3KCHA

Baranase crosslinked by glutaraldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Revisiting glutaraldehyde cross-linking: the case of the Arg-Lys intermolecular doublet
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3kchA00
1B3SA 1YNVX 1AY7A 1B21A 5BIRA 1MGRA 3WHOA 1FW7A 1GMPA 3KCHA 3URPA 1BSDA 1I70A 1RN4A 1BRKA 2F5MA 3D5GA 1RGKA 3WR2A 2RBIA 1A2PA 1BU4A 3BIRA 1X1UA 4J5KA 1TTOA 3A5EA 1I3IA 1RDSA 4RNTA 1BRNL 1I3FA 4J5GA 1C54A 5RNTA 1B2SA 3Q3FA 2BIRA 1X1WA 1RGAA 3D5IA 2F56A 1RHLA 1MGWA 1LOVA 1BNJA 1BVIA 1BSEA 1RCKA 3HOHA 1BSBA 9RNTA 1RGLA 1X1YA 1TRPA 1JBSA 1ZGXA 1RNBA 1BRSA 1DETA 1B2ZA 1UCLA 2HOHA 1BRJA 8RNTA 1I0XA 6GSPA 1UCJA 1B27A 1RGGA 1LOYA 2AAEA 1LOWA 1BRHA 3SYUA 3AHWA 4HOHA 3AGNA 2GSPA 1B2XA 1RNTA 1X1XA 2AADA 1BUJA 1TRQA 1FYSA 3RNTA 1CH0A 1I2EA 1YVSA 3BU4A 1DE3A 2KAAA 1BRIA 1SARA 2F4YA 2F5WA 1R4YA 1BAOA 2KF6A 2RNTA 1BIRA 3GSPA 1GSPA 1I2GA 4GSPA 5BU4A 3AHSA 1GOUA 1I8VA 1LRAA 1PY3A 2SARA 4BU4A 1HZ1A 1GMRA 5GSPA 1FZUA 1RSNA 2C4BA 3DGYA 1BNGA 1PYLA 1UCKA 1B2MA 1FUSA 1JBTA 1Q9EA 5HOHA 2KF3A 1GMQA 1FUTA 1BANA 1RLSA 1RGEA 1HYFA 2KF5A 1BNSA 1RGFA 1RGHA 1BNRA 4BIRA 2KF4A 3D4AA 7GSPA 1GOYA 1I0VA 1BGSA 7RNTA 1BSCA 6RNTA 1BOXA 1RN1A 2ZA4A 3DH2A 1B20A 1BSAA 1T2HA 1BNEA 1IYYA 1AQZA 1JBRA 1T2IA 1RTUA 3AGOA 1YGWA 1RCLA 1G02A 1RMSA 4HAAA 1I2FA 4GHOA 1BRGA 1BNFA 2BU4A 1LNIA 1RGCA 1BNIA 1B2UA 1GOVA 1UCIA
chains in the Genus database with same CATH superfamily
1B3SA 3SOAA 1AY7A 1B21A 4HM6B 1MGRA 4EBGA 5BIRA 3KSPA 1VQ93 3KCHA 4I5QA 1BSDA 4TX4A 1BRKA 1TFOA 2STDA 3LTDA 1UUWB 1WTHA 4HZBB 3WR2A 1BU4A 1X1UA 1V74A 3VF1A 1CYVA 1BRNL 4J5GA 1FGOA 1NNVA 2BMQB 3FF2A 3GZYB 1VQ73 2GU1A 3DY5A 2IY2A 3WA3A 2H0GA 2OWPA 3ROBA 1GYBA 1FGTA 2BO9B 1LQGC 3Q3FA 4HM4B 3X3XA 1CEWI 5JBSA 1TU5A 3X40A 1CYUA 1Q7Y4 1VQO3 3D5IA 2GEYA 5G1LA 1A2KA 3CNMA 2B1XB 1BVIA 1NWWA 1RCKA 3HOHA 3OW22 1A67A 3DM8A 3V92A 1X1YA 1TRPA 3KSED 1UI7A 3FG3A 3B8LA 3NXJA 3X3YA 3LOYA 1IQXA 2W6JH 2H0HA 3MWZA 2HOHA 1BRJA 4HM7B 5D82A 1WMPA 2Z6BA 1DMQA 1I0XA 1UCJA 1Q824 3S29A 1BRHA 1US1A 2RSXA 3DUKA 1F8NA 1MWUA 5IEPA 1JKGA 1T3BA 2UUGC 1OHPA 1N9EA 3DMCA 1JZDA 1MOLA 3FGYA 3H3HA 3WA2X 1B2XA 4HZ9B 1SQWA 3DGNA 1FYSA 3RNTA 4EYCA 3DGOA 1YJ93 1ISKA 3DGMA 4O2HA 3TDGA 1WQLB 2XSHB 1QVG2 4XBYA 1VQ83 3AMOB 4ORLA 3L0RA 4R9KA 1KWIA 4LZIA 1FGMA 1R4YA 1JV2B 2ZL8A 2RNTA 3FCSB 3T8UA 2INXA 5BVBA 1I2GA 4GSPA 2B24B 5BU4A 1I8VA 4HKVB 1W2B2 1UUGB 1QALA 2P0XA 1HZ1A 3X3ZA 1PU4A 3RDEA 2XF3A 2P05A 1Q814 1WMOA 2C4BA 3GZBA 4GL6A 3A76A 2XR8B 4L8OA 2FXTA 2R41A 1B2MA 3CC23 1JBTA 1IQYA 3IMAB 4ZM8A 3ER7A 1K41A 3K5TA 1FUTA 3G8ZA 5M18A 1GD3A 1BANA 1RLSA 3EB8A 5KP4A 1M904 2I9WA 1D6UA 1HYFA 1S723 3CPOA 1BNSA 1GY6A 1RGFA 4NHFA 3MSOA 1IV9A 2XFTA 4BIRA 5LC7A 1OGZA 5D83A 2L1SA 3ECFA 1OHSA 5AYRB 1NJI4 1I0VA 2CFKA 2MC8A 7RNTA 2FNQA 1BSCA 1PFPA 1KQS2 3U97A 3CCV3 1W02A 2BT3A 1O7NB 3MG3A 1BNEA 1RRLA 1NB5I 2UGIA 1IYYA 2RGQA 4O8SA 4CPKA 1T2IA 4FCMA 1YIJ3 3EQQB 1HU9A 1RCLA 4WYKA 3EN8A 2HMNB 4GHOA 4KFFA 3OWUA 5ELJA 3MG1A 1K8A4 1V57A 3NM7A 4N6V0 4Q53A 4JRFA 1RJOA 2F98A 2Q07A 1YIT3 1OF5A 4LGQA 3FG4A 5G1KA 4MMYB 1K734 2HMJB 5AIHA 3MKIA 1GS3A 3F40A 3A5EA 1DMNA 3G0KA 1VQL3 4RNTA 1ASKA 4WP5A 4H61A 2CK3H 4MMXB 1LOXA 3H51A 4K90B 1K9M4 5IERA 3UJMA 1AVKA 2YX9A 3PS8A 3S67A 4N6NB 5AEWB 3CC43 2W9PA 3DXOA 2P09A 4LEHA 2QGUA 1AV4A 1IVWA 3JUPA 1RRHA 1EA2A 3MG2A 5BXQA 2CG0A 1MGWA 1LOVA 3SOYA 3CCR3 3I0YA 1RGLA 1ZO2A 1O7WB 1RNBA 1DETA 4JF8A 1W6GA 1UCLA 5EEOA 2W2CA 1G96A 6GSPA 4IPBA 1B27A 1NO3A 1RGGA 1LOYA 1UUVB 2HMLB 2R4IA 2IYJA 2V1LA 3M8CA 3PCRA 3G6E3 1EEJA 4HYZA 1IVUA 3RGRA 1A90A 1Q42A 4WHAA 3I553 2GSPA 3HI7A 3KZTA 3STDA 1FGRA 1E3RA 1X1XA 3O8YA 2IUJA 1TIJA 4PEJA 1VQN3 3F7SA 5LC6A 2M7OA 4RBNA 1YHQ3 1QJGA 2Z7AA 2W0QA 3X42A 3OWSA 1W6YA 2WOHA 3NX0A 1YVSA 3BU4A 3VSYA 3KKGA 4N3VA 1BRIA 1UGIA 3EX9A 3CCU3 4KFDA 4KVHA 2A15A 2ZDJA 2J8XB 2KF6A 2ZHXB 1KSIA 3GSPA 3D3LA 1FA3A 3JUMA 3MHEA 1TJDA 1TFKA 2HMMB 1GOUA 1JKGB 4BU4A 4OVMA 1ULIB 2LYXA 2W9QA 4HM2B 4HM5B 5GSPA 4EXRA 2H0IA 1RSNA 2D1WA 3KFQC 2F99A 1FUSA 3PCSA 3S28A 1LXEA 4FMAA 5HOHA 2KF3A 1M1XB 1GMQA 2GBWB 5M1AA 2KCDA 3GWRA 1VQ43 5IG5A 3CMA3 3UL5A 2HMKB 2IA7A 3NQYA 3QRDA 3VGNA 5CF2A 3CXC2 1OACA 2XEPA 4MMZB 1BNRA 3CCJ3 1IVXA 4BL2A 4BTWA 1IU7A 2JQ5A 4FMDA 4WFOA 5AIFA 1UDII 4HJLB 3F14A 4H3UA 1JNQA 3UL6A 6RNTA 2CWTA 3CNXA 3Q2PA 4FMBA 1ZX2A 2PZVA 1R4CA 5A0OB 3FG1A 1N5HA 1BSAA 2CFLA 3CCM3 3CD63 5DRVA 1GY7A 3NHXA 1AQZA 3NV0B 3BB9A 1UW1A 2KRTA 3NQZA 1E97A 1RTUA 3IPTA 1YGWA 1OGXA 1U5OA 2GU3A 1IT8A 2OTJ3 5CXOA 3NBRA 3F8HA 2BU4A 1LNIA 2QIYA 4RZMA 4BTXA 1RGCA 1YJN3 1IT7A 3EC9A 3GZRA 3PGBA 3CCE3 2ML5A 3AMOA 3EBTA 1YNVX 3N54B 1FW7A 7STDA 3FSDA 1W4NA 2W56B 1I70A 1SIHA 1RN4A 1SIIA 3DGLA 1RGKA 3LXUX 3BIRA 4J5KA 3K0ZA 5TGNA 1TTOA 4FCZA 4J8TA 3EJVA 3Q1CA 1RDSA 1VQ53 1Z1SA 2K54A 2P0MA 1B2SA 3KE7A 3BNBA 3OXAA 2O9UX 4N6MA 1VQK3 2CWVA 1DVCA 3EHCA 3BNDA 4FR9A 3UB1A 5IENA 3OWYA 1Q40B 1X1WA 1V58A 2E2TA 1RGAA 2YFLB 3N8BA 1MWTA 4IT7A 6STDA 4N6OB 5DREA 3F7XA 1ULJB 1OPYA 5IG3A 1RHLA 1BNJA 1BSEA 2CHCA 3MPHA 1OF5B 1G0TA 2ML6A 1M9GA 1QAFA 1CQSA 2BMOB 3E99A 1W00A 1ZGXA 3CME3 1B2ZA 1JN5A 2RFRA 4G1MB 3NBJA 8RNTA 4K1VA 2K3DA 2GBXB 3BNCA 4L7KA 3SLUA 2QEX3 1LOWA 2W03A 3SYUA 1KD14 4HVNA 2SBLA 1QAKA 4MJDA 3AGNA 1O7MB 2BNGA 5IW9A 1KC84 2OTL3 1D6YA 1T5YA 2BHMA 1IVVA 1AR0A 3FLJA 1BUQA 1RNTA 3LTAA 3PZWA 4I4KA 3MYTA 5CF1A 3D9RA 5AI1A 4EC6A 2AADA 1BUJA 4CJNA 3B4OA 5STDA 5HGRA 1CH0A 1YJW3 1STFI 1I2EA 2CFWA 3WDGB 4FCJA 2F4YA 4N6UA 2F5WA 4KFEA 3FF0A 3G713 1OUNA 1JRQA 1NB3I 5KP1A 4X2OA 1YGEA 3U1WA 3HIIA 1GSPA 1W2ZA 3CCQ3 1EKMA 5CLKA 3CCS3 1PY3A 1DYUA 3WOFB 4KZ1A 1FGQA 4RNYA 2OOVA 4N6TA 1M1K4 1Q7HA 4NREA 5EQLA 1UCKA 4AKYA 2E2VA 4XM4A 1TUHA 3BLZA 4GB5A 4LYLB 2CX1A 4CDLA 3LYGA 3WOEB 2GEXA 3F8XA 3WMDA 3CU3A 4CCVA 5JPUA 3WODG 2XH9A 4FMCA 4R9LA 3K7CA 2KF5A 2OOVC 3GAXA 3EE1A 1RGHA 5IG4A 3HX8A 3B7CA 2KXGA 3CC73 2XGLA 1JZOA 3SEDA 1W6CA 3D4AA 2CKFB 1A2VA 3PYJA 4OUQA 1IQ8A 3LTBA 1K28A 3RGAA 1BGSA 4BTYA 1JB5A 1HKXA 4QWTA 3SVAA 2CX0A 5ELUA 5JPPA 4LMIA 1BOXA 1WNHA 2ZA4A 2LQVA 2YFIB 3JUQA 1UI8A 1UGHI 1JJ22 2Z76A 1QVF2 3BNEA 1JBRA 3LTCA 2RCDA 2L4VA 3EF8A 1EUIC 1SPUA 1E3VA 5AIIA 1RMSA 1W5ZA 2MF7A 5AEUB 5IEOA 1L5GB 3V98A 1Y4KA 1BNIA 5I97A 1B2UA 1GOVA 4MEIA 3FH1A 5AIGA 1OHOA 3SX1A 1QMAA 1LNHA 3LT8A 2WGOA 4O3VA 3B4PA 3JUOA 3WHOA 1D6ZA 1GMPA 1MWSA 1TP6A 3URPA 3S5CA 2F5MA 3JUNA 3K63A 3D5GA 4O02B 2RBIA 1A2PA 3V99A 1IDPA 1GY5A 2IMJA 1MNLA 3GZXB 2Y73A 4N6LA 5AYSC 1I3IA 4HM8B 4NPBA 3OV4A 1I3FA 3LT9A 2WOFA 4HM0B 5RNTA 1C54A 1YVBI 3CPW2 2CG1A 5IF6A 8CHOA 2PNCA 2WGQA 3EBYA 3T8NA 3J7Yd 2BIRA 1VZZA 3FZWA 1STDA 4IIAA 4ILFA 3I563 3SXXA 4WWUC 2OCTA 4X2HA 1VQM3 2F56A 4HM3B 2D42A 3HK4A 1AVLA 4L8PA 3S27A 9RNTA 4KT3B 1BSBA 1MWRA 4R80A 1JBSA 1BRSA 2XGNA 2K0MA 1NDOB 4LSOA 2UX0A 2Y74A 4HBRA 1YI23 1VQP3 1GD4A 2CIUA 1LVNA 2AAEA 2CFDA 1VQ63 2CC3A 2HMOB 5CK6A 3T0UA 3AHWA 2P38A 2W04A 2XSOB 4U13A 2C10A 1OH0A 4HOHA 3ZFZA 1J2BA 1O7GB 5IG0A 2OQEA 1O7PB 3F9SA 3NV0A 4EW5A 4WYKB 2GXFA 2CW9A 4XBXA 1TRQA 3X41A 4XBTA 3QK9A 2CFGA 5D81A 1U8CB 1DE3A 2OQEC 1JN5B 1OCVA 2C11A 2KAAA 1SARA 1IK3A 1JB4A 1N9JA 2F86B 1BAOA 1W7CA 3ALAA 3LH4A 1ROVA 2W56A 1BIRA 4RNZA 2CH9A 4AEQA 3AHSA 1LRAA 2SARA 1EG9B 2O3OA 1GMRA 2JDIH 5EVHA 2QA43 1FZUA 3G16A 3KIIA 4R4KA 1ROAA 3DGYA 2WO0A 3HIGA 3ZG5A 1JB2A 1BNGA 4XDWA 1PYLA 5FGOA 4EV5A 1VQQA 1DMMA 3OX9A 4HM1B 1Q9EA 1W01A 4K1UA 2YFJB 1Q40A 2CWUA 3NM2A 4EV2A 3NBBA 3Q90A 1RGEA 1NU3A 3FKAA 3LMLA 3IJEB 1N5PA 1EQKA 5FW5A 4K61A 1WMNA 3N9HA 4R1KA 3KN4A 1IV7A 2KF4A 3HZPA 1ZS7A 4DKIA 1RKYA 1N8QA 7GSPA 1GOYA 1FUWA 4OK0A 3EN1B 1S5AA 4XB5A 3UNLA 2XRXB 1RN1A 3DH2A 3GRDA 1O7HB 3K9MC 4BL3A 1B20A 1T2HA 5M19A 2E2UA 2BMRB 3CCL3 3PXMA 2IUKA 2FGTA 3JVCA 4J9AA 2Z77A 3AGOA 4XDVA 1G02A 3NUVA 1RN7A 1I2FA 4HAAA 3DZLA 4STDA 1BRGA 3LZAA 5G2GA 1BNFA 3D79A 3ZG0A 3G4S3 1C7HA 1SJWA 4AKZA 1Q864 1DVDA 5KP3A 2XFSA 1UCIA 1N8R4 1LQMB
chains in the Genus database with same CATH topology
1B3SA 1YNVX 1AY7A 1B21A 5BIRA 1MGRA 3WHOA 1FW7A 1GMPA 3KCHA 3URPA 1BSDA 1I70A 1RN4A 1BRKA 2F5MA 3D5GA 1RGKA 3WR2A 2RBIA 1A2PA 1BU4A 3BIRA 1X1UA 4J5KA 1TTOA 3A5EA 1I3IA 1RDSA 4RNTA 1BRNL 1I3FA 4J5GA 1C54A 5RNTA 1B2SA 3Q3FA 2BIRA 1X1WA 1RGAA 3D5IA 2F56A 1RHLA 1MGWA 1LOVA 1BNJA 1BVIA 1BSEA 1RCKA 3HOHA 1BSBA 9RNTA 1RGLA 1X1YA 1TRPA 1JBSA 1ZGXA 1RNBA 1BRSA 1DETA 1B2ZA 1UCLA 2HOHA 1BRJA 8RNTA 1I0XA 6GSPA 1UCJA 1B27A 1RGGA 1LOYA 2AAEA 1LOWA 1BRHA 3SYUA 3AHWA 4HOHA 3AGNA 2GSPA 1B2XA 1RNTA 1X1XA 2AADA 1BUJA 1TRQA 1FYSA 3RNTA 1CH0A 1I2EA 1YVSA 3BU4A 1DE3A 2KAAA 1BRIA 1SARA 2F4YA 2F5WA 1R4YA 1BAOA 2KF6A 2RNTA 1BIRA 3GSPA 1GSPA 1I2GA 4GSPA 5BU4A 3AHSA 1GOUA 1I8VA 1LRAA 1PY3A 2SARA 4BU4A 1HZ1A 1GMRA 5GSPA 1FZUA 1RSNA 2C4BA 3DGYA 1BNGA 1PYLA 1UCKA 1B2MA 1FUSA 1JBTA 1Q9EA 5HOHA 2KF3A 1GMQA 1FUTA 1BANA 1RLSA 1RGEA 1HYFA 2KF5A 1BNSA 1RGFA 1RGHA 1BNRA 4BIRA 2KF4A 3D4AA 7GSPA 1GOYA 1I0VA 1BGSA 7RNTA 1BSCA 6RNTA 1BOXA 1RN1A 2ZA4A 3DH2A 1B20A 1BSAA 1T2HA 1BNEA 1IYYA 1AQZA 1JBRA 1T2IA 1RTUA 3AGOA 1YGWA 1RCLA 1G02A 1RMSA 4HAAA 1I2FA 4GHOA 1BRGA 1BNFA 2BU4A 1LNIA 1RGCA 1BNIA 1B2UA 1GOVA 1UCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3S A;  1YNV X;  1AY7 A;  1B21 A;  5BIR A;  1MGR A;  3WHO A;  1FW7 A;  1GMP A;  3KCH A;  3URP A;  1BSD A;  1I70 A;  1RN4 A;  1BRK A;  2F5M A;  3D5G A;  1RGK A;  3WR2 A;  2RBI A;  1A2P A;  1BU4 A;  3BIR A;  1X1U A;  4J5K A;  1TTO A;  3A5E A;  1I3I A;  1RDS A;  4RNT A;  1BRN L;  1I3F A;  4J5G A;  1C54 A;  5RNT A;  1B2S A;  3Q3F A;  2BIR A;  1X1W A;  1RGA A;  3D5I A;  2F56 A;  1RHL A;  1MGW A;  1LOV A;  1BNJ A;  1BVI A;  1BSE A;  1RCK A;  3HOH A;  1BSB A;  9RNT A;  1RGL A;  1X1Y A;  1TRP A;  1JBS A;  1ZGX A;  1RNB A;  1BRS A;  1DET A;  1B2Z A;  1UCL A;  2HOH A;  1BRJ A;  8RNT A;  1I0X A;  6GSP A;  1UCJ A;  1B27 A;  1RGG A;  1LOY A;  2AAE A;  1LOW A;  1BRH A;  3SYU A;  3AHW A;  4HOH A;  3AGN A;  2GSP A;  1B2X A;  1RNT A;  1X1X A;  2AAD A;  1BUJ A;  1TRQ A;  1FYS A;  3RNT A;  1CH0 A;  1I2E A;  1YVS A;  3BU4 A;  1DE3 A;  2KAA A;  1BRI A;  1SAR A;  2F4Y A;  2F5W A;  1R4Y A;  1BAO A;  2KF6 A;  2RNT A;  1BIR A;  3GSP A;  1GSP A;  1I2G A;  4GSP A;  5BU4 A;  3AHS A;  1GOU A;  1I8V A;  1LRA A;  1PY3 A;  2SAR A;  4BU4 A;  1HZ1 A;  1GMR A;  5GSP A;  1FZU A;  1RSN A;  2C4B A;  3DGY A;  1BNG A;  1PYL A;  1UCK A;  1B2M A;  1FUS A;  1JBT A;  1Q9E A;  5HOH A;  2KF3 A;  1GMQ A;  1FUT A;  1BAN A;  1RLS A;  1RGE A;  1HYF A;  2KF5 A;  1BNS A;  1RGF A;  1RGH A;  1BNR A;  4BIR A;  2KF4 A;  3D4A A;  7GSP A;  1GOY A;  1I0V A;  1BGS A;  7RNT A;  1BSC A;  6RNT A;  1BOX A;  1RN1 A;  2ZA4 A;  3DH2 A;  1B20 A;  1BSA A;  1T2H A;  1BNE A;  1IYY A;  1AQZ A;  1JBR A;  1T2I A;  1RTU A;  3AGO A;  1YGW A;  1RCL A;  1G02 A;  1RMS A;  4HAA A;  1I2F A;  4GHO A;  1BRG A;  1BNF A;  2BU4 A;  1LNI A;  1RGC A;  1BNI A;  1B2U A;  1GOV A;  1UCI A; 
#chains in the Genus database with same CATH topology
 1B3S A;  3SOA A;  1AY7 A;  1B21 A;  4HM6 B;  1MGR A;  4EBG A;  5BIR A;  3KSP A;  1VQ9 3;  3KCH A;  4I5Q A;  1BSD A;  4TX4 A;  1BRK A;  1TFO A;  2STD A;  3LTD A;  1UUW B;  1WTH A;  4HZB B;  3WR2 A;  1BU4 A;  1X1U A;  1V74 A;  3VF1 A;  1CYV A;  1BRN L;  4J5G A;  1FGO A;  1NNV A;  2BMQ B;  3FF2 A;  3GZY B;  1VQ7 3;  2GU1 A;  3DY5 A;  2IY2 A;  3WA3 A;  2H0G A;  2OWP A;  3ROB A;  1GYB A;  1FGT A;  2BO9 B;  1LQG C;  3Q3F A;  4HM4 B;  3X3X A;  1CEW I;  5JBS A;  1TU5 A;  3X40 A;  1CYU A;  1Q7Y 4;  1VQO 3;  3D5I A;  2GEY A;  5G1L A;  1A2K A;  3CNM A;  2B1X B;  1BVI A;  1NWW A;  1RCK A;  3HOH A;  3OW2 2;  1A67 A;  3DM8 A;  3V92 A;  1X1Y A;  1TRP A;  3KSE D;  1UI7 A;  3FG3 A;  3B8L A;  3NXJ A;  3X3Y A;  3LOY A;  1IQX A;  2W6J H;  2H0H A;  3MWZ A;  2HOH A;  1BRJ A;  4HM7 B;  5D82 A;  1WMP A;  2Z6B A;  1DMQ A;  1I0X A;  1UCJ A;  1Q82 4;  3S29 A;  1BRH A;  1US1 A;  2RSX A;  3DUK A;  1F8N A;  1MWU A;  5IEP A;  1JKG A;  1T3B A;  2UUG C;  1OHP A;  1N9E A;  3DMC A;  1JZD A;  1MOL A;  3FGY A;  3H3H A;  3WA2 X;  1B2X A;  4HZ9 B;  1SQW A;  3DGN A;  1FYS A;  3RNT A;  4EYC A;  3DGO A;  1YJ9 3;  1ISK A;  3DGM A;  4O2H A;  3TDG A;  1WQL B;  2XSH B;  1QVG 2;  4XBY A;  1VQ8 3;  3AMO B;  4ORL A;  3L0R A;  4R9K A;  1KWI A;  4LZI A;  1FGM A;  1R4Y A;  1JV2 B;  2ZL8 A;  2RNT A;  3FCS B;  3T8U A;  2INX A;  5BVB A;  1I2G A;  4GSP A;  2B24 B;  5BU4 A;  1I8V A;  4HKV B;  1W2B 2;  1UUG B;  1QAL A;  2P0X A;  1HZ1 A;  3X3Z A;  1PU4 A;  3RDE A;  2XF3 A;  2P05 A;  1Q81 4;  1WMO A;  2C4B A;  3GZB A;  4GL6 A;  3A76 A;  2XR8 B;  4L8O A;  2FXT A;  2R41 A;  1B2M A;  3CC2 3;  1JBT A;  1IQY A;  3IMA B;  4ZM8 A;  3ER7 A;  1K41 A;  3K5T A;  1FUT A;  3G8Z A;  5M18 A;  1GD3 A;  1BAN A;  1RLS A;  3EB8 A;  5KP4 A;  1M90 4;  2I9W A;  1D6U A;  1HYF A;  1S72 3;  3CPO A;  1BNS A;  1GY6 A;  1RGF A;  4NHF A;  3MSO A;  1IV9 A;  2XFT A;  4BIR A;  5LC7 A;  1OGZ A;  5D83 A;  2L1S A;  3ECF A;  1OHS A;  5AYR B;  1NJI 4;  1I0V A;  2CFK A;  2MC8 A;  7RNT A;  2FNQ A;  1BSC A;  1PFP A;  1KQS 2;  3U97 A;  3CCV 3;  1W02 A;  2BT3 A;  1O7N B;  3MG3 A;  1BNE A;  1RRL A;  1NB5 I;  2UGI A;  1IYY A;  2RGQ A;  4O8S A;  4CPK A;  1T2I A;  4FCM A;  1YIJ 3;  3EQQ B;  1HU9 A;  1RCL A;  4WYK A;  3EN8 A;  2HMN B;  4GHO A;  4KFF A;  3OWU A;  5ELJ A;  3MG1 A;  1K8A 4;  1V57 A;  3NM7 A;  4N6V 0;  4Q53 A;  4JRF A;  1RJO A;  2F98 A;  2Q07 A;  1YIT 3;  1OF5 A;  4LGQ A;  3FG4 A;  5G1K A;  4MMY B;  1K73 4;  2HMJ B;  5AIH A;  3MKI A;  1GS3 A;  3F40 A;  3A5E A;  1DMN A;  3G0K A;  1VQL 3;  4RNT A;  1ASK A;  4WP5 A;  4H61 A;  2CK3 H;  4MMX B;  1LOX A;  3H51 A;  4K90 B;  1K9M 4;  5IER A;  3UJM A;  1AVK A;  2YX9 A;  3PS8 A;  3S67 A;  4N6N B;  5AEW B;  3CC4 3;  2W9P A;  3DXO A;  2P09 A;  4LEH A;  2QGU A;  1AV4 A;  1IVW A;  3JUP A;  1RRH A;  1EA2 A;  3MG2 A;  5BXQ A;  2CG0 A;  1MGW A;  1LOV A;  3SOY A;  3CCR 3;  3I0Y A;  1RGL A;  1ZO2 A;  1O7W B;  1RNB A;  1DET A;  4JF8 A;  1W6G A;  1UCL A;  5EEO A;  2W2C A;  1G96 A;  6GSP A;  4IPB A;  1B27 A;  1NO3 A;  1RGG A;  1LOY A;  1UUV B;  2HML B;  2R4I A;  2IYJ A;  2V1L A;  3M8C A;  3PCR A;  3G6E 3;  1EEJ A;  4HYZ A;  1IVU A;  3RGR A;  1A90 A;  1Q42 A;  4WHA A;  3I55 3;  2GSP A;  3HI7 A;  3KZT A;  3STD A;  1FGR A;  1E3R A;  1X1X A;  3O8Y A;  2IUJ A;  1TIJ A;  4PEJ A;  1VQN 3;  3F7S A;  5LC6 A;  2M7O A;  4RBN A;  1YHQ 3;  1QJG A;  2Z7A A;  2W0Q A;  3X42 A;  3OWS A;  1W6Y A;  2WOH A;  3NX0 A;  1YVS A;  3BU4 A;  3VSY A;  3KKG A;  4N3V A;  1BRI A;  1UGI A;  3EX9 A;  3CCU 3;  4KFD A;  4KVH A;  2A15 A;  2ZDJ A;  2J8X B;  2KF6 A;  2ZHX B;  1KSI A;  3GSP A;  3D3L A;  1FA3 A;  3JUM A;  3MHE A;  1TJD A;  1TFK A;  2HMM B;  1GOU A;  1JKG B;  4BU4 A;  4OVM A;  1ULI B;  2LYX A;  2W9Q A;  4HM2 B;  4HM5 B;  5GSP A;  4EXR A;  2H0I A;  1RSN A;  2D1W A;  3KFQ C;  2F99 A;  1FUS A;  3PCS A;  3S28 A;  1LXE A;  4FMA A;  5HOH A;  2KF3 A;  1M1X B;  1GMQ A;  2GBW B;  5M1A A;  2KCD A;  3GWR A;  1VQ4 3;  5IG5 A;  3CMA 3;  3UL5 A;  2HMK B;  2IA7 A;  3NQY A;  3QRD A;  3VGN A;  5CF2 A;  3CXC 2;  1OAC A;  2XEP A;  4MMZ B;  1BNR A;  3CCJ 3;  1IVX A;  4BL2 A;  4BTW A;  1IU7 A;  2JQ5 A;  4FMD A;  4WFO A;  5AIF A;  1UDI I;  4HJL B;  3F14 A;  4H3U A;  1JNQ A;  3UL6 A;  6RNT A;  2CWT A;  3CNX A;  3Q2P A;  4FMB A;  1ZX2 A;  2PZV A;  1R4C A;  5A0O B;  3FG1 A;  1N5H A;  1BSA A;  2CFL A;  3CCM 3;  3CD6 3;  5DRV A;  1GY7 A;  3NHX A;  1AQZ A;  3NV0 B;  3BB9 A;  1UW1 A;  2KRT A;  3NQZ A;  1E97 A;  1RTU A;  3IPT A;  1YGW A;  1OGX A;  1U5O A;  2GU3 A;  1IT8 A;  2OTJ 3;  5CXO A;  3NBR A;  3F8H A;  2BU4 A;  1LNI A;  2QIY A;  4RZM A;  4BTX A;  1RGC A;  1YJN 3;  1IT7 A;  3EC9 A;  3GZR A;  3PGB A;  3CCE 3;  2ML5 A;  3AMO A;  3EBT A;  1YNV X;  3N54 B;  1FW7 A;  7STD A;  3FSD A;  1W4N A;  2W56 B;  1I70 A;  1SIH A;  1RN4 A;  1SII A;  3DGL A;  1RGK A;  3LXU X;  3BIR A;  4J5K A;  3K0Z A;  5TGN A;  1TTO A;  4FCZ A;  4J8T A;  3EJV A;  3Q1C A;  1RDS A;  1VQ5 3;  1Z1S A;  2K54 A;  2P0M A;  1B2S A;  3KE7 A;  3BNB A;  3OXA A;  2O9U X;  4N6M A;  1VQK 3;  2CWV A;  1DVC A;  3EHC A;  3BND A;  4FR9 A;  3UB1 A;  5IEN A;  3OWY A;  1Q40 B;  1X1W A;  1V58 A;  2E2T A;  1RGA A;  2YFL B;  3N8B A;  1MWT A;  4IT7 A;  6STD A;  4N6O B;  5DRE A;  3F7X A;  1ULJ B;  1OPY A;  5IG3 A;  1RHL A;  1BNJ A;  1BSE A;  2CHC A;  3MPH A;  1OF5 B;  1G0T A;  2ML6 A;  1M9G A;  1QAF A;  1CQS A;  2BMO B;  3E99 A;  1W00 A;  1ZGX A;  3CME 3;  1B2Z A;  1JN5 A;  2RFR A;  4G1M B;  3NBJ A;  8RNT A;  4K1V A;  2K3D A;  2GBX B;  3BNC A;  4L7K A;  3SLU A;  2QEX 3;  1LOW A;  2W03 A;  3SYU A;  1KD1 4;  4HVN A;  2SBL A;  1QAK A;  4MJD A;  3AGN A;  1O7M B;  2BNG A;  5IW9 A;  1KC8 4;  2OTL 3;  1D6Y A;  1T5Y A;  2BHM A;  1IVV A;  1AR0 A;  3FLJ A;  1BUQ A;  1RNT A;  3LTA A;  3PZW A;  4I4K A;  3MYT A;  5CF1 A;  3D9R A;  5AI1 A;  4EC6 A;  2AAD A;  1BUJ A;  4CJN A;  3B4O A;  5STD A;  5HGR A;  1CH0 A;  1YJW 3;  1STF I;  1I2E A;  2CFW A;  3WDG B;  4FCJ A;  2F4Y A;  4N6U A;  2F5W A;  4KFE A;  3FF0 A;  3G71 3;  1OUN A;  1JRQ A;  1NB3 I;  5KP1 A;  4X2O A;  1YGE A;  3U1W A;  3HII A;  1GSP A;  1W2Z A;  3CCQ 3;  1EKM A;  5CLK A;  3CCS 3;  1PY3 A;  1DYU A;  3WOF B;  4KZ1 A;  1FGQ A;  4RNY A;  2OOV A;  4N6T A;  1M1K 4;  1Q7H A;  4NRE A;  5EQL A;  1UCK A;  4AKY A;  2E2V A;  4XM4 A;  1TUH A;  3BLZ A;  4GB5 A;  4LYL B;  2CX1 A;  4CDL A;  3LYG A;  3WOE B;  2GEX A;  3F8X A;  3WMD A;  3CU3 A;  4CCV A;  5JPU A;  3WOD G;  2XH9 A;  4FMC A;  4R9L A;  3K7C A;  2KF5 A;  2OOV C;  3GAX A;  3EE1 A;  1RGH A;  5IG4 A;  3HX8 A;  3B7C A;  2KXG A;  3CC7 3;  2XGL A;  1JZO A;  3SED A;  1W6C A;  3D4A A;  2CKF B;  1A2V A;  3PYJ A;  4OUQ A;  1IQ8 A;  3LTB A;  1K28 A;  3RGA A;  1BGS A;  4BTY A;  1JB5 A;  1HKX A;  4QWT A;  3SVA A;  2CX0 A;  5ELU A;  5JPP A;  4LMI A;  1BOX A;  1WNH A;  2ZA4 A;  2LQV A;  2YFI B;  3JUQ A;  1UI8 A;  1UGH I;  1JJ2 2;  2Z76 A;  1QVF 2;  3BNE A;  1JBR A;  3LTC A;  2RCD A;  2L4V A;  3EF8 A;  1EUI C;  1SPU A;  1E3V A;  5AII A;  1RMS A;  1W5Z A;  2MF7 A;  5AEU B;  5IEO A;  1L5G B;  3V98 A;  1Y4K A;  1BNI A;  5I97 A;  1B2U A;  1GOV A;  4MEI A;  3FH1 A;  5AIG A;  1OHO A;  3SX1 A;  1QMA A;  1LNH A;  3LT8 A;  2WGO A;  4O3V A;  3B4P A;  3JUO A;  3WHO A;  1D6Z A;  1GMP A;  1MWS A;  1TP6 A;  3URP A;  3S5C A;  2F5M A;  3JUN A;  3K63 A;  3D5G A;  4O02 B;  2RBI A;  1A2P A;  3V99 A;  1IDP A;  1GY5 A;  2IMJ A;  1MNL A;  3GZX B;  2Y73 A;  4N6L A;  5AYS C;  1I3I A;  4HM8 B;  4NPB A;  3OV4 A;  1I3F A;  3LT9 A;  2WOF A;  4HM0 B;  5RNT A;  1C54 A;  1YVB I;  3CPW 2;  2CG1 A;  5IF6 A;  8CHO A;  2PNC A;  2WGQ A;  3EBY A;  3T8N A;  3J7Y d;  2BIR A;  1VZZ A;  3FZW A;  1STD A;  4IIA A;  4ILF A;  3I56 3;  3SXX A;  4WWU C;  2OCT A;  4X2H A;  1VQM 3;  2F56 A;  4HM3 B;  2D42 A;  3HK4 A;  1AVL A;  4L8P A;  3S27 A;  9RNT A;  4KT3 B;  1BSB A;  1MWR A;  4R80 A;  1JBS A;  1BRS A;  2XGN A;  2K0M A;  1NDO B;  4LSO A;  2UX0 A;  2Y74 A;  4HBR A;  1YI2 3;  1VQP 3;  1GD4 A;  2CIU A;  1LVN A;  2AAE A;  2CFD A;  1VQ6 3;  2CC3 A;  2HMO B;  5CK6 A;  3T0U A;  3AHW A;  2P38 A;  2W04 A;  2XSO B;  4U13 A;  2C10 A;  1OH0 A;  4HOH A;  3ZFZ A;  1J2B A;  1O7G B;  5IG0 A;  2OQE A;  1O7P B;  3F9S A;  3NV0 A;  4EW5 A;  4WYK B;  2GXF A;  2CW9 A;  4XBX A;  1TRQ A;  3X41 A;  4XBT A;  3QK9 A;  2CFG A;  5D81 A;  1U8C B;  1DE3 A;  2OQE C;  1JN5 B;  1OCV A;  2C11 A;  2KAA A;  1SAR A;  1IK3 A;  1JB4 A;  1N9J A;  2F86 B;  1BAO A;  1W7C A;  3ALA A;  3LH4 A;  1ROV A;  2W56 A;  1BIR A;  4RNZ A;  2CH9 A;  4AEQ A;  3AHS A;  1LRA A;  2SAR A;  1EG9 B;  2O3O A;  1GMR A;  2JDI H;  5EVH A;  2QA4 3;  1FZU A;  3G16 A;  3KII A;  4R4K A;  1ROA A;  3DGY A;  2WO0 A;  3HIG A;  3ZG5 A;  1JB2 A;  1BNG A;  4XDW A;  1PYL A;  5FGO A;  4EV5 A;  1VQQ A;  1DMM A;  3OX9 A;  4HM1 B;  1Q9E A;  1W01 A;  4K1U A;  2YFJ B;  1Q40 A;  2CWU A;  3NM2 A;  4EV2 A;  3NBB A;  3Q90 A;  1RGE A;  1NU3 A;  3FKA A;  3LML A;  3IJE B;  1N5P A;  1EQK A;  5FW5 A;  4K61 A;  1WMN A;  3N9H A;  4R1K A;  3KN4 A;  1IV7 A;  2KF4 A;  3HZP A;  1ZS7 A;  4DKI A;  1RKY A;  1N8Q A;  7GSP A;  1GOY A;  1FUW A;  4OK0 A;  3EN1 B;  1S5A A;  4XB5 A;  3UNL A;  2XRX B;  1RN1 A;  3DH2 A;  3GRD A;  1O7H B;  3K9M C;  4BL3 A;  1B20 A;  1T2H A;  5M19 A;  2E2U A;  2BMR B;  3CCL 3;  3PXM A;  2IUK A;  2FGT A;  3JVC A;  4J9A A;  2Z77 A;  3AGO A;  4XDV A;  1G02 A;  3NUV A;  1RN7 A;  1I2F A;  4HAA A;  3DZL A;  4STD A;  1BRG A;  3LZA A;  5G2G A;  1BNF A;  3D79 A;  3ZG0 A;  3G4S 3;  1C7H A;  1SJW A;  4AKZ A;  1Q86 4;  1DVD A;  5KP3 A;  2XFS A;  1UCI A;  1N8R 4;  1LQM B; 
#chains in the Genus database with same CATH homology
 1B3S A;  1YNV X;  1AY7 A;  1B21 A;  5BIR A;  1MGR A;  3WHO A;  1FW7 A;  1GMP A;  3KCH A;  3URP A;  1BSD A;  1I70 A;  1RN4 A;  1BRK A;  2F5M A;  3D5G A;  1RGK A;  3WR2 A;  2RBI A;  1A2P A;  1BU4 A;  3BIR A;  1X1U A;  4J5K A;  1TTO A;  3A5E A;  1I3I A;  1RDS A;  4RNT A;  1BRN L;  1I3F A;  4J5G A;  1C54 A;  5RNT A;  1B2S A;  3Q3F A;  2BIR A;  1X1W A;  1RGA A;  3D5I A;  2F56 A;  1RHL A;  1MGW A;  1LOV A;  1BNJ A;  1BVI A;  1BSE A;  1RCK A;  3HOH A;  1BSB A;  9RNT A;  1RGL A;  1X1Y A;  1TRP A;  1JBS A;  1ZGX A;  1RNB A;  1BRS A;  1DET A;  1B2Z A;  1UCL A;  2HOH A;  1BRJ A;  8RNT A;  1I0X A;  6GSP A;  1UCJ A;  1B27 A;  1RGG A;  1LOY A;  2AAE A;  1LOW A;  1BRH A;  3SYU A;  3AHW A;  4HOH A;  3AGN A;  2GSP A;  1B2X A;  1RNT A;  1X1X A;  2AAD A;  1BUJ A;  1TRQ A;  1FYS A;  3RNT A;  1CH0 A;  1I2E A;  1YVS A;  3BU4 A;  1DE3 A;  2KAA A;  1BRI A;  1SAR A;  2F4Y A;  2F5W A;  1R4Y A;  1BAO A;  2KF6 A;  2RNT A;  1BIR A;  3GSP A;  1GSP A;  1I2G A;  4GSP A;  5BU4 A;  3AHS A;  1GOU A;  1I8V A;  1LRA A;  1PY3 A;  2SAR A;  4BU4 A;  1HZ1 A;  1GMR A;  5GSP A;  1FZU A;  1RSN A;  2C4B A;  3DGY A;  1BNG A;  1PYL A;  1UCK A;  1B2M A;  1FUS A;  1JBT A;  1Q9E A;  5HOH A;  2KF3 A;  1GMQ A;  1FUT A;  1BAN A;  1RLS A;  1RGE A;  1HYF A;  2KF5 A;  1BNS A;  1RGF A;  1RGH A;  1BNR A;  4BIR A;  2KF4 A;  3D4A A;  7GSP A;  1GOY A;  1I0V A;  1BGS A;  7RNT A;  1BSC A;  6RNT A;  1BOX A;  1RN1 A;  2ZA4 A;  3DH2 A;  1B20 A;  1BSA A;  1T2H A;  1BNE A;  1IYY A;  1AQZ A;  1JBR A;  1T2I A;  1RTU A;  3AGO A;  1YGW A;  1RCL A;  1G02 A;  1RMS A;  4HAA A;  1I2F A;  4GHO A;  1BRG A;  1BNF A;  2BU4 A;  1LNI A;  1RGC A;  1BNI A;  1B2U A;  1GOV A;  1UCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...