3KCHA

Baranase crosslinked by glutaraldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Revisiting glutaraldehyde cross-linking: the case of the Arg-Lys intermolecular doublet
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3kchA00
2C4BA 1A2PA 5RNTA 1BSCA 1LNIA 1RMSA 1BU4A 1I0VA 1PYLA 3A5EA 1BRSA 1LRAA 1B2MA 1BRHA 3BIRA 1TRPA 1I2FA 1FW7A 1RLSA 1HZ1A 1B2XA 1G02A 6GSPA 1BNRA 1I2EA 3HOHA 1B2SA 1RGCA 1LOYA 2F56A 1LOVA 1BRJA 3SYUA 3RNTA 1BRGA 1RCKA 1PY3A 1FYSA 1BNGA 1RGGA 1IYYA 4BU4A 1B21A 1JBRA 1BRNL 3AHWA 4BIRA 3AHSA 1FUSA 2KF6A 1JBTA 1AY7A 1GOYA 1RGKA 1GMRA 1BRIA 1UCJA 1YVSA 1B2UA 2F4YA 3AGOA 2F5MA 1I3IA 4GSPA 1Q9EA 1UCLA 1FZUA 1RTUA 2KAAA 1BRKA 1FUTA 3URPA 1I3FA 1AQZA 5BU4A 8RNTA 1BSEA 1R4YA 1MGWA 1I2GA 3DGYA 1X1WA 3BU4A 1YGWA 1DETA 1ZGXA 2HOHA 1GSPA 7RNTA 1B27A 4J5GA 3KCHA 1X1XA 1BNFA 4HOHA 2BIRA 4J5KA 1B20A 1JBSA 3Q3FA 1I70A 1YNVX 1RGFA 1BGSA 5HOHA 1BIRA 1CH0A 1I0XA 1B3SA 5GSPA 3WR2A 1BSDA 1GOUA 1TRQA 1RNBA 2SARA 3WHOA 1RGEA 4RNTA 1RN4A 1BUJA 2AADA 3AGNA 1BAOA 1RSNA 1MGRA 1RHLA 1SARA 1I8VA 1HYFA 1UCKA 2AAEA 9RNTA 1GMQA 1GMPA 1T2HA 2RNTA 3D5GA 1BSBA 3D4AA 1RCLA 1RNTA 1RDSA 1UCIA 1X1YA 2KF4A 7GSPA 1BSAA 2ZA4A 2BU4A 1RN1A 5BIRA 2RBIA 3DH2A 1X1UA 4GHOA 1BNSA 1BNIA 2F5WA 1GOVA 1B2ZA 6RNTA 1RGHA 1T2IA 1BOXA 2KF5A 1BNJA 1C54A 3GSPA 1RGLA 3D5IA 2KF3A 1LOWA 1BANA 1TTOA 1DE3A 2GSPA 1RGAA 4HAAA 1BVIA 1BNEA
chains in the Genus database with same CATH superfamily
1F8NA 1ROAA 1AR0A 3DGMA 3PCRA 2P05A 1PYLA 1N8QA 1W02A 1BRSA 1LRAA 2W6JH 1B2MA 2OQEA 2FNQA 3BIRA 4K90B 5ELUA 2Z7AA 2W04A 1HZ1A 4LGQA 2MC8A 1AV4A 1G02A 1GY5A 2P09A 1ROVA 1I2EA 2L4VA 5AIGA 3HOHA 4EXRA 1QAFA 1EUIC 4O2HA 1DMMA 1LVNA 3PYJA 4MJDA 4KT3B 2PZVA 3MSOA 2CWVA 1LOVA 3F7XA 1BRJA 4HM8B 4K1UA 5ELJA 1BRGA 1RCKA 1YHQ3 1Q824 3JUOA 1BNGA 3MHEA 1JBRA 3SOYA 1CQSA 1YGEA 3JUNA 5JBSA 1IVVA 2FGTA 2L1SA 3G0KA 1JBTA 1CEWI 4OUQA 1GOYA 1UCJA 3CD63 1B2UA 3NV0A 3BB9A 1N8R4 3AGOA 2F5MA 1I3IA 3EX9A 1JRQA 4GSPA 3RGAA 3KSED 2W56A 2CG1A 1W4NA 2KAAA 2HMKB 3B4PA 3OXAA 3ECFA 1FUTA 4FCMA 2YFJB 1AQZA 8RNTA 1R4YA 3JUQA 1HU9A 1IT8A 4N6TA 3MG3A 4O8SA 1K41A 3UJMA 4MEIA 3FG4A 5M19A 1KQS2 2CWUA 3GZXB 4GL6A 1ZGXA 5A0OB 4XBXA 1Q7HA 2XH9A 4HKVB 4HOHA 1BNFA 3CCR3 1B20A 1EA2A 1JBSA 3Q3FA 5DREA 3CCV3 4N6UA 4DKIA 1K734 1W01A 2GEXA 1US1A 3FKAA 1IK3A 1BGSA 1UDII 3SVAA 2OOVC 3CCM3 1B3SA 5CF1A 3NQZA 3SX1A 3WR2A 3JUPA 3HK4A 3D79A 4N6V0 4X2HA 3T0UA 4AEQA 1A67A 1SPUA 4RNTA 4KVHA 1QVG2 3N9HA 3ZG5A 3CC73 3FCSB 2CH9A 1BUJA 4WWUC 1E97A 4EV2A 1BAOA 1MGRA 3DZLA 3HZPA 1JB5A 1HKXA 2WOHA 2CX1A 2GEYA 1O7GB 3FLJA 4Q53A 1ZS7A 5G1LA 2XRXB 2AAEA 3DGNA 5BVBA 1GMQA 5FW5A 1T2HA 3D5GA 5IENA 2GU1A 3EBTA 3JUMA 1OF5B 2C10A 1BSBA 5JPUA 1JV2B 1IVUA 1UI7A 1RDSA 4NHFA 2BMOB 7GSPA 1BSAA 5FGOA 2P0MA 1YIT3 2BMRB 5BIRA 2RBIA 4GHOA 1MWSA 1X1UA 1BNSA 4I4KA 3UB1A 2RFRA 2F5WA 2STDA 1IVWA 4HJLB 2B1XB 3H3HA 1CYVA 2J8XB 3OWYA 5IG0A 4HM3B 1VQN3 5AYSC 1C54A 3NBBA 4L7KA 2OOVA 2UUGC 4FMCA 2W0QA 1RGLA 3D5IA 4HZ9B 2IMJA 1Y4KA 2KF3A 1ZO2A 1WMPA 3LXUX 1BANA 3EC9A 3EN8A 2Z76A 1STFI 3LOYA 3V98A 4O3VA 1IV9A 1OH0A 2R41A 1RRHA 4H3UA 3LYGA 1NNVA 1A2PA 1BSCA 2WO0A 1LNIA 1BU4A 4XBTA 3NQYA 1KWIA 1I2FA 1Q40B 1AVLA 1RLSA 1VQL3 1FW7A 5G2GA 1VZZA 2BMQB 4ORLA 3LTAA 2UX0A 4R9LA 4HZBB 1OGZA 1JN5A 4QWTA 2D1WA 5CK6A 5DRVA 3CME3 4K61A 1V58A 2CFWA 1WMNA 2F56A 3KIIA 3PGBA 3LTCA 1VQ93 3EQQB 4N6MA 3RNTA 1PY3A 3S27A 1TIJA 2IY2A 1IYYA 2BHMA 3HX8A 1FA3A 3NM7A 1QMAA 1U8CB 3U1WA 4BIRA 4BTWA 4EV5A 3LT8A 2C11A 3WOFB 1TU5A 1FUSA 2KF6A 1NU3A 1EEJA 3X40A 3DXOA 3CPOA 3GZRA 1RGKA 1GMRA 2W56B 1YVSA 1N5PA 2F4YA 4IT7A 4WYKA 1FGRA 1QALA 2E2UA 3M8CA 3X3XA 3K7CA 1BRKA 2O3OA 3GZBA 1OHSA 3U97A 5M1AA 1C7HA 4BTYA 4BTXA 1VQ53 1Q40A 2P38A 5CXOA 2MF7A 5D81A 2W2CA 2ZHXB 1YGWA 3CCE3 3D3LA 2HOHA 2CW9A 2E2TA 1T5YA 1V57A 2LYXA 2HMJB 2PNCA 3IPTA 3PS8A 1X1XA 1FUWA 4J5KA 1Q814 3F8HA 3OW22 2IYJA 5AIHA 3LMLA 2YFIB 3CCL3 1RJOA 2A15A 1O7PB 1YJ93 1E3VA 2ML5A 1BIRA 2YX9A 3A76A 1CH0A 3Q1CA 1I0XA 1V74A 1RKYA 1N9EA 4HM2B 1GOUA 2F86B 2E2VA 4N3VA 2QGUA 2K0MA 3V99A 3PZWA 3CNXA 1RNBA 5D82A 2SARA 1RGEA 5IF6A 3IJEB 4OVMA 3DGLA 2WGOA 2AADA 3J7Yd 3AGNA 3B8LA 3MYTA 3KN4A 1FGMA 2CG0A 1DVDA 1N5HA 5EVHA 3SEDA 3TDGA 1UUWB 3K5TA 1I8VA 3WA2X 3EBYA 1UCKA 2CFDA 1STDA 3RDEA 3CU3A 4NPBA 1GMPA 2RNTA 4K1VA 3D4AA 3X3YA 1VQK3 1RNTA 2V1LA 1UGIA 2Y74A 4XDVA 1OPYA 4JRFA 1X1YA 2Q07A 1JB2A 5IG3A 2ZA4A 5EQLA 2BU4A 3HIIA 4IPBA 2IA7A 3LH4A 3FG3A 3STDA 1RN1A 3GWRA 3F40A 1EKMA 3SLUA 2OCTA 1QJGA 2ZDJA 4BL2A 1KD14 3ALAA 5LC6A 1D6ZA 2K3DA 2B24B 4XDWA 1FGTA 2CHCA 2XEPA 5IERA 1T2IA 2M7OA 3WODG 2KF5A 3E99A 1BNJA 4N6LA 3G713 1YJW3 2Y73A 3EN1B 5AEWB 1UUGB 2R4IA 4ZM8A 1IQXA 3CCU3 3S29A 1TP6A 3DM8A 3QRDA 4KFFA 4J9AA 3ROBA 3V92A 3N54B 3Q90A 1LOWA 1TTOA 2QEX3 1W2B2 2OTJ3 1DE3A 4X2OA 1O7MB 4LEHA 3Q2PA 3NX0A 4HM0B 4RBNA 1IU7A 5IEPA 1S723 2CX0A 3FF2A 3IMAB 5RNTA 2K54A 3LTDA 1W2ZA 1SIHA 3A5EA 1FGOA 3OWSA 2ZL8A 4HM4B 2SBLA 1LOXA 4XBYA 1TRPA 3OX9A 2CFLA 1VQO3 1WTHA 2BT3A 1JN5B 3MWZA 6GSPA 5AIIA 1G0TA 1BNRA 1A90A 1IDPA 1Z1SA 2I9WA 1YJN3 1UI8A 3EJVA 4AKYA 3ER7A 1RGCA 5IEOA 5LC7A 7STDA 4L8PA 3NBRA 1ZX2A 3SYUA 4ILFA 1OUNA 1D6YA 5G1KA 3G16A 3DGOA 3EE1A 1RGGA 2XSHB 2XR8B 5IG4A 4BU4A 1B21A 3CCQ3 1YI23 2OTL3 1BRNL 5I97A 3OV4A 3AHWA 4WYKB 4RNYA 4MMXB 3S67A 2IUJA 1W6YA 1QAKA 1M9GA 2W9QA 1IQYA 3GAXA 5IG5A 2HMLB 3VGNA 4EBGA 1UCLA 2O9UX 4KFEA 4WFOA 4EW5A 1NB5I 1ULIB 1S5AA 5BU4A 3MG1A 4H61A 1BSEA 3D9RA 1MGWA 3AMOB 1I2GA 3DGYA 3K9MC 1PU4A 1X1WA 1UW1A 2FXTA 1EG9B 3KKGA 1SQWA 1KSIA 1VQ73 4RZMA 1Q864 1GSPA 3BNCA 1Q42A 1B27A 2W9PA 1PFPA 3KCHA 3RGRA 2QA43 3MG2A 2Z6BA 4PEJA 1SJWA 1WMOA 1N9JA 4HBRA 1YNVX 1JKGB 1RGFA 3GRDA 3WDGB 3NUVA 4AKZA 3CCJ3 2CKFB 1TRQA 1O7HB 1IV7A 2W03A 1DVCA 4N6NB 4LSOA 1RN4A 2H0GA 1TFOA 3S28A 1KC84 3BNEA 4CDLA 1GD3A 2P0XA 1Q7Y4 3BNBA 3LZAA 2XGNA 4FMAA 1K8A4 1HYFA 3AMOA 3OWUA 2CK3H 1O7WB 3EB8A 4G1MB 4XB5A 1OGXA 3QK9A 1RRLA 1UCIA 5AYRB 2KF4A 8CHOA 2CFKA 1DMNA 1NB3I 1K9M4 4WP5A 3WOEB 1YVBI 3DH2A 5BXQA 2WGQA 1BNIA 1W5ZA 1JKGA 4L8OA 3WA3A 1B2ZA 1K28A 3DUKA 4FCJA 1UUVB 2XF3A 4R9KA 4WHAA 3ZG0A 4HM5B 4R80A 1W00A 1IT7A 1OCVA 4J8TA 5STDA 3ZFZA 3CNMA 2CWTA 4FMDA 1A2VA 4R1KA 1TUHA 4U13A 3UNLA 1DYUA 4HYZA 1EQKA 4HM7B 2GSPA 3MKIA 3FG1A 1O7NB 2KXGA 2QIYA 1BVIA 3NM2A 3PCSA 2C4BA 2HMOB 1J2BA 4TX4A 5D83A 3K0ZA 5AEUB 1RMSA 1I0VA 1BRHA 2HMNB 1M1XB 2F99A 2XFTA 4FR9A 3WMDA 1M1K4 1RN7A 1JZDA 2RCDA 1B2XA 1NWWA 2OWPA 1MNLA 3I553 2GXFA 1TFKA 1ISKA 1B2SA 1GY6A 3MPHA 3O8YA 2F98A 4HVNA 4O02B 1VQ83 4JF8A 3CCS3 1W7CA 4NREA 1LOYA 1OHOA 3NXJA 3CC23 3G4S3 1ASKA 1DMQA 3EHCA 1QVF2 3FZWA 3KFQC 1LQGC 1FYSA 1VQP3 2IUKA 3KZTA 3NBJA 5KP1A 1W6CA 3SOAA 1MWUA 2HMMB 3F7SA 2GBXB 3AHSA 1G96A 1AY7A 3X41A 1AVKA 1VQ63 4FCZA 2KRTA 1BRIA 2CC3A 1LXEA 1Q9EA 3UL5A 3CMA3 1FZUA 1M904 1RTUA 1MOLA 1SIIA 3F14A 1OHPA 2WOFA 1R4CA 3FSDA 4BL3A 3BLZA 1LQMB 2UGIA 3KE7A 1I3FA 1UGHI 1WQLB 3URPA 2BO9B 5CF2A 4HM1B 1JB4A 6STDA 4GB5A 2XGLA 2RSXA 3BU4A 4CPKA 3CXC2 1DETA 1TJDA 2CFGA 1W6GA 3NHXA 4KFDA 4OK0A 4CJNA 1VQQA 4KZ1A 7RNTA 2JDIH 2GBWB 1T3BA 4MMYB 3T8UA 3X42A 3K63A 2BIRA 3KSPA 1GYBA 1YIJ3 5KP3A 3FGYA 1U5OA 4HM6B 5HGRA 3F9SA 3JVCA 1I70A 1MWTA 3G6E3 3LT9A 4LMIA 1NDOB 1GD4A 5HOHA 4I5QA 2BNGA 3GZYB 1OACA 3T8NA 2XFSA 5GSPA 3CC43 1BSDA 3VF1A 4FMBA 5CLKA 5JPPA 1GY7A 2INXA 3H51A 3WHOA 3HIGA 3S5CA 5EEOA 1E3RA 3DMCA 5AI1A 1VQM3 2KCDA 2RGQA 3EF8A 1RSNA 1VQ43 1D6UA 3BNDA 1RHLA 4XM4A 1SARA 3I563 3N8BA 3VSYA 1BUQA 2D42A 2OQEC 2CIUA 4LZIA 5TGNA 3SXXA 4N6OB 9RNTA 3FF0A 3I0YA 3LTBA 2H0IA 1RCLA 1WNHA 4RNZA 5KP4A 4IIAA 1JNQA 1OF5A 5M18A 2GU3A 4EYCA 3FH1A 1ULJB 1NJI4 1CYUA 3F8XA 2Z77A 3CPW2 2LQVA 3PXMA 4CCVA 1GOVA 1LNHA 6RNTA 3B4OA 5IW9A 5AIFA 1RGHA 1BOXA 2H0HA 1A2KA 4MMZB 3B7CA 1MWRA 1IVXA 3GSPA 3L0RA 3UL6A 1IQ8A 4LYLB 1NO3A 3DY5A 4STDA 4EC6A 1L5GB 1GS3A 4R4KA 1JZOA 2JQ5A 2YFLB 3HI7A 3X3ZA 1RGAA 2XSOB 1JJ22 1FGQA 3G8ZA 3NV0B 4HAAA 4J5GA 2ML6A 1BNEA
chains in the Genus database with same CATH topology
2C4BA 1A2PA 5RNTA 1BSCA 1LNIA 1RMSA 1BU4A 1I0VA 1PYLA 3A5EA 1BRSA 1LRAA 1B2MA 1BRHA 3BIRA 1TRPA 1I2FA 1FW7A 1RLSA 1HZ1A 1B2XA 1G02A 6GSPA 1BNRA 1I2EA 3HOHA 1B2SA 1RGCA 1LOYA 2F56A 1LOVA 1BRJA 3SYUA 3RNTA 1BRGA 1RCKA 1PY3A 1FYSA 1BNGA 1RGGA 1IYYA 4BU4A 1B21A 1JBRA 1BRNL 3AHWA 4BIRA 3AHSA 1FUSA 2KF6A 1JBTA 1AY7A 1GOYA 1RGKA 1GMRA 1BRIA 1UCJA 1YVSA 1B2UA 2F4YA 3AGOA 2F5MA 1I3IA 4GSPA 1Q9EA 1UCLA 1FZUA 1RTUA 2KAAA 1BRKA 1FUTA 3URPA 1I3FA 1AQZA 5BU4A 8RNTA 1BSEA 1R4YA 1MGWA 1I2GA 3DGYA 1X1WA 3BU4A 1YGWA 1DETA 1ZGXA 2HOHA 1GSPA 7RNTA 1B27A 4J5GA 3KCHA 1X1XA 1BNFA 4HOHA 2BIRA 4J5KA 1B20A 1JBSA 3Q3FA 1I70A 1YNVX 1RGFA 1BGSA 5HOHA 1BIRA 1CH0A 1I0XA 1B3SA 5GSPA 3WR2A 1BSDA 1GOUA 1TRQA 1RNBA 2SARA 3WHOA 1RGEA 4RNTA 1RN4A 1BUJA 2AADA 3AGNA 1BAOA 1RSNA 1MGRA 1RHLA 1SARA 1I8VA 1HYFA 1UCKA 2AAEA 9RNTA 1GMQA 1GMPA 1T2HA 2RNTA 3D5GA 1BSBA 3D4AA 1RCLA 1RNTA 1RDSA 1UCIA 1X1YA 2KF4A 7GSPA 1BSAA 2ZA4A 2BU4A 1RN1A 5BIRA 2RBIA 3DH2A 1X1UA 4GHOA 1BNSA 1BNIA 2F5WA 1GOVA 1B2ZA 6RNTA 1RGHA 1T2IA 1BOXA 2KF5A 1BNJA 1C54A 3GSPA 1RGLA 3D5IA 2KF3A 1LOWA 1BANA 1TTOA 1DE3A 2GSPA 1RGAA 4HAAA 1BVIA 1BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C4B A;  1A2P A;  5RNT A;  1BSC A;  1LNI A;  1RMS A;  1BU4 A;  1I0V A;  1PYL A;  3A5E A;  1BRS A;  1LRA A;  1B2M A;  1BRH A;  3BIR A;  1TRP A;  1I2F A;  1FW7 A;  1RLS A;  1HZ1 A;  1B2X A;  1G02 A;  6GSP A;  1BNR A;  1I2E A;  3HOH A;  1B2S A;  1RGC A;  1LOY A;  2F56 A;  1LOV A;  1BRJ A;  3SYU A;  3RNT A;  1BRG A;  1RCK A;  1PY3 A;  1FYS A;  1BNG A;  1RGG A;  1IYY A;  4BU4 A;  1B21 A;  1JBR A;  1BRN L;  3AHW A;  4BIR A;  3AHS A;  1FUS A;  2KF6 A;  1JBT A;  1AY7 A;  1GOY A;  1RGK A;  1GMR A;  1BRI A;  1UCJ A;  1YVS A;  1B2U A;  2F4Y A;  3AGO A;  2F5M A;  1I3I A;  4GSP A;  1Q9E A;  1UCL A;  1FZU A;  1RTU A;  2KAA A;  1BRK A;  1FUT A;  3URP A;  1I3F A;  1AQZ A;  5BU4 A;  8RNT A;  1BSE A;  1R4Y A;  1MGW A;  1I2G A;  3DGY A;  1X1W A;  3BU4 A;  1YGW A;  1DET A;  1ZGX A;  2HOH A;  1GSP A;  7RNT A;  1B27 A;  4J5G A;  3KCH A;  1X1X A;  1BNF A;  4HOH A;  2BIR A;  4J5K A;  1B20 A;  1JBS A;  3Q3F A;  1I70 A;  1YNV X;  1RGF A;  1BGS A;  5HOH A;  1BIR A;  1CH0 A;  1I0X A;  1B3S A;  5GSP A;  3WR2 A;  1BSD A;  1GOU A;  1TRQ A;  1RNB A;  2SAR A;  3WHO A;  1RGE A;  4RNT A;  1RN4 A;  1BUJ A;  2AAD A;  3AGN A;  1BAO A;  1RSN A;  1MGR A;  1RHL A;  1SAR A;  1I8V A;  1HYF A;  1UCK A;  2AAE A;  9RNT A;  1GMQ A;  1GMP A;  1T2H A;  2RNT A;  3D5G A;  1BSB A;  3D4A A;  1RCL A;  1RNT A;  1RDS A;  1UCI A;  1X1Y A;  2KF4 A;  7GSP A;  1BSA A;  2ZA4 A;  2BU4 A;  1RN1 A;  5BIR A;  2RBI A;  3DH2 A;  1X1U A;  4GHO A;  1BNS A;  1BNI A;  2F5W A;  1GOV A;  1B2Z A;  6RNT A;  1RGH A;  1T2I A;  1BOX A;  2KF5 A;  1BNJ A;  1C54 A;  3GSP A;  1RGL A;  3D5I A;  2KF3 A;  1LOW A;  1BAN A;  1TTO A;  1DE3 A;  2GSP A;  1RGA A;  4HAA A;  1BVI A;  1BNE A; 
#chains in the Genus database with same CATH topology
 1F8N A;  1ROA A;  1AR0 A;  3DGM A;  3PCR A;  2P05 A;  1PYL A;  1N8Q A;  1W02 A;  1BRS A;  1LRA A;  2W6J H;  1B2M A;  2OQE A;  2FNQ A;  3BIR A;  4K90 B;  5ELU A;  2Z7A A;  2W04 A;  1HZ1 A;  4LGQ A;  2MC8 A;  1AV4 A;  1G02 A;  1GY5 A;  2P09 A;  1ROV A;  1I2E A;  2L4V A;  5AIG A;  3HOH A;  4EXR A;  1QAF A;  1EUI C;  4O2H A;  1DMM A;  1LVN A;  3PYJ A;  4MJD A;  4KT3 B;  2PZV A;  3MSO A;  2CWV A;  1LOV A;  3F7X A;  1BRJ A;  4HM8 B;  4K1U A;  5ELJ A;  1BRG A;  1RCK A;  1YHQ 3;  1Q82 4;  3JUO A;  1BNG A;  3MHE A;  1JBR A;  3SOY A;  1CQS A;  1YGE A;  3JUN A;  5JBS A;  1IVV A;  2FGT A;  2L1S A;  3G0K A;  1JBT A;  1CEW I;  4OUQ A;  1GOY A;  1UCJ A;  3CD6 3;  1B2U A;  3NV0 A;  3BB9 A;  1N8R 4;  3AGO A;  2F5M A;  1I3I A;  3EX9 A;  1JRQ A;  4GSP A;  3RGA A;  3KSE D;  2W56 A;  2CG1 A;  1W4N A;  2KAA A;  2HMK B;  3B4P A;  3OXA A;  3ECF A;  1FUT A;  4FCM A;  2YFJ B;  1AQZ A;  8RNT A;  1R4Y A;  3JUQ A;  1HU9 A;  1IT8 A;  4N6T A;  3MG3 A;  4O8S A;  1K41 A;  3UJM A;  4MEI A;  3FG4 A;  5M19 A;  1KQS 2;  2CWU A;  3GZX B;  4GL6 A;  1ZGX A;  5A0O B;  4XBX A;  1Q7H A;  2XH9 A;  4HKV B;  4HOH A;  1BNF A;  3CCR 3;  1B20 A;  1EA2 A;  1JBS A;  3Q3F A;  5DRE A;  3CCV 3;  4N6U A;  4DKI A;  1K73 4;  1W01 A;  2GEX A;  1US1 A;  3FKA A;  1IK3 A;  1BGS A;  1UDI I;  3SVA A;  2OOV C;  3CCM 3;  1B3S A;  5CF1 A;  3NQZ A;  3SX1 A;  3WR2 A;  3JUP A;  3HK4 A;  3D79 A;  4N6V 0;  4X2H A;  3T0U A;  4AEQ A;  1A67 A;  1SPU A;  4RNT A;  4KVH A;  1QVG 2;  3N9H A;  3ZG5 A;  3CC7 3;  3FCS B;  2CH9 A;  1BUJ A;  4WWU C;  1E97 A;  4EV2 A;  1BAO A;  1MGR A;  3DZL A;  3HZP A;  1JB5 A;  1HKX A;  2WOH A;  2CX1 A;  2GEY A;  1O7G B;  3FLJ A;  4Q53 A;  1ZS7 A;  5G1L A;  2XRX B;  2AAE A;  3DGN A;  5BVB A;  1GMQ A;  5FW5 A;  1T2H A;  3D5G A;  5IEN A;  2GU1 A;  3EBT A;  3JUM A;  1OF5 B;  2C10 A;  1BSB A;  5JPU A;  1JV2 B;  1IVU A;  1UI7 A;  1RDS A;  4NHF A;  2BMO B;  7GSP A;  1BSA A;  5FGO A;  2P0M A;  1YIT 3;  2BMR B;  5BIR A;  2RBI A;  4GHO A;  1MWS A;  1X1U A;  1BNS A;  4I4K A;  3UB1 A;  2RFR A;  2F5W A;  2STD A;  1IVW A;  4HJL B;  2B1X B;  3H3H A;  1CYV A;  2J8X B;  3OWY A;  5IG0 A;  4HM3 B;  1VQN 3;  5AYS C;  1C54 A;  3NBB A;  4L7K A;  2OOV A;  2UUG C;  4FMC A;  2W0Q A;  1RGL A;  3D5I A;  4HZ9 B;  2IMJ A;  1Y4K A;  2KF3 A;  1ZO2 A;  1WMP A;  3LXU X;  1BAN A;  3EC9 A;  3EN8 A;  2Z76 A;  1STF I;  3LOY A;  3V98 A;  4O3V A;  1IV9 A;  1OH0 A;  2R41 A;  1RRH A;  4H3U A;  3LYG A;  1NNV A;  1A2P A;  1BSC A;  2WO0 A;  1LNI A;  1BU4 A;  4XBT A;  3NQY A;  1KWI A;  1I2F A;  1Q40 B;  1AVL A;  1RLS A;  1VQL 3;  1FW7 A;  5G2G A;  1VZZ A;  2BMQ B;  4ORL A;  3LTA A;  2UX0 A;  4R9L A;  4HZB B;  1OGZ A;  1JN5 A;  4QWT A;  2D1W A;  5CK6 A;  5DRV A;  3CME 3;  4K61 A;  1V58 A;  2CFW A;  1WMN A;  2F56 A;  3KII A;  3PGB A;  3LTC A;  1VQ9 3;  3EQQ B;  4N6M A;  3RNT A;  1PY3 A;  3S27 A;  1TIJ A;  2IY2 A;  1IYY A;  2BHM A;  3HX8 A;  1FA3 A;  3NM7 A;  1QMA A;  1U8C B;  3U1W A;  4BIR A;  4BTW A;  4EV5 A;  3LT8 A;  2C11 A;  3WOF B;  1TU5 A;  1FUS A;  2KF6 A;  1NU3 A;  1EEJ A;  3X40 A;  3DXO A;  3CPO A;  3GZR A;  1RGK A;  1GMR A;  2W56 B;  1YVS A;  1N5P A;  2F4Y A;  4IT7 A;  4WYK A;  1FGR A;  1QAL A;  2E2U A;  3M8C A;  3X3X A;  3K7C A;  1BRK A;  2O3O A;  3GZB A;  1OHS A;  3U97 A;  5M1A A;  1C7H A;  4BTY A;  4BTX A;  1VQ5 3;  1Q40 A;  2P38 A;  5CXO A;  2MF7 A;  5D81 A;  2W2C A;  2ZHX B;  1YGW A;  3CCE 3;  3D3L A;  2HOH A;  2CW9 A;  2E2T A;  1T5Y A;  1V57 A;  2LYX A;  2HMJ B;  2PNC A;  3IPT A;  3PS8 A;  1X1X A;  1FUW A;  4J5K A;  1Q81 4;  3F8H A;  3OW2 2;  2IYJ A;  5AIH A;  3LML A;  2YFI B;  3CCL 3;  1RJO A;  2A15 A;  1O7P B;  1YJ9 3;  1E3V A;  2ML5 A;  1BIR A;  2YX9 A;  3A76 A;  1CH0 A;  3Q1C A;  1I0X A;  1V74 A;  1RKY A;  1N9E A;  4HM2 B;  1GOU A;  2F86 B;  2E2V A;  4N3V A;  2QGU A;  2K0M A;  3V99 A;  3PZW A;  3CNX A;  1RNB A;  5D82 A;  2SAR A;  1RGE A;  5IF6 A;  3IJE B;  4OVM A;  3DGL A;  2WGO A;  2AAD A;  3J7Y d;  3AGN A;  3B8L A;  3MYT A;  3KN4 A;  1FGM A;  2CG0 A;  1DVD A;  1N5H A;  5EVH A;  3SED A;  3TDG A;  1UUW B;  3K5T A;  1I8V A;  3WA2 X;  3EBY A;  1UCK A;  2CFD A;  1STD A;  3RDE A;  3CU3 A;  4NPB A;  1GMP A;  2RNT A;  4K1V A;  3D4A A;  3X3Y A;  1VQK 3;  1RNT A;  2V1L A;  1UGI A;  2Y74 A;  4XDV A;  1OPY A;  4JRF A;  1X1Y A;  2Q07 A;  1JB2 A;  5IG3 A;  2ZA4 A;  5EQL A;  2BU4 A;  3HII A;  4IPB A;  2IA7 A;  3LH4 A;  3FG3 A;  3STD A;  1RN1 A;  3GWR A;  3F40 A;  1EKM A;  3SLU A;  2OCT A;  1QJG A;  2ZDJ A;  4BL2 A;  1KD1 4;  3ALA A;  5LC6 A;  1D6Z A;  2K3D A;  2B24 B;  4XDW A;  1FGT A;  2CHC A;  2XEP A;  5IER A;  1T2I A;  2M7O A;  3WOD G;  2KF5 A;  3E99 A;  1BNJ A;  4N6L A;  3G71 3;  1YJW 3;  2Y73 A;  3EN1 B;  5AEW B;  1UUG B;  2R4I A;  4ZM8 A;  1IQX A;  3CCU 3;  3S29 A;  1TP6 A;  3DM8 A;  3QRD A;  4KFF A;  4J9A A;  3ROB A;  3V92 A;  3N54 B;  3Q90 A;  1LOW A;  1TTO A;  2QEX 3;  1W2B 2;  2OTJ 3;  1DE3 A;  4X2O A;  1O7M B;  4LEH A;  3Q2P A;  3NX0 A;  4HM0 B;  4RBN A;  1IU7 A;  5IEP A;  1S72 3;  2CX0 A;  3FF2 A;  3IMA B;  5RNT A;  2K54 A;  3LTD A;  1W2Z A;  1SIH A;  3A5E A;  1FGO A;  3OWS A;  2ZL8 A;  4HM4 B;  2SBL A;  1LOX A;  4XBY A;  1TRP A;  3OX9 A;  2CFL A;  1VQO 3;  1WTH A;  2BT3 A;  1JN5 B;  3MWZ A;  6GSP A;  5AII A;  1G0T A;  1BNR A;  1A90 A;  1IDP A;  1Z1S A;  2I9W A;  1YJN 3;  1UI8 A;  3EJV A;  4AKY A;  3ER7 A;  1RGC A;  5IEO A;  5LC7 A;  7STD A;  4L8P A;  3NBR A;  1ZX2 A;  3SYU A;  4ILF A;  1OUN A;  1D6Y A;  5G1K A;  3G16 A;  3DGO A;  3EE1 A;  1RGG A;  2XSH B;  2XR8 B;  5IG4 A;  4BU4 A;  1B21 A;  3CCQ 3;  1YI2 3;  2OTL 3;  1BRN L;  5I97 A;  3OV4 A;  3AHW A;  4WYK B;  4RNY A;  4MMX B;  3S67 A;  2IUJ A;  1W6Y A;  1QAK A;  1M9G A;  2W9Q A;  1IQY A;  3GAX A;  5IG5 A;  2HML B;  3VGN A;  4EBG A;  1UCL A;  2O9U X;  4KFE A;  4WFO A;  4EW5 A;  1NB5 I;  1ULI B;  1S5A A;  5BU4 A;  3MG1 A;  4H61 A;  1BSE A;  3D9R A;  1MGW A;  3AMO B;  1I2G A;  3DGY A;  3K9M C;  1PU4 A;  1X1W A;  1UW1 A;  2FXT A;  1EG9 B;  3KKG A;  1SQW A;  1KSI A;  1VQ7 3;  4RZM A;  1Q86 4;  1GSP A;  3BNC A;  1Q42 A;  1B27 A;  2W9P A;  1PFP A;  3KCH A;  3RGR A;  2QA4 3;  3MG2 A;  2Z6B A;  4PEJ A;  1SJW A;  1WMO A;  1N9J A;  4HBR A;  1YNV X;  1JKG B;  1RGF A;  3GRD A;  3WDG B;  3NUV A;  4AKZ A;  3CCJ 3;  2CKF B;  1TRQ A;  1O7H B;  1IV7 A;  2W03 A;  1DVC A;  4N6N B;  4LSO A;  1RN4 A;  2H0G A;  1TFO A;  3S28 A;  1KC8 4;  3BNE A;  4CDL A;  1GD3 A;  2P0X A;  1Q7Y 4;  3BNB A;  3LZA A;  2XGN A;  4FMA A;  1K8A 4;  1HYF A;  3AMO A;  3OWU A;  2CK3 H;  1O7W B;  3EB8 A;  4G1M B;  4XB5 A;  1OGX A;  3QK9 A;  1RRL A;  1UCI A;  5AYR B;  2KF4 A;  8CHO A;  2CFK A;  1DMN A;  1NB3 I;  1K9M 4;  4WP5 A;  3WOE B;  1YVB I;  3DH2 A;  5BXQ A;  2WGQ A;  1BNI A;  1W5Z A;  1JKG A;  4L8O A;  3WA3 A;  1B2Z A;  1K28 A;  3DUK A;  4FCJ A;  1UUV B;  2XF3 A;  4R9K A;  4WHA A;  3ZG0 A;  4HM5 B;  4R80 A;  1W00 A;  1IT7 A;  1OCV A;  4J8T A;  5STD A;  3ZFZ A;  3CNM A;  2CWT A;  4FMD A;  1A2V A;  4R1K A;  1TUH A;  4U13 A;  3UNL A;  1DYU A;  4HYZ A;  1EQK A;  4HM7 B;  2GSP A;  3MKI A;  3FG1 A;  1O7N B;  2KXG A;  2QIY A;  1BVI A;  3NM2 A;  3PCS A;  2C4B A;  2HMO B;  1J2B A;  4TX4 A;  5D83 A;  3K0Z A;  5AEU B;  1RMS A;  1I0V A;  1BRH A;  2HMN B;  1M1X B;  2F99 A;  2XFT A;  4FR9 A;  3WMD A;  1M1K 4;  1RN7 A;  1JZD A;  2RCD A;  1B2X A;  1NWW A;  2OWP A;  1MNL A;  3I55 3;  2GXF A;  1TFK A;  1ISK A;  1B2S A;  1GY6 A;  3MPH A;  3O8Y A;  2F98 A;  4HVN A;  4O02 B;  1VQ8 3;  4JF8 A;  3CCS 3;  1W7C A;  4NRE A;  1LOY A;  1OHO A;  3NXJ A;  3CC2 3;  3G4S 3;  1ASK A;  1DMQ A;  3EHC A;  1QVF 2;  3FZW A;  3KFQ C;  1LQG C;  1FYS A;  1VQP 3;  2IUK A;  3KZT A;  3NBJ A;  5KP1 A;  1W6C A;  3SOA A;  1MWU A;  2HMM B;  3F7S A;  2GBX B;  3AHS A;  1G96 A;  1AY7 A;  3X41 A;  1AVK A;  1VQ6 3;  4FCZ A;  2KRT A;  1BRI A;  2CC3 A;  1LXE A;  1Q9E A;  3UL5 A;  3CMA 3;  1FZU A;  1M90 4;  1RTU A;  1MOL A;  1SII A;  3F14 A;  1OHP A;  2WOF A;  1R4C A;  3FSD A;  4BL3 A;  3BLZ A;  1LQM B;  2UGI A;  3KE7 A;  1I3F A;  1UGH I;  1WQL B;  3URP A;  2BO9 B;  5CF2 A;  4HM1 B;  1JB4 A;  6STD A;  4GB5 A;  2XGL A;  2RSX A;  3BU4 A;  4CPK A;  3CXC 2;  1DET A;  1TJD A;  2CFG A;  1W6G A;  3NHX A;  4KFD A;  4OK0 A;  4CJN A;  1VQQ A;  4KZ1 A;  7RNT A;  2JDI H;  2GBW B;  1T3B A;  4MMY B;  3T8U A;  3X42 A;  3K63 A;  2BIR A;  3KSP A;  1GYB A;  1YIJ 3;  5KP3 A;  3FGY A;  1U5O A;  4HM6 B;  5HGR A;  3F9S A;  3JVC A;  1I70 A;  1MWT A;  3G6E 3;  3LT9 A;  4LMI A;  1NDO B;  1GD4 A;  5HOH A;  4I5Q A;  2BNG A;  3GZY B;  1OAC A;  3T8N A;  2XFS A;  5GSP A;  3CC4 3;  1BSD A;  3VF1 A;  4FMB A;  5CLK A;  5JPP A;  1GY7 A;  2INX A;  3H51 A;  3WHO A;  3HIG A;  3S5C A;  5EEO A;  1E3R A;  3DMC A;  5AI1 A;  1VQM 3;  2KCD A;  2RGQ A;  3EF8 A;  1RSN A;  1VQ4 3;  1D6U A;  3BND A;  1RHL A;  4XM4 A;  1SAR A;  3I56 3;  3N8B A;  3VSY A;  1BUQ A;  2D42 A;  2OQE C;  2CIU A;  4LZI A;  5TGN A;  3SXX A;  4N6O B;  9RNT A;  3FF0 A;  3I0Y A;  3LTB A;  2H0I A;  1RCL A;  1WNH A;  4RNZ A;  5KP4 A;  4IIA A;  1JNQ A;  1OF5 A;  5M18 A;  2GU3 A;  4EYC A;  3FH1 A;  1ULJ B;  1NJI 4;  1CYU A;  3F8X A;  2Z77 A;  3CPW 2;  2LQV A;  3PXM A;  4CCV A;  1GOV A;  1LNH A;  6RNT A;  3B4O A;  5IW9 A;  5AIF A;  1RGH A;  1BOX A;  2H0H A;  1A2K A;  4MMZ B;  3B7C A;  1MWR A;  1IVX A;  3GSP A;  3L0R A;  3UL6 A;  1IQ8 A;  4LYL B;  1NO3 A;  3DY5 A;  4STD A;  4EC6 A;  1L5G B;  1GS3 A;  4R4K A;  1JZO A;  2JQ5 A;  2YFL B;  3HI7 A;  3X3Z A;  1RGA A;  2XSO B;  1JJ2 2;  1FGQ A;  3G8Z A;  3NV0 B;  4HAA A;  4J5G A;  2ML6 A;  1BNE A; 
#chains in the Genus database with same CATH homology
 2C4B A;  1A2P A;  5RNT A;  1BSC A;  1LNI A;  1RMS A;  1BU4 A;  1I0V A;  1PYL A;  3A5E A;  1BRS A;  1LRA A;  1B2M A;  1BRH A;  3BIR A;  1TRP A;  1I2F A;  1FW7 A;  1RLS A;  1HZ1 A;  1B2X A;  1G02 A;  6GSP A;  1BNR A;  1I2E A;  3HOH A;  1B2S A;  1RGC A;  1LOY A;  2F56 A;  1LOV A;  1BRJ A;  3SYU A;  3RNT A;  1BRG A;  1RCK A;  1PY3 A;  1FYS A;  1BNG A;  1RGG A;  1IYY A;  4BU4 A;  1B21 A;  1JBR A;  1BRN L;  3AHW A;  4BIR A;  3AHS A;  1FUS A;  2KF6 A;  1JBT A;  1AY7 A;  1GOY A;  1RGK A;  1GMR A;  1BRI A;  1UCJ A;  1YVS A;  1B2U A;  2F4Y A;  3AGO A;  2F5M A;  1I3I A;  4GSP A;  1Q9E A;  1UCL A;  1FZU A;  1RTU A;  2KAA A;  1BRK A;  1FUT A;  3URP A;  1I3F A;  1AQZ A;  5BU4 A;  8RNT A;  1BSE A;  1R4Y A;  1MGW A;  1I2G A;  3DGY A;  1X1W A;  3BU4 A;  1YGW A;  1DET A;  1ZGX A;  2HOH A;  1GSP A;  7RNT A;  1B27 A;  4J5G A;  3KCH A;  1X1X A;  1BNF A;  4HOH A;  2BIR A;  4J5K A;  1B20 A;  1JBS A;  3Q3F A;  1I70 A;  1YNV X;  1RGF A;  1BGS A;  5HOH A;  1BIR A;  1CH0 A;  1I0X A;  1B3S A;  5GSP A;  3WR2 A;  1BSD A;  1GOU A;  1TRQ A;  1RNB A;  2SAR A;  3WHO A;  1RGE A;  4RNT A;  1RN4 A;  1BUJ A;  2AAD A;  3AGN A;  1BAO A;  1RSN A;  1MGR A;  1RHL A;  1SAR A;  1I8V A;  1HYF A;  1UCK A;  2AAE A;  9RNT A;  1GMQ A;  1GMP A;  1T2H A;  2RNT A;  3D5G A;  1BSB A;  3D4A A;  1RCL A;  1RNT A;  1RDS A;  1UCI A;  1X1Y A;  2KF4 A;  7GSP A;  1BSA A;  2ZA4 A;  2BU4 A;  1RN1 A;  5BIR A;  2RBI A;  3DH2 A;  1X1U A;  4GHO A;  1BNS A;  1BNI A;  2F5W A;  1GOV A;  1B2Z A;  6RNT A;  1RGH A;  1T2I A;  1BOX A;  2KF5 A;  1BNJ A;  1C54 A;  3GSP A;  1RGL A;  3D5I A;  2KF3 A;  1LOW A;  1BAN A;  1TTO A;  1DE3 A;  2GSP A;  1RGA A;  4HAA A;  1BVI A;  1BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...