3FKA A;  4K61 A;  2D1W A;  2CFD A;  3NUV A;  4N3V A;  2CG1 A;  1YJW 3;  3T0U A;  1QAK A;  4R4K A;  4MJD A;  5D82 A;  3WMD A;  1AVL A;  3A76 A;  1VQ6 3;  3EBY A;  3JVC A;  1C7H A;  1WNH A;  1AV4 A;  3SOA A;  1EA2 A;  3O8Y A;  4FMD A;  3HI7 A;  1YVB I;  3B4P A;  2GBW B;  1CYV A;  4RNY A;  2P09 A;  1IT8 A;  3HIG A;  4WYK B;  4KZ1 A;  2RCD A;  1TP6 A;  2W0Q A;  1O7M B;  3STD A;  5BVB A;  4WYK A;  1DMM A;  3OWY A;  2INX A;  4HM6 B;  2W56 B;  3OXA A;  1U8C B;  1JRQ A;  2W56 A;  3N8B A;  3OX9 A;  1O7P B;  3NM7 A;  3DXO A;  2K0M A;  3IMA B;  1HKX A;  2CC3 A;  3D9R A;  4HZB B;  1HU9 A;  3T8U A;  3JUP A;  4IPB A;  4K1V A;  3UNL A;  1EQK A;  2P38 A;  3ER7 A;  1OH0 A;  2HMO B;  3EQQ B;  2HMJ B;  4IIA A;  4ZM8 A;  2OQE C;  3N54 B;  4OVM A;  2BHM A;  1VQP 3;  3SVA A;  4NHF A;  1WTH A;  1W6Y A;  1R4C A;  1EG9 B;  5JBS A;  1NB5 I;  5CF2 A;  2OTJ 3;  4WP5 A;  3LT8 A;  1WQL B;  1W2Z A;  4MMZ B;  1W01 A;  4GB5 A;  3WOD G;  3BNE A;  2XFS A;  3Q1C A;  2Z76 A;  4CDL A;  1DYU A;  1UUV B;  5FW5 A;  4EXR A;  2OWP A;  3HK4 A;  4LMI A;  1VZZ A;  1M90 4;  4LGQ A;  1YGE A;  3NXJ A;  1ULI B;  3LYG A;  1OGX A;  1OAC A;  4N6T A;  2CFK A;  4XBX A;  1IV7 A;  4STD A;  4FCJ A;  5AI1 A;  1W6C A;  2XSO B;  2W6J H;  4LSO A;  4MMX B;  2Y73 A;  1SIH A;  1N8Q A;  1YJ9 3;  4HM5 B;  3FF2 A;  1Q42 A;  4IT7 A;  3DM8 A;  3AMO A;  1ZX2 A;  5CXO A;  2OCT A;  3B7C A;  3V92 A;  3G6E 3;  1SQW A;  4XBT A;  1EKM A;  4HBR A;  4O3V A;  5IG0 A;  1LXE A;  3EC9 A;  2Y74 A;  1W02 A;  3G8Z A;  4J9A A;  1VQ9 3;  3SOY A;  2O9U X;  3G0K A;  4N6U A;  3G4S 3;  3EBT A;  3F8X A;  2SBL A;  5IG5 A;  3SXX A;  4HYZ A;  1SII A;  3NQZ A;  2CFW A;  1IU7 A;  4RNZ A;  1RRH A;  3DGN A;  5DRV A;  1YIJ 3;  4RZM A;  4EYC A;  3KKG A;  3KN4 A;  1NO3 A;  4OUQ A;  3Q2P A;  5EVH A;  1IT7 A;  1GD4 A;  1Z1S A;  2BO9 B;  3LXU X;  5TGN A;  4X2H A;  1AR0 A;  1CQS A;  4I4K A;  2ML5 A;  3MG3 A;  1TU5 A;  1IQX A;  4WHA A;  1E97 A;  3MYT A;  3CCV 3;  1K28 A;  3KE7 A;  4AKY A;  1VQN 3;  3EN8 A;  4GL6 A;  1VQL 3;  4EBG A;  3HX8 A;  5IER A;  2E2U A;  3M8C A;  1QAF A;  3IPT A;  3MHE A;  1JN5 A;  1JV2 B;  1ROV A;  3GRD A;  4KFE A;  1M1X B;  2IUK A;  3HII A;  3PZW A;  5AIF A;  5IEO A;  3UL5 A;  2CFG A;  1KQS 2;  1F8N A;  4FMC A;  2JQ5 A;  3FG3 A;  5LC6 A;  3G16 A;  2CWV A;  2QGU A;  3NX0 A;  4NRE A;  8CHO A;  2CHC A;  4BTY A;  4N6M A;  1RKY A;  1SPU A;  2OQE A;  2V1L A;  1GYB A;  3FG1 A;  2CK3 H;  3T8N A;  2XGL A;  3DGO A;  1GY5 A;  3I0Y A;  5ELJ A;  1Q86 4;  3WA2 X;  4EV5 A;  4N6O B;  3I56 3;  3G71 3;  1Q40 B;  1JB5 A;  2W2C A;  3KII A;  4FMB A;  4EC6 A;  2GBX B;  1NU3 A;  1JNQ A;  1MNL A;  1Q40 A;  1S72 3;  4WWU C;  3LML A;  4XBY A;  2OOV A;  3I55 3;  1GS3 A;  1OHS A;  3X41 A;  1IVU A;  5EEO A;  1PU4 A;  3FCS B;  2RGQ A;  1QAL A;  3OWS A;  1M1K 4;  3F7S A;  3KSP A;  3U97 A;  3EB8 A;  1ISK A;  4MMY B;  3CCU 3;  3EN1 B;  1IDP A;  1W2B 2;  3PS8 A;  2FNQ A;  2BMR B;  5I97 A;  4HM0 B;  3CPW 2;  5G2G A;  4L7K A;  1GY6 A;  3SLU A;  3RGA A;  2M7O A;  3PGB A;  1DMN A;  1NDO B;  1VQO 3;  2FXT A;  2IA7 A;  1YJN 3;  1ULJ B;  2PNC A;  3NBJ A;  1JKG A;  1US1 A;  2P05 A;  1FGR A;  3K0Z A;  3NHX A;  1D6U A;  3F8H A;  1NWW A;  1TIJ A;  2YX9 A;  3CC4 3;  1STD A;  1BUQ A;  3L0R A;  3GZX B;  3DUK A;  5D83 A;  2OOV C;  2CW9 A;  1IK3 A;  1DVC A;  5A0O B;  1IVW A;  3SX1 A;  3EX9 A;  1GD3 A;  2WGQ A;  1FUW A;  5DRE A;  3CCQ 3;  2D42 A;  4XDV A;  3FH1 A;  1S5A A;  4KVH A;  3CCR 3;  1IVX A;  1K8A 4;  3BND A;  1FGO A;  7STD A;  3DMC A;  4HM7 B;  3BB9 A;  1ASK A;  4BTX A;  3AMO B;  5AYS C;  1JB4 A;  3LZA A;  2HMN B;  3E99 A;  4FCZ A;  3K7C A;  1E3R A;  2HML B;  2F86 B;  3MG2 A;  1WMP A;  4XM4 A;  1LNH A;  5EQL A;  3KFQ C;  2MF7 A;  1IV9 A;  4CCV A;  1VQ7 3;  4MEI A;  4ORL A;  1LVN A;  1LOX A;  2GU1 A;  4O2H A;  4X2O A;  4EV2 A;  3MG1 A;  1UI8 A;  2W9Q A;  4G1M B;  5IW9 A;  2LYX A;  5AII A;  3V99 A;  2YFL B;  3FG4 A;  2FGT A;  1OGZ A;  1IVV A;  4Q53 A;  3EHC A;  3PXM A;  2C10 A;  3CCE 3;  4LEH A;  2QEX 3;  3X3Z A;  3LTB A;  3CCL 3;  3LT9 A;  2W04 A;  4HKV B;  1PFP A;  1W5Z A;  2XSH B;  3IJE B;  2W9P A;  5AYR B;  2IUJ A;  1JB2 A;  1K9M 4;  2UX0 A;  4JF8 A;  2RFR A;  3OW2 2;  1J2B A;  1N9J A;  3KSE D;  1Y4K A;  3DGL A;  4HM3 B;  4KFD A;  1TUH A;  4H61 A;  5IEN A;  4L8O A;  2BT3 A;  3BNB A;  3FF0 A;  4QWT A;  2STD A;  1N5H A;  2E2V A;  4HM2 B;  4L8P A;  3RGR A;  1VQ8 3;  1SJW A;  5ELU A;  1G96 A;  2BMO B;  4PEJ A;  2Z77 A;  1OPY A;  2E2T A;  3GZR A;  3S27 A;  3JUM A;  3WDG B;  1D6Z A;  3CC7 3;  1D6Y A;  1W7C A;  3CCM 3;  5JPU A;  1Q7Y 4;  1TFO A;  4AEQ A;  5KP1 A;  2XRX B;  1JN5 B;  3ECF A;  3CNM A;  4R80 A;  4O02 B;  3S67 A;  3KZT A;  2XF3 A;  2HMM B;  2YFJ B;  1FA3 A;  5CF1 A;  3GZB A;  5JPP A;  1W00 A;  3PCS A;  3VF1 A;  2Z6B A;  1QMA A;  3VSY A;  1OCV A;  1KWI A;  3MPH A;  5D81 A;  4HVN A;  4FCM A;  4R9K A;  2C11 A;  3BLZ A;  2CFL A;  3GAX A;  1A90 A;  4N6N B;  3LTC A;  5IG3 A;  1NB3 I;  1O7N B;  5AEW B;  5IG4 A;  2F98 A;  1UI7 A;  2Z7A A;  3X3Y A;  1UW1 A;  4OK0 A;  1U5O A;  3JUO A;  1FGT A;  4AKZ A;  2LQV A;  2WGO A;  5AEU B;  1IQY A;  3EF8 A;  1W4N A;  4HM8 B;  4KFF A;  2IMJ A;  1VQM 3;  1ROA A;  3HZP A;  4O8S A;  2O3O A;  3CNX A;  2B1X B;  6STD A;  3WA3 A;  1YHQ 3;  2QA4 3;  5CK6 A;  3FGY A;  1QJG A;  1K41 A;  2I9W A;  1O7G B;  3B4O A;  1T5Y A;  1OF5 B;  4XDW A;  5FGO A;  1N9E A;  3RDE A;  2OTL 3;  1OF5 A;  3K63 A;  3F9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...