3KCHA

Baranase crosslinked by glutaraldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Revisiting glutaraldehyde cross-linking: the case of the Arg-Lys intermolecular doublet
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3kchA00
1T2HA 1GOUA 1FW7A 1RMSA 3BU4A 1I2FA 2F4YA 1RCKA 1BSBA 3KCHA 1UCKA 1ZGXA 7RNTA 3D5GA 1FZUA 1I70A 1LNIA 2GSPA 1X1WA 3AHSA 1I2GA 1RSNA 1I8VA 8RNTA 1BSEA 1RNTA 1GMQA 3DGYA 1RGGA 3WR2A 1B2UA 1BRJA 1UCLA 4GSPA 1BRHA 1YGWA 3HOHA 4HAAA 1YVSA 1GMRA 1RHLA 1RGAA 4J5GA 1HZ1A 3A5EA 1LOVA 2BU4A 1BRIA 2AADA 2KF3A 1I0XA 1PYLA 6GSPA 4HOHA 9RNTA 1MGWA 1BRSA 1A2PA 3D5IA 1C54A 1BIRA 1RGCA 1G02A 1BNRA 1Q9EA 1AY7A 1RDSA 3AGOA 1GOYA 1BOXA 1BNGA 1BSDA 1SARA 3URPA 1I3FA 5GSPA 1MGRA 1TRPA 1BSCA 1R4YA 1IYYA 1RCLA 1GSPA 1X1XA 2SARA 1BNJA 1LRAA 1B2XA 1B20A 1DE3A 1JBSA 4RNTA 3Q3FA 1RGHA 1TTOA 1YNVX 1I2EA 1RGKA 1BNSA 2KF4A 1BGSA 1BSAA 5RNTA 2F56A 3AGNA 2ZA4A 3RNTA 2KF5A 1B2MA 3AHWA 1GMPA 1RGLA 1FUTA 1B27A 1JBRA 1AQZA 1LOYA 1BAOA 1BNEA 3BIRA 1BRGA 1JBTA 1GOVA 2RBIA 1BRKA 4BU4A 1TRQA 2AAEA 1RN1A 2C4BA 1RGFA 1RTUA 2HOHA 1RGEA 2F5MA 1UCIA 2F5WA 3WHOA 1B2SA 1X1YA 3SYUA 1DETA 4BIRA 3D4AA 1I3IA 1FUSA 1BVIA 1B21A 1UCJA 1B2ZA 1RLSA 1RNBA 2BIRA 2RNTA 4J5KA 1LOWA 1HYFA 1BANA 1CH0A 1BUJA 1X1UA 3GSPA 1RN4A 1I0VA 7GSPA 5BIRA 1BNFA 3DH2A 1BU4A 1FYSA 1T2IA 4GHOA 2KAAA 1B3SA 1BNIA 5HOHA 1BRNL 5BU4A 1PY3A 2KF6A 6RNTA
chains in the Genus database with same CATH superfamily
1T2HA 3MKIA 1EG9B 1FGMA 1TFKA 3G713 1O7GB 3DGNA 1NB5I 2A15A 1I2FA 2R4IA 1OUNA 1W00A 3KCHA 1UCKA 4MMXB 1ZGXA 2UGIA 3D5GA 5M1AA 7RNTA 5BVBA 1JNQA 4FR9A 1OF5A 2ZHXB 1GY6A 1IVVA 3CNXA 8RNTA 1OGXA 2Z76A 3PXMA 4WHAA 1JKGA 2RFRA 3JUPA 1IDPA 5AYSC 1B2UA 3JUMA 4FCMA 3EX9A 4BL2A 2E2VA 1T5YA 2IYJA 3G16A 4GSPA 2IMJA 3QK9A 1JB2A 3L0RA 3HOHA 5EVHA 3S67A 3CCL3 1C7HA 3G4S3 1Y4KA 1NO3A 2P05A 1PFPA 2CIUA 4L8PA 3LTBA 1O7MB 1NNVA 2PZVA 3A76A 1RN7A 1FGQA 3A5EA 4FMBA 4MMZB 4H61A 2ML5A 4HM2B 4HZBB 4Q53A 2QA43 3D3LA 1MWRA 3D9RA 1GS3A 5ELUA 4HOHA 1WTHA 1OCVA 5LC6A 1D6ZA 1A2PA 3D5IA 1ASKA 1IK3A 2CH9A 1G02A 4RNYA 1BNRA 1IU7A 1O7PB 1U8CB 1STFI 1ZO2A 4O2HA 1FUWA 1AY7A 1RDSA 5EQLA 1VQ93 1YI23 4N3VA 2HMMB 3OV4A 3I563 3B8LA 1TIJA 3K9MC 2E2UA 4R4KA 1BSDA 2CFDA 3V99A 3JVCA 4XBTA 5GSPA 1VZZA 4LGQA 1EEJA 4X2OA 1Q40B 2JDIH 1VQM3 1RCLA 3I553 1FGRA 4FMCA 1X1XA 4AEQA 2SARA 1J2BA 4IT7A 1BNJA 1EQKA 1ULJB 1DE3A 1B20A 1R4CA 4N6OB 1JBSA 1IV7A 1TTOA 2GU3A 1I2EA 1BNSA 4H3UA 2J8XB 4HBRA 4R1KA 4L8OA 3K7CA 3PGBA 3KN4A 3RGAA 4GL6A 3Q1CA 2F56A 4N6V0 1IQXA 2ZA4A 4N6TA 4OUQA 1GMPA 3NV0B 1GD4A 3JUQA 2WOFA 3DM8A 1HU9A 2XRXB 2ZDJA 3PS8A 4HM3B 1JBRA 1OGZA 2XGLA 1GYBA 4J8TA 4O3VA 3LOYA 2Z6BA 1ZX2A 5CXOA 1K9M4 3HI7A 1VQ43 2OTJ3 3BB9A 4BU4A 4AKZA 1TRQA 3DGOA 4KFDA 1OHOA 4KVHA 2HOHA 2Z7AA 2WO0A 2XEPA 3KSPA 1DMQA 4O02B 1OH0A 2XFSA 4K1UA 3MWZA 5G1LA 2GBXB 1V57A 3DZLA 5M19A 1WMPA 3K0ZA 4TX4A 1WQLB 1W02A 3X3YA 3HK4A 3DGMA 1VQN3 1AVKA 2YFLB 2BIRA 4FCZA 5D83A 2FXTA 4J5KA 3PYJA 5DRVA 2L4VA 3ER7A 5AIHA 1BANA 3GSPA 3BNEA 1UDII 3V92A 2XSHB 4LEHA 3LT8A 3BLZA 1STDA 1RJOA 4WP5A 1B3SA 1GD3A 2CFLA 4HM1B 2FNQA 4EV2A 2K54A 3UL6A 1BRNL 5KP1A 1MNLA 3F9SA 3IPTA 1PY3A 5BU4A 5FGOA 3JUNA 3VSYA 5M18A 2CC3A 4EYCA 5IF6A 1GOUA 3LXUX 1FW7A 1RMSA 1DYUA 2F4YA 1RCKA 1KD14 1YJ93 2GBWB 3MHEA 4NPBA 4RZMA 2P0MA 3G0KA 2B24B 1ULIB 3K63A 3NBRA 1I2GA 3LYGA 1I8VA 1VQP3 1N8QA 1RNTA 1RRLA 1GMQA 5KP3A 1HKXA 2XR8B 1RGGA 1W6GA 4R80A 1Q42A 1BRJA 1UCLA 2P38A 1N9EA 1BRHA 1GY7A 4RBNA 4HM4B 1YGWA 2HMOB 3VF1A 1JJ22 3SOYA 1SIIA 1YVSA 1EA2A 3FG4A 3S29A 4RNZA 3OWUA 3CXC2 5CLKA 1I0XA 1UI8A 3HX8A 3NHXA 1MWUA 3G8ZA 1VQL3 3CPOA 3SEDA 1Q7Y4 3BNBA 3DMCA 3DY5A 1BRSA 3PCSA 5JPUA 1NB3I 1TP6A 2CKFB 3UNLA 1C54A 4U13A 4L7KA 1BIRA 1Q40A 3KSED 5HGRA 1EUIC 8CHOA 3WMDA 5EEOA 3EN8A 4LSOA 2CG1A 3G6E3 3SXXA 1YIJ3 3FLJA 4MEIA 3EBYA 2KXGA 1Q864 5AIGA 3AGOA 1GOYA 1US1A 1BOXA 1BNGA 3URPA 4FMDA 1FGTA 1I3FA 3GWRA 4I4KA 1WMNA 1G0TA 3RDEA 2H0HA 2I9WA 5AEWB 1GSPA 1V58A 2ZL8A 4LYLB 2OWPA 1IYYA 2B1XB 1VQ73 5STDA 3NV0A 2CK3H 3ECFA 1ROVA 1RRHA 1W01A 1QVF2 4RNTA 3DUKA 3NXJA 2IUJA 1UGIA 6STDA 1BGSA 1W2B2 3CCJ3 1BSAA 3SOAA 5CF1A 5RNTA 1LVNA 1WMOA 3AGNA 2MF7A 3UL5A 1E97A 1RGLA 3LTCA 3X3XA 1DMNA 4HM6B 4MJDA 1SPUA 3H3HA 1B27A 1LXEA 3OX9A 3OWYA 1O7NB 3PZWA 2UX0A 3BIRA 2IA7A 3MG3A 1DVCA 1W6YA 3CD63 2RBIA 2GEYA 4HM0B 2YFJB 1RN1A 3EJVA 4N6MA 5AIFA 1JN5A 1JV2B 1RGFA 2CFGA 2HMNB 1LNHA 1ISKA 1RGEA 2F5MA 1UCIA 2MC8A 2CWUA 1X1YA 5D82A 1LQMB 3D4AA 3O8YA 5TGNA 4EV5A 1FUSA 2YX9A 3NUVA 1G96A 1MOLA 5IG5A 3EN1B 5ELJA 2OQEA 3SVAA 1RLSA 1SJWA 2SBLA 4XB5A 3MSOA 2BMQB 2CWVA 1HYFA 1BUJA 1O7WB 3T0UA 4G1MB 3B7CA 1QAKA 1CYVA 1I0VA 7GSPA 3B4PA 1A67A 3OWSA 4EBGA 2CG0A 3DH2A 1BU4A 1FYSA 4O8SA 1A90A 1T2IA 5LC7A 1TUHA 1Z1SA 4J9AA 1A2KA 5CK6A 4QWTA 1JB5A 3LMLA 1N8R4 5HOHA 1JRQA 1Q7HA 3CCU3 4XM4A 1M1XB 2W2CA 4HM5B 5IENA 3WOEB 1MWTA 1W6CA 2LQVA 3BU4A 3LT9A 4WYKB 2W6JH 3J7Yd 1VQO3 1BSBA 2OTL3 4EC6A 4AKYA 1IQ8A 1I70A 1YVBI 3F7XA 4HM7B 3AMOB 3S5CA 3Q2PA 2GSPA 4MMYB 1X1WA 3LZAA 7STDA 2CX0A 1JN5B 4N6NB 3RGRA 3GZRA 3ROBA 1RSNA 1BSEA 4ZM8A 4JF8A 3IMAB 1DMMA 1EKMA 3WA2X 4HZ9B 1K41A 3KZTA 3WR2A 3CMA3 4JRFA 3GRDA 4IPBA 3MPHA 4CPKA 2W04A 1QVG2 1W5ZA 4HAAA 5A0OB 5IG3A 1GMRA 1IQYA 3FKAA 1IVUA 2BHMA 3FSDA 4J5GA 2RSXA 3U1WA 4HKVB 1KSIA 2BU4A 2AADA 1YIT3 5IEPA 2XGNA 1YJW3 2HMJB 5IG0A 1E3VA 2HMLB 1NU3A 5FW5A 4BL3A 1MGWA 3CME3 1SQWA 2XSOB 3GZYB 3LTDA 1RGCA 1JB4A 1OHPA 2QEX3 1IT7A 2IUKA 4N6LA 1QALA 4LMIA 4CJNA 2W9QA 3CCQ3 2HMKB 3CCR3 3SLUA 1CEWI 3DXOA 1TU5A 1VQK3 4FCJA 4X2HA 1M904 3FCSB 3EF8A 1SARA 3F40A 3LTAA 3NQZA 4STDA 5AYRB 1TRPA 1BSCA 3KKGA 4XDWA 1PU4A 1M9GA 5AIIA 5JPPA 1D6UA 3ZG0A 3NBJA 4EW5A 3M8CA 3VGNA 2OOVA 4HJLB 5BXQA 5IG4A 1RGKA 2CW9A 1QMAA 3NQYA 2KF4A 3X40A 1NWWA 1TFOA 4K90B 1IVWA 4XDVA 1B2MA 3AHWA 3UB1A 1V74A 2C11A 2K0MA 1UUVB 1FUTA 2IY2A 1KC84 2GXFA 1LOYA 1BAOA 1BNEA 3GZXB 3KE7A 3UJMA 4BTXA 2P09A 1UUWB 1CYUA 1GOVA 2W03A 2BMRB 3NX0A 2WGQA 5JBSA 2BO9B 4ILFA 2C4BA 1RTUA 3NM7A 1FGOA 2F5WA 2F86B 2Y73A 3BNCA 4OVMA 1B2SA 4GB5A 5I97A 2W56B 5G2GA 2R41A 1Q814 3EE1A 1BVIA 3EC9A 2CFKA 4I5QA 1N9JA 3OW22 1B2ZA 1UI7A 4XBYA 1VQ53 2F99A 2ML6A 4BTWA 3PCRA 3KFQC 1LOWA 4KZ1A 1DVDA 2OOVC 1NDOB 5DREA 2RGQA 1N5HA 3SX1A 1RN4A 4CCVA 5BIRA 3IJEB 1ZS7A 1BNFA 4NHFA 4WYKA 1OHSA 2H0IA 3JUOA 2QGUA 2RCDA 2XFTA 4GHOA 1YJN3 3NM2A 3E99A 4CDLA 3AMOA 3B4OA 1W4NA 1LOXA 2C10A 2Y74A 1VQQA 2KF6A 2E2TA 1UW1A 3MG1A 5IEOA 3T8NA 3X42A 6RNTA 1CQSA 2D1WA 1IV9A 1YHQ3 5AEUB 2O9UX 2BNGA 2W9PA 2OCTA 3FG3A 3EQQB 3STDA 1IT8A 3CCS3 2W0QA 1FZUA 4HM8B 1LNIA 4PEJA 2STDA 3HZPA 2Z77A 3AHSA 3F8XA 4N6UA 1T3BA 2KRTA 3ZG5A 4R9KA 1VQ83 3DGYA 3WDGB 3CU3A 3HIIA 3N9HA 2CFWA 2F98A 1ROAA 1W7CA 3EB8A 3V98A 2GU1A 3WA3A 1RHLA 1RGAA 3I0YA 1OF5B 1FA3A 3WOFB 4KT3B 4NREA 2JQ5A 1HZ1A 1IVXA 1KWIA 2FGTA 4IIAA 4WFOA 1LOVA 1BRIA 2KF3A 1JKGB 2XH9A 3CNMA 3FF2A 4DKIA 1PYLA 2GEXA 1JZOA 2M7OA 5G1KA 3FH1A 3WODG 6GSPA 1AR0A 3Q90A 2L1SA 9RNTA 2CHCA 3GAXA 1YGEA 1WNHA 2P0XA 1F8NA 3CC73 1TJDA 1Q9EA 3DGLA 2QIYA 3F7SA 3HIGA 3CC23 1U5OA 4LZIA 1L5GB 3LH4A 2K3DA 3FF0A 4ORLA 3TDGA 2OQEC 1N5PA 1LQGC 3CCE3 1MGRA 1K28A 1R4YA 2BT3A 2LYXA 1O7HB 4K61A 5IW9A 1BUQA 3T8UA 3FGYA 1QAFA 5D81A 5KP4A 1LRAA 1NJI4 1B2XA 1MWSA 4EXRA 3EHCA 1OACA 3N8BA 3Q3FA 1RGHA 4XBXA 1YNVX 3CPW2 3CC43 1UGHI 2H0GA 3X3ZA 5CF2A 2BMOB 2V1LA 3H51A 4KFFA 1QJGA 5AI1A 3RNTA 2WOHA 2KF5A 2XF3A 4OK0A 2UUGC 1RKYA 4BTYA 3NBBA 4K1VA 1W2ZA 2W56A 3FG1A 1AQZA 1GY5A 1S5AA 2CX1A 1K734 1BRGA 1JBTA 2D42A 1OPYA 1VQ63 1UUGB 4HVNA 2INXA 3CCV3 1BRKA 2AAEA 3EBTA 1D6YA 2Q07A 3ZFZA 3MYTA 3WHOA 1AVLA 2KCDA 3SYUA 1DETA 3GZBA 4BIRA 1I3IA 4R9LA 1A2VA 3CCM3 1AV4A 1B21A 1UCJA 3FZWA 3KIIA 5IERA 1S723 1Q824 1RNBA 2CWTA 1SIHA 3F14A 3N54B 3U97A 4FMAA 2RNTA 2YFIB 1CH0A 3BNDA 1X1UA 3S27A 3K5TA 2WGOA 4KFEA 2O3OA 3ALAA 1K8A4 3D79A 1E3RA 2KAAA 1JZDA 3X41A 1M1K4 4WWUC 1BNIA 4HYZA 3MG2A 3F8HA 3OXAA 3S28A 3QRDA 2PNCA 1KQS2
chains in the Genus database with same CATH topology
1T2HA 1GOUA 1FW7A 1RMSA 3BU4A 1I2FA 2F4YA 1RCKA 1BSBA 3KCHA 1UCKA 1ZGXA 7RNTA 3D5GA 1FZUA 1I70A 1LNIA 2GSPA 1X1WA 3AHSA 1I2GA 1RSNA 1I8VA 8RNTA 1BSEA 1RNTA 1GMQA 3DGYA 1RGGA 3WR2A 1B2UA 1BRJA 1UCLA 4GSPA 1BRHA 1YGWA 3HOHA 4HAAA 1YVSA 1GMRA 1RHLA 1RGAA 4J5GA 1HZ1A 3A5EA 1LOVA 2BU4A 1BRIA 2AADA 2KF3A 1I0XA 1PYLA 6GSPA 4HOHA 9RNTA 1MGWA 1BRSA 1A2PA 3D5IA 1C54A 1BIRA 1RGCA 1G02A 1BNRA 1Q9EA 1AY7A 1RDSA 3AGOA 1GOYA 1BOXA 1BNGA 1BSDA 1SARA 3URPA 1I3FA 5GSPA 1MGRA 1TRPA 1BSCA 1R4YA 1IYYA 1RCLA 1GSPA 1X1XA 2SARA 1BNJA 1LRAA 1B2XA 1B20A 1DE3A 1JBSA 4RNTA 3Q3FA 1RGHA 1TTOA 1YNVX 1I2EA 1RGKA 1BNSA 2KF4A 1BGSA 1BSAA 5RNTA 2F56A 3AGNA 2ZA4A 3RNTA 2KF5A 1B2MA 3AHWA 1GMPA 1RGLA 1FUTA 1B27A 1JBRA 1AQZA 1LOYA 1BAOA 1BNEA 3BIRA 1BRGA 1JBTA 1GOVA 2RBIA 1BRKA 4BU4A 1TRQA 2AAEA 1RN1A 2C4BA 1RGFA 1RTUA 2HOHA 1RGEA 2F5MA 1UCIA 2F5WA 3WHOA 1B2SA 1X1YA 3SYUA 1DETA 4BIRA 3D4AA 1I3IA 1FUSA 1BVIA 1B21A 1UCJA 1B2ZA 1RLSA 1RNBA 2BIRA 2RNTA 4J5KA 1LOWA 1HYFA 1BANA 1CH0A 1BUJA 1X1UA 3GSPA 1RN4A 1I0VA 7GSPA 5BIRA 1BNFA 3DH2A 1BU4A 1FYSA 1T2IA 4GHOA 2KAAA 1B3SA 1BNIA 5HOHA 1BRNL 5BU4A 1PY3A 2KF6A 6RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2H A;  1GOU A;  1FW7 A;  1RMS A;  3BU4 A;  1I2F A;  2F4Y A;  1RCK A;  1BSB A;  3KCH A;  1UCK A;  1ZGX A;  7RNT A;  3D5G A;  1FZU A;  1I70 A;  1LNI A;  2GSP A;  1X1W A;  3AHS A;  1I2G A;  1RSN A;  1I8V A;  8RNT A;  1BSE A;  1RNT A;  1GMQ A;  3DGY A;  1RGG A;  3WR2 A;  1B2U A;  1BRJ A;  1UCL A;  4GSP A;  1BRH A;  1YGW A;  3HOH A;  4HAA A;  1YVS A;  1GMR A;  1RHL A;  1RGA A;  4J5G A;  1HZ1 A;  3A5E A;  1LOV A;  2BU4 A;  1BRI A;  2AAD A;  2KF3 A;  1I0X A;  1PYL A;  6GSP A;  4HOH A;  9RNT A;  1MGW A;  1BRS A;  1A2P A;  3D5I A;  1C54 A;  1BIR A;  1RGC A;  1G02 A;  1BNR A;  1Q9E A;  1AY7 A;  1RDS A;  3AGO A;  1GOY A;  1BOX A;  1BNG A;  1BSD A;  1SAR A;  3URP A;  1I3F A;  5GSP A;  1MGR A;  1TRP A;  1BSC A;  1R4Y A;  1IYY A;  1RCL A;  1GSP A;  1X1X A;  2SAR A;  1BNJ A;  1LRA A;  1B2X A;  1B20 A;  1DE3 A;  1JBS A;  4RNT A;  3Q3F A;  1RGH A;  1TTO A;  1YNV X;  1I2E A;  1RGK A;  1BNS A;  2KF4 A;  1BGS A;  1BSA A;  5RNT A;  2F56 A;  3AGN A;  2ZA4 A;  3RNT A;  2KF5 A;  1B2M A;  3AHW A;  1GMP A;  1RGL A;  1FUT A;  1B27 A;  1JBR A;  1AQZ A;  1LOY A;  1BAO A;  1BNE A;  3BIR A;  1BRG A;  1JBT A;  1GOV A;  2RBI A;  1BRK A;  4BU4 A;  1TRQ A;  2AAE A;  1RN1 A;  2C4B A;  1RGF A;  1RTU A;  2HOH A;  1RGE A;  2F5M A;  1UCI A;  2F5W A;  3WHO A;  1B2S A;  1X1Y A;  3SYU A;  1DET A;  4BIR A;  3D4A A;  1I3I A;  1FUS A;  1BVI A;  1B21 A;  1UCJ A;  1B2Z A;  1RLS A;  1RNB A;  2BIR A;  2RNT A;  4J5K A;  1LOW A;  1HYF A;  1BAN A;  1CH0 A;  1BUJ A;  1X1U A;  3GSP A;  1RN4 A;  1I0V A;  7GSP A;  5BIR A;  1BNF A;  3DH2 A;  1BU4 A;  1FYS A;  1T2I A;  4GHO A;  2KAA A;  1B3S A;  1BNI A;  5HOH A;  1BRN L;  5BU4 A;  1PY3 A;  2KF6 A;  6RNT A; 
#chains in the Genus database with same CATH topology
 1T2H A;  3MKI A;  1EG9 B;  1FGM A;  1TFK A;  3G71 3;  1O7G B;  3DGN A;  1NB5 I;  2A15 A;  1I2F A;  2R4I A;  1OUN A;  1W00 A;  3KCH A;  1UCK A;  4MMX B;  1ZGX A;  2UGI A;  3D5G A;  5M1A A;  7RNT A;  5BVB A;  1JNQ A;  4FR9 A;  1OF5 A;  2ZHX B;  1GY6 A;  1IVV A;  3CNX A;  8RNT A;  1OGX A;  2Z76 A;  3PXM A;  4WHA A;  1JKG A;  2RFR A;  3JUP A;  1IDP A;  5AYS C;  1B2U A;  3JUM A;  4FCM A;  3EX9 A;  4BL2 A;  2E2V A;  1T5Y A;  2IYJ A;  3G16 A;  4GSP A;  2IMJ A;  3QK9 A;  1JB2 A;  3L0R A;  3HOH A;  5EVH A;  3S67 A;  3CCL 3;  1C7H A;  3G4S 3;  1Y4K A;  1NO3 A;  2P05 A;  1PFP A;  2CIU A;  4L8P A;  3LTB A;  1O7M B;  1NNV A;  2PZV A;  3A76 A;  1RN7 A;  1FGQ A;  3A5E A;  4FMB A;  4MMZ B;  4H61 A;  2ML5 A;  4HM2 B;  4HZB B;  4Q53 A;  2QA4 3;  3D3L A;  1MWR A;  3D9R A;  1GS3 A;  5ELU A;  4HOH A;  1WTH A;  1OCV A;  5LC6 A;  1D6Z A;  1A2P A;  3D5I A;  1ASK A;  1IK3 A;  2CH9 A;  1G02 A;  4RNY A;  1BNR A;  1IU7 A;  1O7P B;  1U8C B;  1STF I;  1ZO2 A;  4O2H A;  1FUW A;  1AY7 A;  1RDS A;  5EQL A;  1VQ9 3;  1YI2 3;  4N3V A;  2HMM B;  3OV4 A;  3I56 3;  3B8L A;  1TIJ A;  3K9M C;  2E2U A;  4R4K A;  1BSD A;  2CFD A;  3V99 A;  3JVC A;  4XBT A;  5GSP A;  1VZZ A;  4LGQ A;  1EEJ A;  4X2O A;  1Q40 B;  2JDI H;  1VQM 3;  1RCL A;  3I55 3;  1FGR A;  4FMC A;  1X1X A;  4AEQ A;  2SAR A;  1J2B A;  4IT7 A;  1BNJ A;  1EQK A;  1ULJ B;  1DE3 A;  1B20 A;  1R4C A;  4N6O B;  1JBS A;  1IV7 A;  1TTO A;  2GU3 A;  1I2E A;  1BNS A;  4H3U A;  2J8X B;  4HBR A;  4R1K A;  4L8O A;  3K7C A;  3PGB A;  3KN4 A;  3RGA A;  4GL6 A;  3Q1C A;  2F56 A;  4N6V 0;  1IQX A;  2ZA4 A;  4N6T A;  4OUQ A;  1GMP A;  3NV0 B;  1GD4 A;  3JUQ A;  2WOF A;  3DM8 A;  1HU9 A;  2XRX B;  2ZDJ A;  3PS8 A;  4HM3 B;  1JBR A;  1OGZ A;  2XGL A;  1GYB A;  4J8T A;  4O3V A;  3LOY A;  2Z6B A;  1ZX2 A;  5CXO A;  1K9M 4;  3HI7 A;  1VQ4 3;  2OTJ 3;  3BB9 A;  4BU4 A;  4AKZ A;  1TRQ A;  3DGO A;  4KFD A;  1OHO A;  4KVH A;  2HOH A;  2Z7A A;  2WO0 A;  2XEP A;  3KSP A;  1DMQ A;  4O02 B;  1OH0 A;  2XFS A;  4K1U A;  3MWZ A;  5G1L A;  2GBX B;  1V57 A;  3DZL A;  5M19 A;  1WMP A;  3K0Z A;  4TX4 A;  1WQL B;  1W02 A;  3X3Y A;  3HK4 A;  3DGM A;  1VQN 3;  1AVK A;  2YFL B;  2BIR A;  4FCZ A;  5D83 A;  2FXT A;  4J5K A;  3PYJ A;  5DRV A;  2L4V A;  3ER7 A;  5AIH A;  1BAN A;  3GSP A;  3BNE A;  1UDI I;  3V92 A;  2XSH B;  4LEH A;  3LT8 A;  3BLZ A;  1STD A;  1RJO A;  4WP5 A;  1B3S A;  1GD3 A;  2CFL A;  4HM1 B;  2FNQ A;  4EV2 A;  2K54 A;  3UL6 A;  1BRN L;  5KP1 A;  1MNL A;  3F9S A;  3IPT A;  1PY3 A;  5BU4 A;  5FGO A;  3JUN A;  3VSY A;  5M18 A;  2CC3 A;  4EYC A;  5IF6 A;  1GOU A;  3LXU X;  1FW7 A;  1RMS A;  1DYU A;  2F4Y A;  1RCK A;  1KD1 4;  1YJ9 3;  2GBW B;  3MHE A;  4NPB A;  4RZM A;  2P0M A;  3G0K A;  2B24 B;  1ULI B;  3K63 A;  3NBR A;  1I2G A;  3LYG A;  1I8V A;  1VQP 3;  1N8Q A;  1RNT A;  1RRL A;  1GMQ A;  5KP3 A;  1HKX A;  2XR8 B;  1RGG A;  1W6G A;  4R80 A;  1Q42 A;  1BRJ A;  1UCL A;  2P38 A;  1N9E A;  1BRH A;  1GY7 A;  4RBN A;  4HM4 B;  1YGW A;  2HMO B;  3VF1 A;  1JJ2 2;  3SOY A;  1SII A;  1YVS A;  1EA2 A;  3FG4 A;  3S29 A;  4RNZ A;  3OWU A;  3CXC 2;  5CLK A;  1I0X A;  1UI8 A;  3HX8 A;  3NHX A;  1MWU A;  3G8Z A;  1VQL 3;  3CPO A;  3SED A;  1Q7Y 4;  3BNB A;  3DMC A;  3DY5 A;  1BRS A;  3PCS A;  5JPU A;  1NB3 I;  1TP6 A;  2CKF B;  3UNL A;  1C54 A;  4U13 A;  4L7K A;  1BIR A;  1Q40 A;  3KSE D;  5HGR A;  1EUI C;  8CHO A;  3WMD A;  5EEO A;  3EN8 A;  4LSO A;  2CG1 A;  3G6E 3;  3SXX A;  1YIJ 3;  3FLJ A;  4MEI A;  3EBY A;  2KXG A;  1Q86 4;  5AIG A;  3AGO A;  1GOY A;  1US1 A;  1BOX A;  1BNG A;  3URP A;  4FMD A;  1FGT A;  1I3F A;  3GWR A;  4I4K A;  1WMN A;  1G0T A;  3RDE A;  2H0H A;  2I9W A;  5AEW B;  1GSP A;  1V58 A;  2ZL8 A;  4LYL B;  2OWP A;  1IYY A;  2B1X B;  1VQ7 3;  5STD A;  3NV0 A;  2CK3 H;  3ECF A;  1ROV A;  1RRH A;  1W01 A;  1QVF 2;  4RNT A;  3DUK A;  3NXJ A;  2IUJ A;  1UGI A;  6STD A;  1BGS A;  1W2B 2;  3CCJ 3;  1BSA A;  3SOA A;  5CF1 A;  5RNT A;  1LVN A;  1WMO A;  3AGN A;  2MF7 A;  3UL5 A;  1E97 A;  1RGL A;  3LTC A;  3X3X A;  1DMN A;  4HM6 B;  4MJD A;  1SPU A;  3H3H A;  1B27 A;  1LXE A;  3OX9 A;  3OWY A;  1O7N B;  3PZW A;  2UX0 A;  3BIR A;  2IA7 A;  3MG3 A;  1DVC A;  1W6Y A;  3CD6 3;  2RBI A;  2GEY A;  4HM0 B;  2YFJ B;  1RN1 A;  3EJV A;  4N6M A;  5AIF A;  1JN5 A;  1JV2 B;  1RGF A;  2CFG A;  2HMN B;  1LNH A;  1ISK A;  1RGE A;  2F5M A;  1UCI A;  2MC8 A;  2CWU A;  1X1Y A;  5D82 A;  1LQM B;  3D4A A;  3O8Y A;  5TGN A;  4EV5 A;  1FUS A;  2YX9 A;  3NUV A;  1G96 A;  1MOL A;  5IG5 A;  3EN1 B;  5ELJ A;  2OQE A;  3SVA A;  1RLS A;  1SJW A;  2SBL A;  4XB5 A;  3MSO A;  2BMQ B;  2CWV A;  1HYF A;  1BUJ A;  1O7W B;  3T0U A;  4G1M B;  3B7C A;  1QAK A;  1CYV A;  1I0V A;  7GSP A;  3B4P A;  1A67 A;  3OWS A;  4EBG A;  2CG0 A;  3DH2 A;  1BU4 A;  1FYS A;  4O8S A;  1A90 A;  1T2I A;  5LC7 A;  1TUH A;  1Z1S A;  4J9A A;  1A2K A;  5CK6 A;  4QWT A;  1JB5 A;  3LML A;  1N8R 4;  5HOH A;  1JRQ A;  1Q7H A;  3CCU 3;  4XM4 A;  1M1X B;  2W2C A;  4HM5 B;  5IEN A;  3WOE B;  1MWT A;  1W6C A;  2LQV A;  3BU4 A;  3LT9 A;  4WYK B;  2W6J H;  3J7Y d;  1VQO 3;  1BSB A;  2OTL 3;  4EC6 A;  4AKY A;  1IQ8 A;  1I70 A;  1YVB I;  3F7X A;  4HM7 B;  3AMO B;  3S5C A;  3Q2P A;  2GSP A;  4MMY B;  1X1W A;  3LZA A;  7STD A;  2CX0 A;  1JN5 B;  4N6N B;  3RGR A;  3GZR A;  3ROB A;  1RSN A;  1BSE A;  4ZM8 A;  4JF8 A;  3IMA B;  1DMM A;  1EKM A;  3WA2 X;  4HZ9 B;  1K41 A;  3KZT A;  3WR2 A;  3CMA 3;  4JRF A;  3GRD A;  4IPB A;  3MPH A;  4CPK A;  2W04 A;  1QVG 2;  1W5Z A;  4HAA A;  5A0O B;  5IG3 A;  1GMR A;  1IQY A;  3FKA A;  1IVU A;  2BHM A;  3FSD A;  4J5G A;  2RSX A;  3U1W A;  4HKV B;  1KSI A;  2BU4 A;  2AAD A;  1YIT 3;  5IEP A;  2XGN A;  1YJW 3;  2HMJ B;  5IG0 A;  1E3V A;  2HML B;  1NU3 A;  5FW5 A;  4BL3 A;  1MGW A;  3CME 3;  1SQW A;  2XSO B;  3GZY B;  3LTD A;  1RGC A;  1JB4 A;  1OHP A;  2QEX 3;  1IT7 A;  2IUK A;  4N6L A;  1QAL A;  4LMI A;  4CJN A;  2W9Q A;  3CCQ 3;  2HMK B;  3CCR 3;  3SLU A;  1CEW I;  3DXO A;  1TU5 A;  1VQK 3;  4FCJ A;  4X2H A;  1M90 4;  3FCS B;  3EF8 A;  1SAR A;  3F40 A;  3LTA A;  3NQZ A;  4STD A;  5AYR B;  1TRP A;  1BSC A;  3KKG A;  4XDW A;  1PU4 A;  1M9G A;  5AII A;  5JPP A;  1D6U A;  3ZG0 A;  3NBJ A;  4EW5 A;  3M8C A;  3VGN A;  2OOV A;  4HJL B;  5BXQ A;  5IG4 A;  1RGK A;  2CW9 A;  1QMA A;  3NQY A;  2KF4 A;  3X40 A;  1NWW A;  1TFO A;  4K90 B;  1IVW A;  4XDV A;  1B2M A;  3AHW A;  3UB1 A;  1V74 A;  2C11 A;  2K0M A;  1UUV B;  1FUT A;  2IY2 A;  1KC8 4;  2GXF A;  1LOY A;  1BAO A;  1BNE A;  3GZX B;  3KE7 A;  3UJM A;  4BTX A;  2P09 A;  1UUW B;  1CYU A;  1GOV A;  2W03 A;  2BMR B;  3NX0 A;  2WGQ A;  5JBS A;  2BO9 B;  4ILF A;  2C4B A;  1RTU A;  3NM7 A;  1FGO A;  2F5W A;  2F86 B;  2Y73 A;  3BNC A;  4OVM A;  1B2S A;  4GB5 A;  5I97 A;  2W56 B;  5G2G A;  2R41 A;  1Q81 4;  3EE1 A;  1BVI A;  3EC9 A;  2CFK A;  4I5Q A;  1N9J A;  3OW2 2;  1B2Z A;  1UI7 A;  4XBY A;  1VQ5 3;  2F99 A;  2ML6 A;  4BTW A;  3PCR A;  3KFQ C;  1LOW A;  4KZ1 A;  1DVD A;  2OOV C;  1NDO B;  5DRE A;  2RGQ A;  1N5H A;  3SX1 A;  1RN4 A;  4CCV A;  5BIR A;  3IJE B;  1ZS7 A;  1BNF A;  4NHF A;  4WYK A;  1OHS A;  2H0I A;  3JUO A;  2QGU A;  2RCD A;  2XFT A;  4GHO A;  1YJN 3;  3NM2 A;  3E99 A;  4CDL A;  3AMO A;  3B4O A;  1W4N A;  1LOX A;  2C10 A;  2Y74 A;  1VQQ A;  2KF6 A;  2E2T A;  1UW1 A;  3MG1 A;  5IEO A;  3T8N A;  3X42 A;  6RNT A;  1CQS A;  2D1W A;  1IV9 A;  1YHQ 3;  5AEU B;  2O9U X;  2BNG A;  2W9P A;  2OCT A;  3FG3 A;  3EQQ B;  3STD A;  1IT8 A;  3CCS 3;  2W0Q A;  1FZU A;  4HM8 B;  1LNI A;  4PEJ A;  2STD A;  3HZP A;  2Z77 A;  3AHS A;  3F8X A;  4N6U A;  1T3B A;  2KRT A;  3ZG5 A;  4R9K A;  1VQ8 3;  3DGY A;  3WDG B;  3CU3 A;  3HII A;  3N9H A;  2CFW A;  2F98 A;  1ROA A;  1W7C A;  3EB8 A;  3V98 A;  2GU1 A;  3WA3 A;  1RHL A;  1RGA A;  3I0Y A;  1OF5 B;  1FA3 A;  3WOF B;  4KT3 B;  4NRE A;  2JQ5 A;  1HZ1 A;  1IVX A;  1KWI A;  2FGT A;  4IIA A;  4WFO A;  1LOV A;  1BRI A;  2KF3 A;  1JKG B;  2XH9 A;  3CNM A;  3FF2 A;  4DKI A;  1PYL A;  2GEX A;  1JZO A;  2M7O A;  5G1K A;  3FH1 A;  3WOD G;  6GSP A;  1AR0 A;  3Q90 A;  2L1S A;  9RNT A;  2CHC A;  3GAX A;  1YGE A;  1WNH A;  2P0X A;  1F8N A;  3CC7 3;  1TJD A;  1Q9E A;  3DGL A;  2QIY A;  3F7S A;  3HIG A;  3CC2 3;  1U5O A;  4LZI A;  1L5G B;  3LH4 A;  2K3D A;  3FF0 A;  4ORL A;  3TDG A;  2OQE C;  1N5P A;  1LQG C;  3CCE 3;  1MGR A;  1K28 A;  1R4Y A;  2BT3 A;  2LYX A;  1O7H B;  4K61 A;  5IW9 A;  1BUQ A;  3T8U A;  3FGY A;  1QAF A;  5D81 A;  5KP4 A;  1LRA A;  1NJI 4;  1B2X A;  1MWS A;  4EXR A;  3EHC A;  1OAC A;  3N8B A;  3Q3F A;  1RGH A;  4XBX A;  1YNV X;  3CPW 2;  3CC4 3;  1UGH I;  2H0G A;  3X3Z A;  5CF2 A;  2BMO B;  2V1L A;  3H51 A;  4KFF A;  1QJG A;  5AI1 A;  3RNT A;  2WOH A;  2KF5 A;  2XF3 A;  4OK0 A;  2UUG C;  1RKY A;  4BTY A;  3NBB A;  4K1V A;  1W2Z A;  2W56 A;  3FG1 A;  1AQZ A;  1GY5 A;  1S5A A;  2CX1 A;  1K73 4;  1BRG A;  1JBT A;  2D42 A;  1OPY A;  1VQ6 3;  1UUG B;  4HVN A;  2INX A;  3CCV 3;  1BRK A;  2AAE A;  3EBT A;  1D6Y A;  2Q07 A;  3ZFZ A;  3MYT A;  3WHO A;  1AVL A;  2KCD A;  3SYU A;  1DET A;  3GZB A;  4BIR A;  1I3I A;  4R9L A;  1A2V A;  3CCM 3;  1AV4 A;  1B21 A;  1UCJ A;  3FZW A;  3KII A;  5IER A;  1S72 3;  1Q82 4;  1RNB A;  2CWT A;  1SIH A;  3F14 A;  3N54 B;  3U97 A;  4FMA A;  2RNT A;  2YFI B;  1CH0 A;  3BND A;  1X1U A;  3S27 A;  3K5T A;  2WGO A;  4KFE A;  2O3O A;  3ALA A;  1K8A 4;  3D79 A;  1E3R A;  2KAA A;  1JZD A;  3X41 A;  1M1K 4;  4WWU C;  1BNI A;  4HYZ A;  3MG2 A;  3F8H A;  3OXA A;  3S28 A;  3QRD A;  2PNC A;  1KQS 2; 
#chains in the Genus database with same CATH homology
 1T2H A;  1GOU A;  1FW7 A;  1RMS A;  3BU4 A;  1I2F A;  2F4Y A;  1RCK A;  1BSB A;  3KCH A;  1UCK A;  1ZGX A;  7RNT A;  3D5G A;  1FZU A;  1I70 A;  1LNI A;  2GSP A;  1X1W A;  3AHS A;  1I2G A;  1RSN A;  1I8V A;  8RNT A;  1BSE A;  1RNT A;  1GMQ A;  3DGY A;  1RGG A;  3WR2 A;  1B2U A;  1BRJ A;  1UCL A;  4GSP A;  1BRH A;  1YGW A;  3HOH A;  4HAA A;  1YVS A;  1GMR A;  1RHL A;  1RGA A;  4J5G A;  1HZ1 A;  3A5E A;  1LOV A;  2BU4 A;  1BRI A;  2AAD A;  2KF3 A;  1I0X A;  1PYL A;  6GSP A;  4HOH A;  9RNT A;  1MGW A;  1BRS A;  1A2P A;  3D5I A;  1C54 A;  1BIR A;  1RGC A;  1G02 A;  1BNR A;  1Q9E A;  1AY7 A;  1RDS A;  3AGO A;  1GOY A;  1BOX A;  1BNG A;  1BSD A;  1SAR A;  3URP A;  1I3F A;  5GSP A;  1MGR A;  1TRP A;  1BSC A;  1R4Y A;  1IYY A;  1RCL A;  1GSP A;  1X1X A;  2SAR A;  1BNJ A;  1LRA A;  1B2X A;  1B20 A;  1DE3 A;  1JBS A;  4RNT A;  3Q3F A;  1RGH A;  1TTO A;  1YNV X;  1I2E A;  1RGK A;  1BNS A;  2KF4 A;  1BGS A;  1BSA A;  5RNT A;  2F56 A;  3AGN A;  2ZA4 A;  3RNT A;  2KF5 A;  1B2M A;  3AHW A;  1GMP A;  1RGL A;  1FUT A;  1B27 A;  1JBR A;  1AQZ A;  1LOY A;  1BAO A;  1BNE A;  3BIR A;  1BRG A;  1JBT A;  1GOV A;  2RBI A;  1BRK A;  4BU4 A;  1TRQ A;  2AAE A;  1RN1 A;  2C4B A;  1RGF A;  1RTU A;  2HOH A;  1RGE A;  2F5M A;  1UCI A;  2F5W A;  3WHO A;  1B2S A;  1X1Y A;  3SYU A;  1DET A;  4BIR A;  3D4A A;  1I3I A;  1FUS A;  1BVI A;  1B21 A;  1UCJ A;  1B2Z A;  1RLS A;  1RNB A;  2BIR A;  2RNT A;  4J5K A;  1LOW A;  1HYF A;  1BAN A;  1CH0 A;  1BUJ A;  1X1U A;  3GSP A;  1RN4 A;  1I0V A;  7GSP A;  5BIR A;  1BNF A;  3DH2 A;  1BU4 A;  1FYS A;  1T2I A;  4GHO A;  2KAA A;  1B3S A;  1BNI A;  5HOH A;  1BRN L;  5BU4 A;  1PY3 A;  2KF6 A;  6RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...