3KCHA

Baranase crosslinked by glutaraldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title Revisiting glutaraldehyde cross-linking: the case of the Arg-Lys intermolecular doublet
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3kchA00
8RNTA 1BRJA 3D5IA 2F56A 1BRNL 2F5WA 1BSCA 2F4YA 1BAOA 1RGKA 3SYUA 1LOYA 9RNTA 1G02A 1BRKA 2BIRA 1BRHA 3D4AA 1DE3A 1RGFA 1YGWA 2RBIA 1CH0A 1RGGA 4HOHA 4BU4A 2ZA4A 1FUTA 5BU4A 1BNRA 2KF4A 1BNFA 1X1UA 1LRAA 2KF5A 1R4YA 1RN1A 1BNSA 1RTUA 3RNTA 1B3SA 1RDSA 1BU4A 2GSPA 1RGHA 1BRSA 1I3IA 3GSPA 3AHWA 1UCJA 2RNTA 2KF3A 3BU4A 1TTOA 3AHSA 7GSPA 2AAEA 1GMPA 1BNJA 3Q3FA 1BANA 1RSNA 1B21A 1IYYA 1I0VA 1PYLA 1B2MA 1HYFA 4GSPA 1I3FA 1FUSA 1LOWA 2HOHA 1B20A 1GSPA 5GSPA 3AGOA 1FZUA 1RMSA 1BSAA 1B2UA 1I70A 1RHLA 1RGAA 1AQZA 1I2GA 1A2PA 1BNIA 1BRIA 3D5GA 4BIRA 4RNTA 1BSDA 1UCIA 1B27A 1MGWA 1Q9EA 1GOYA 1FYSA 7RNTA 1RNBA 1GMQA 1BNEA 1FW7A 1RGCA 1T2HA 5RNTA 1GMRA 1X1WA 1BRGA 2BU4A 1X1XA 3URPA 4GHOA 3DGYA 4HAAA 1BIRA 1BSBA 1RGEA 3BIRA 1BSEA 1I0XA 1B2ZA 1UCKA 1RCKA 1LNIA 1DETA 1AY7A 2KF6A 2C4BA 5BIRA 1BVIA 2SARA 3HOHA 1B2SA 1RN4A 1C54A 1YVSA 2F5MA 1HZ1A 1RLSA 1LOVA 1T2IA 1GOVA 1UCLA 1TRQA 1JBSA 1JBRA 1I2EA 6RNTA 3AGNA 1PY3A 1TRPA 2AADA 4J5GA 1BGSA 1X1YA 3WR2A 1RCLA 1I8VA 1RGLA 3A5EA 1RNTA 1I2FA 1SARA 3KCHA 4J5KA 1YNVX 5HOHA 3WHOA 1MGRA 3DH2A 1GOUA 1JBTA 1B2XA 1ZGXA 1BOXA 2KAAA 1BUJA 1BNGA 6GSPA
chains in the Genus database with same CATH superfamily
3EHCA 1K41A 3X41A 1PU4A 1BRJA 4GB5A 5JPPA 4LMIA 2W9PA 1HKXA 1RGKA 3SYUA 2WGOA 3B4PA 1UUGB 1W4NA 1WMOA 4JF8A 2YFLB 3UNLA 1A2KA 3S28A 5ELUA 1DE3A 1YGWA 1Q7Y4 2CFKA 5CF1A 1RGGA 3MWZA 3DXOA 1YHQ3 3CCM3 3UB1A 2ZA4A 5BU4A 2GEXA 1BNRA 3EE1A 4N6UA 1MOLA 3HZPA 2CFLA 1LRAA 5AYRB 1BNSA 3T8UA 3LTBA 3OV4A 2WOHA 3FKAA 1EEJA 1I3IA 2MF7A 3HIIA 1A2VA 3EBYA 2HMMB 3HK4A 1W6CA 3F7SA 4LYLB 5D81A 2KF3A 5EQLA 3RGRA 4WFOA 1TP6A 1ZX2A 3S67A 3OWYA 3Q1CA 4CCVA 3ER7A 1N5PA 4O3VA 3I553 2W03A 3I0YA 2AAEA 3Q3FA 1MWSA 1QJGA 1BANA 4MMYB 4O2HA 1N8QA 1IYYA 1I0VA 1VQ73 2B24B 5LC6A 3DM8A 3SVAA 5G1KA 8CHOA 1NB3I 5D83A 1VQ53 1NU3A 1OHOA 3GZXB 4EXRA 2A15A 2FGTA 3NBRA 1CEWI 3MG1A 2W6JH 3PZWA 4FR9A 4XDVA 1W00A 3EC9A 4BTYA 1BSAA 1B2UA 2GU3A 3HI7A 3KSPA 1RGAA 1Q7HA 3GZYB 2P05A 4TX4A 5BXQA 3AMOB 1OACA 2CKFB 5IW9A 4ORLA 1HU9A 3AMOA 1BRIA 3BB9A 3FG3A 6GSPA 3LZAA 1Z1SA 3FG1A 3OWUA 3D3LA 3BNEA 1G96A 4FCMA 2CFWA 3N54B 3MG2A 3NX0A 2LYXA 3GAXA 2ZL8A 1FW7A 1T2HA 1GMRA 2B1XB 3F7XA 3RGAA 2BU4A 3FG4A 3URPA 4HAAA 4R9KA 1VQL3 1JJ22 1KQS2 2XSHB 4G1MB 1BSEA 1ULIB 2JQ5A 4L8OA 2Z7AA 1V74A 3LYGA 1YGEA 1OHPA 2CWTA 1AY7A 1MWRA 1IT8A 4IT7A 5TGNA 1B2SA 2C10A 1TIJA 3UJMA 3FCSB 3IMAB 4HM5B 1PFPA 4EV2A 1STFI 2IA7A 3EF8A 1RLSA 1LOVA 1T2IA 3CME3 3IPTA 4HM0B 2CX1A 3PGBA 4LSOA 4OVMA 4QWTA 2R4IA 5IF6A 5M19A 1TRPA 3CD63 3V98A 3B4OA 1Q42A 1X1YA 3JUOA 3WR2A 1KD14 1S5AA 1SPUA 1OF5B 3Q2PA 4K1UA 1LQMB 4FCZA 7STDA 1VQM3 1OF5A 1N8R4 2XSOB 3K5TA 1FUWA 1MGRA 3DH2A 1EUIC 1VQQA 4R4KA 1GOUA 4BTWA 3D9RA 1OPYA 4N6LA 3KZTA 1QAFA 2KAAA 1JBTA 3NV0A 1BNGA 1JKGA 1GD3A 3LT9A 1WTHA 1VQN3 3LH4A 2F5WA 1BRNL 1BSCA 9RNTA 3QK9A 3DGNA 2D42A 3IJEB 2GXFA 2KXGA 2BIRA 2C11A 2RCDA 1CH0A 4NREA 4BU4A 2FXTA 2GU1A 1FUTA 3ROBA 1FGRA 5G2GA 2L1SA 4HM7B 1IV7A 3RNTA 1RTUA 5CLKA 1US1A 1VQK3 1RDSA 1TUHA 2GSPA 3KE7A 4O02B 2QEX3 3AHWA 1C7HA 4BL2A 4IIAA 2RNTA 2RFRA 1GY6A 5KP4A 1G0TA 4HVNA 5KP3A 3AHSA 3FF2A 1IQ8A 1M9GA 1RRHA 3CPOA 5FGOA 4EBGA 3S27A 4N6OB 3K7CA 1Y4KA 1RSNA 2MC8A 1RJOA 3CU3A 2PNCA 1PYLA 2J8XB 4AKZA 3OWSA 1EG9B 3NHXA 3V92A 1U8CB 4X2HA 2CFGA 3K63A 1I3FA 3DUKA 4N6NB 3G6E3 3KN4A 1B20A 3H3HA 1E97A 2UGIA 5STDA 3X40A 2W0QA 3X3XA 1EQKA 3JUMA 3AGOA 5CXOA 3DMCA 2IYJA 5FW5A 1KWIA 1W7CA 1AQZA 4L8PA 1A90A 2L4VA 3D5GA 4BIRA 4RNTA 2CG1A 1JRQA 2GEYA 3VF1A 1JB5A 1A67A 3CCR3 2W56B 3MG3A 1BUQA 1UI8A 3EN1B 4HYZA 5M18A 1IQXA 3FLJA 1LXEA 1TU5A 2BMOB 1X1WA 5IERA 4MJDA 2HMKB 1BRGA 1X1XA 1DVCA 2H0GA 3NQYA 3CCL3 1BSBA 3BIRA 4WYKB 5AIFA 2CK3H 2P38A 4FCJA 4WP5A 3CCV3 4HKVB 3F9SA 5KP1A 2YX9A 1LNIA 1DETA 3KFQC 2W2CA 1K734 1JV2B 1O7GB 3DGLA 5BIRA 4FMBA 2SARA 4MMXB 3LTAA 4RNZA 3QRDA 3OXAA 5EVHA 1IVWA 4H61A 1UDII 1EA2A 4AEQA 1MWUA 1HZ1A 1N9JA 4Q53A 5EEOA 3G4S3 1K8A4 2OCTA 1LQGC 2OOVC 1RRLA 3FF0A 2OOVA 1JBSA 3S5CA 3CCU3 2CW9A 2CWUA 3AGNA 5JBSA 1PY3A 1Q40B 1FGTA 1JN5B 1NO3A 3HIGA 3OX9A 4HM8B 3RDEA 1SIHA 1OGXA 4CDLA 5A0OB 1Q40A 1UI7A 1JN5A 2CH9A 4MMZB 3TDGA 4EV5A 1YJ93 1QMAA 4KZ1A 4LGQA 1ULJB 1DYUA 1RNTA 1GYBA 1STDA 4XBYA 1I2FA 1SARA 3KCHA 3ZG5A 1VQO3 1NDOB 1VQ83 1W2ZA 2CFDA 1W6YA 3VGNA 3WHOA 3ZFZA 3O8YA 1RKYA 6STDA 2BNGA 1K9M4 2P0MA 3S29A 8RNTA 2BHMA 2F56A 5CK6A 3F8HA 3EQQB 1BAOA 4CPKA 2BMQB 1OCVA 4DKIA 1G02A 1BRKA 1AV4A 5ELJA 2E2UA 1BRHA 3D4AA 1RGFA 2RBIA 4EW5A 3B8LA 1UUWB 3SLUA 3U97A 5AEWB 4HOHA 1IU7A 4HZ9B 1FA3A 1TJDA 2R41A 3A76A 1L5GB 1FGQA 1X1UA 1N5HA 2KF5A 2WO0A 3BNCA 1YIJ3 1UGHI 3WOEB 5D82A 5G1LA 4HM2B 2KCDA 4HZBB 1V57A 4RZMA 5AYSC 3NM2A 1RGHA 3X3ZA 1WNHA 3GSPA 5IENA 1NJI4 5IG4A 3SOYA 1M1K4 3BNDA 1O7MB 3NBBA 1TFKA 3BU4A 3LTCA 4PEJA 1QVG2 3MHEA 3LXUX 1NWWA 7GSPA 2STDA 4KFDA 2BO9B 1GMPA 4N6V0 2K0MA 4J8TA 4EYCA 2CIUA 4J9AA 1IVXA 4ILFA 4L7KA 1D6UA 3FH1A 5IEPA 1HYFA 1IT7A 2CWVA 1N9EA 3K9MC 3JUNA 2K3DA 4GSPA 1LOWA 2HOHA 4K61A 3T0UA 2FNQA 1UUVB 3LOYA 3NQZA 4XB5A 1FZUA 4EC6A 3CC23 3LTDA 1Q814 4FMDA 4N6TA 4HM1B 2GBWB 1SJWA 4RNYA 1WQLB 4OK0A 4N3VA 2CHCA 1A2PA 1VZZA 2SBLA 4HJLB 1WMPA 1LNHA 1OUNA 5BVBA 4HBRA 4KFEA 3SX1A 1MGWA 4XBXA 4R1KA 1Q9EA 1GOYA 1CYVA 1FYSA 1UGIA 7RNTA 1GMQA 3J7Yd 1OHSA 1GY5A 2OWPA 5RNTA 2HMNB 2O9UX 4I4KA 3GWRA 1JB2A 1M1XB 4OUQA 4GL6A 3CCS3 2W9QA 3EBTA 1O7WB 3DGYA 3N9HA 3X42A 4HM6B 4WWUC 3CNXA 1B2ZA 3LT8A 1RCKA 1VQ63 2JDIH 2XFTA 3NBJA 1QALA 2KF6A 2C4BA 1W2B2 1ROAA 4H3UA 1GD4A 4X2OA 3WOFB 1YVSA 2F99A 1JZDA 2ZHXB 3MKIA 1GOVA 1MWTA 3CNMA 2XGNA 2F86B 3PXMA 1YVBI 2CG0A 1K28A 1TRQA 3PCRA 2V1LA 2ZDJA 1VQ93 1IV9A 1SQWA 1JBRA 1AR0A 1IK3A 4K1VA 3CPW2 4N6MA 2W56A 3I563 1ZO2A 1QVF2 2H0IA 1LVNA 4LEHA 1JB4A 3NM7A 4J5GA 3N8BA 4KVHA 5DRVA 3SOAA 1RN7A 4R80A 1RCLA 1CYUA 1I8VA 2E2VA 3F8XA 3T8NA 5CF2A 3MPHA 1VQ43 4J5KA 4WYKA 1YJN3 4HM3B 4HM4B 2M7OA 3FGYA 3SXXA 5IG5A 1ISKA 3EB8A 1KC84 3ZG0A 1DMNA 1OGZA 1ZGXA 3DGOA 1O7NB 2ML5A 3CMA3 4NPBA 2CX0A 4FMAA 2XF3A 3PS8A 3DY5A 1U5OA 3D5IA 2F4YA 3MYTA 1LOYA 3JUPA 4R9LA 4BL3A 2WOFA 3FSDA 1TFOA 3KKGA 2IMJA 3GRDA 5AEUB 2XGLA 1D6YA 3WA2X 3H51A 2RGQA 1Q864 4WHAA 2Y73A 3LMLA 3CC43 5AIGA 2KF4A 2UUGC 3WODG 1BNFA 2YFJB 2H0HA 3PCSA 3OW22 5IEOA 2P09A 1R4YA 1RN1A 2O3OA 4IPBA 2INXA 4BTXA 1AVLA 1B3SA 1DMQA 3CCQ3 1BU4A 1EKMA 1IVVA 2Q07A 2Z6BA 2OQEC 1BRSA 3G8ZA 3M8CA 2OQEA 4ZM8A 3UL5A 1JNQA 1UCJA 5I97A 2HMOB 3CCE3 3JUQA 1DVDA 3E99A 2UX0A 3MSOA 1Q824 1T5YA 1W5ZA 3EN8A 1OH0A 1TTOA 5HGRA 4U13A 2YFIB 5AI1A 2HMLB 3EJVA 1BNJA 2ML6A 1J2BA 2OTJ3 1WMNA 4I5QA 4KFFA 1B21A 3K0ZA 3UL6A 1B2MA 1LOXA 1NNVA 2D1WA 3ECFA 3KIIA 5AIIA 2QA43 1QAKA 1AVKA 1FUSA 3STDA 4AKYA 2XH9A 1GSPA 3ALAA 1YJW3 4XDWA 2XFSA 5GSPA 1VQP3 1MNLA 1RMSA 1I70A 1RHLA 2E2TA 2K54A 4K90B 3NXJA 4O8SA 5LC7A 3HX8A 3WDGB 1I2GA 5AIHA 1YI23 2IUJA 2LQVA 5IG0A 1FGMA 1BNIA 5DREA 3CCJ3 1F8NA 2XEPA 3DGMA 1BSDA 1UCIA 1B27A 1W6GA 3DZLA 3NUVA 2QGUA 2HMJB 3GZRA 4NHFA 3WMDA 1E3VA 5M1AA 3Q90A 1RNBA 3U1WA 3BLZA 3KSED 1BNEA 1D6ZA 1RGCA 1M904 4RBNA 1DMMA 1O7HB 1O7PB 1IVUA 1ZS7A 4FMCA 4XM4A 2OTL3 4XBTA 2P0XA 4GHOA 3FZWA 1BIRA 1RGEA 4KT3B 2IY2A 3F14A 1I0XA 1SIIA 1UCKA 5JPUA 2RSXA 4LZIA 2BMRB 1W01A 3F40A 1BVIA 3EX9A 3HOHA 1IQYA 1FGOA 1RN4A 1ROVA 3B7CA 2Y74A 1KSIA 1JKGB 3NV0B 1C54A 2IUKA 1T3BA 2F5MA 2XR8B 2Z76A 3SEDA 2I9WA 1GS3A 1UCLA 2BT3A 3L0RA 3CXC2 1YIT3 4MEIA 1I2EA 6RNTA 3D79A 1JZOA 2GBXB 3BNBA 2W04A 3G713 3CC73 2F98A 3G0KA 3V99A 4STDA 2AADA 2XRXB 1BGSA 3X3YA 1CQSA 2WGQA 1E3RA 1RGLA 3WA3A 2Z77A 4JRFA 3A5EA 2QIYA 1V58A 1S723 1IDPA 1UW1A 1R4CA 1YNVX 3VSYA 3GZBA 5HOHA 5IG3A 1GY7A 2KRTA 3JVCA 1ASKA 4CJNA 1W02A 1NB5I 1B2XA 1BOXA 3G16A 3PYJA 1BUJA 2CC3A 2PZVA
chains in the Genus database with same CATH topology
8RNTA 1BRJA 3D5IA 2F56A 1BRNL 2F5WA 1BSCA 2F4YA 1BAOA 1RGKA 3SYUA 1LOYA 9RNTA 1G02A 1BRKA 2BIRA 1BRHA 3D4AA 1DE3A 1RGFA 1YGWA 2RBIA 1CH0A 1RGGA 4HOHA 4BU4A 2ZA4A 1FUTA 5BU4A 1BNRA 2KF4A 1BNFA 1X1UA 1LRAA 2KF5A 1R4YA 1RN1A 1BNSA 1RTUA 3RNTA 1B3SA 1RDSA 1BU4A 2GSPA 1RGHA 1BRSA 1I3IA 3GSPA 3AHWA 1UCJA 2RNTA 2KF3A 3BU4A 1TTOA 3AHSA 7GSPA 2AAEA 1GMPA 1BNJA 3Q3FA 1BANA 1RSNA 1B21A 1IYYA 1I0VA 1PYLA 1B2MA 1HYFA 4GSPA 1I3FA 1FUSA 1LOWA 2HOHA 1B20A 1GSPA 5GSPA 3AGOA 1FZUA 1RMSA 1BSAA 1B2UA 1I70A 1RHLA 1RGAA 1AQZA 1I2GA 1A2PA 1BNIA 1BRIA 3D5GA 4BIRA 4RNTA 1BSDA 1UCIA 1B27A 1MGWA 1Q9EA 1GOYA 1FYSA 7RNTA 1RNBA 1GMQA 1BNEA 1FW7A 1RGCA 1T2HA 5RNTA 1GMRA 1X1WA 1BRGA 2BU4A 1X1XA 3URPA 4GHOA 3DGYA 4HAAA 1BIRA 1BSBA 1RGEA 3BIRA 1BSEA 1I0XA 1B2ZA 1UCKA 1RCKA 1LNIA 1DETA 1AY7A 2KF6A 2C4BA 5BIRA 1BVIA 2SARA 3HOHA 1B2SA 1RN4A 1C54A 1YVSA 2F5MA 1HZ1A 1RLSA 1LOVA 1T2IA 1GOVA 1UCLA 1TRQA 1JBSA 1JBRA 1I2EA 6RNTA 3AGNA 1PY3A 1TRPA 2AADA 4J5GA 1BGSA 1X1YA 3WR2A 1RCLA 1I8VA 1RGLA 3A5EA 1RNTA 1I2FA 1SARA 3KCHA 4J5KA 1YNVX 5HOHA 3WHOA 1MGRA 3DH2A 1GOUA 1JBTA 1B2XA 1ZGXA 1BOXA 2KAAA 1BUJA 1BNGA 6GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8RNT A;  1BRJ A;  3D5I A;  2F56 A;  1BRN L;  2F5W A;  1BSC A;  2F4Y A;  1BAO A;  1RGK A;  3SYU A;  1LOY A;  9RNT A;  1G02 A;  1BRK A;  2BIR A;  1BRH A;  3D4A A;  1DE3 A;  1RGF A;  1YGW A;  2RBI A;  1CH0 A;  1RGG A;  4HOH A;  4BU4 A;  2ZA4 A;  1FUT A;  5BU4 A;  1BNR A;  2KF4 A;  1BNF A;  1X1U A;  1LRA A;  2KF5 A;  1R4Y A;  1RN1 A;  1BNS A;  1RTU A;  3RNT A;  1B3S A;  1RDS A;  1BU4 A;  2GSP A;  1RGH A;  1BRS A;  1I3I A;  3GSP A;  3AHW A;  1UCJ A;  2RNT A;  2KF3 A;  3BU4 A;  1TTO A;  3AHS A;  7GSP A;  2AAE A;  1GMP A;  1BNJ A;  3Q3F A;  1BAN A;  1RSN A;  1B21 A;  1IYY A;  1I0V A;  1PYL A;  1B2M A;  1HYF A;  4GSP A;  1I3F A;  1FUS A;  1LOW A;  2HOH A;  1B20 A;  1GSP A;  5GSP A;  3AGO A;  1FZU A;  1RMS A;  1BSA A;  1B2U A;  1I70 A;  1RHL A;  1RGA A;  1AQZ A;  1I2G A;  1A2P A;  1BNI A;  1BRI A;  3D5G A;  4BIR A;  4RNT A;  1BSD A;  1UCI A;  1B27 A;  1MGW A;  1Q9E A;  1GOY A;  1FYS A;  7RNT A;  1RNB A;  1GMQ A;  1BNE A;  1FW7 A;  1RGC A;  1T2H A;  5RNT A;  1GMR A;  1X1W A;  1BRG A;  2BU4 A;  1X1X A;  3URP A;  4GHO A;  3DGY A;  4HAA A;  1BIR A;  1BSB A;  1RGE A;  3BIR A;  1BSE A;  1I0X A;  1B2Z A;  1UCK A;  1RCK A;  1LNI A;  1DET A;  1AY7 A;  2KF6 A;  2C4B A;  5BIR A;  1BVI A;  2SAR A;  3HOH A;  1B2S A;  1RN4 A;  1C54 A;  1YVS A;  2F5M A;  1HZ1 A;  1RLS A;  1LOV A;  1T2I A;  1GOV A;  1UCL A;  1TRQ A;  1JBS A;  1JBR A;  1I2E A;  6RNT A;  3AGN A;  1PY3 A;  1TRP A;  2AAD A;  4J5G A;  1BGS A;  1X1Y A;  3WR2 A;  1RCL A;  1I8V A;  1RGL A;  3A5E A;  1RNT A;  1I2F A;  1SAR A;  3KCH A;  4J5K A;  1YNV X;  5HOH A;  3WHO A;  1MGR A;  3DH2 A;  1GOU A;  1JBT A;  1B2X A;  1ZGX A;  1BOX A;  2KAA A;  1BUJ A;  1BNG A;  6GSP A; 
#chains in the Genus database with same CATH topology
 3EHC A;  1K41 A;  3X41 A;  1PU4 A;  1BRJ A;  4GB5 A;  5JPP A;  4LMI A;  2W9P A;  1HKX A;  1RGK A;  3SYU A;  2WGO A;  3B4P A;  1UUG B;  1W4N A;  1WMO A;  4JF8 A;  2YFL B;  3UNL A;  1A2K A;  3S28 A;  5ELU A;  1DE3 A;  1YGW A;  1Q7Y 4;  2CFK A;  5CF1 A;  1RGG A;  3MWZ A;  3DXO A;  1YHQ 3;  3CCM 3;  3UB1 A;  2ZA4 A;  5BU4 A;  2GEX A;  1BNR A;  3EE1 A;  4N6U A;  1MOL A;  3HZP A;  2CFL A;  1LRA A;  5AYR B;  1BNS A;  3T8U A;  3LTB A;  3OV4 A;  2WOH A;  3FKA A;  1EEJ A;  1I3I A;  2MF7 A;  3HII A;  1A2V A;  3EBY A;  2HMM B;  3HK4 A;  1W6C A;  3F7S A;  4LYL B;  5D81 A;  2KF3 A;  5EQL A;  3RGR A;  4WFO A;  1TP6 A;  1ZX2 A;  3S67 A;  3OWY A;  3Q1C A;  4CCV A;  3ER7 A;  1N5P A;  4O3V A;  3I55 3;  2W03 A;  3I0Y A;  2AAE A;  3Q3F A;  1MWS A;  1QJG A;  1BAN A;  4MMY B;  4O2H A;  1N8Q A;  1IYY A;  1I0V A;  1VQ7 3;  2B24 B;  5LC6 A;  3DM8 A;  3SVA A;  5G1K A;  8CHO A;  1NB3 I;  5D83 A;  1VQ5 3;  1NU3 A;  1OHO A;  3GZX B;  4EXR A;  2A15 A;  2FGT A;  3NBR A;  1CEW I;  3MG1 A;  2W6J H;  3PZW A;  4FR9 A;  4XDV A;  1W00 A;  3EC9 A;  4BTY A;  1BSA A;  1B2U A;  2GU3 A;  3HI7 A;  3KSP A;  1RGA A;  1Q7H A;  3GZY B;  2P05 A;  4TX4 A;  5BXQ A;  3AMO B;  1OAC A;  2CKF B;  5IW9 A;  4ORL A;  1HU9 A;  3AMO A;  1BRI A;  3BB9 A;  3FG3 A;  6GSP A;  3LZA A;  1Z1S A;  3FG1 A;  3OWU A;  3D3L A;  3BNE A;  1G96 A;  4FCM A;  2CFW A;  3N54 B;  3MG2 A;  3NX0 A;  2LYX A;  3GAX A;  2ZL8 A;  1FW7 A;  1T2H A;  1GMR A;  2B1X B;  3F7X A;  3RGA A;  2BU4 A;  3FG4 A;  3URP A;  4HAA A;  4R9K A;  1VQL 3;  1JJ2 2;  1KQS 2;  2XSH B;  4G1M B;  1BSE A;  1ULI B;  2JQ5 A;  4L8O A;  2Z7A A;  1V74 A;  3LYG A;  1YGE A;  1OHP A;  2CWT A;  1AY7 A;  1MWR A;  1IT8 A;  4IT7 A;  5TGN A;  1B2S A;  2C10 A;  1TIJ A;  3UJM A;  3FCS B;  3IMA B;  4HM5 B;  1PFP A;  4EV2 A;  1STF I;  2IA7 A;  3EF8 A;  1RLS A;  1LOV A;  1T2I A;  3CME 3;  3IPT A;  4HM0 B;  2CX1 A;  3PGB A;  4LSO A;  4OVM A;  4QWT A;  2R4I A;  5IF6 A;  5M19 A;  1TRP A;  3CD6 3;  3V98 A;  3B4O A;  1Q42 A;  1X1Y A;  3JUO A;  3WR2 A;  1KD1 4;  1S5A A;  1SPU A;  1OF5 B;  3Q2P A;  4K1U A;  1LQM B;  4FCZ A;  7STD A;  1VQM 3;  1OF5 A;  1N8R 4;  2XSO B;  3K5T A;  1FUW A;  1MGR A;  3DH2 A;  1EUI C;  1VQQ A;  4R4K A;  1GOU A;  4BTW A;  3D9R A;  1OPY A;  4N6L A;  3KZT A;  1QAF A;  2KAA A;  1JBT A;  3NV0 A;  1BNG A;  1JKG A;  1GD3 A;  3LT9 A;  1WTH A;  1VQN 3;  3LH4 A;  2F5W A;  1BRN L;  1BSC A;  9RNT A;  3QK9 A;  3DGN A;  2D42 A;  3IJE B;  2GXF A;  2KXG A;  2BIR A;  2C11 A;  2RCD A;  1CH0 A;  4NRE A;  4BU4 A;  2FXT A;  2GU1 A;  1FUT A;  3ROB A;  1FGR A;  5G2G A;  2L1S A;  4HM7 B;  1IV7 A;  3RNT A;  1RTU A;  5CLK A;  1US1 A;  1VQK 3;  1RDS A;  1TUH A;  2GSP A;  3KE7 A;  4O02 B;  2QEX 3;  3AHW A;  1C7H A;  4BL2 A;  4IIA A;  2RNT A;  2RFR A;  1GY6 A;  5KP4 A;  1G0T A;  4HVN A;  5KP3 A;  3AHS A;  3FF2 A;  1IQ8 A;  1M9G A;  1RRH A;  3CPO A;  5FGO A;  4EBG A;  3S27 A;  4N6O B;  3K7C A;  1Y4K A;  1RSN A;  2MC8 A;  1RJO A;  3CU3 A;  2PNC A;  1PYL A;  2J8X B;  4AKZ A;  3OWS A;  1EG9 B;  3NHX A;  3V92 A;  1U8C B;  4X2H A;  2CFG A;  3K63 A;  1I3F A;  3DUK A;  4N6N B;  3G6E 3;  3KN4 A;  1B20 A;  3H3H A;  1E97 A;  2UGI A;  5STD A;  3X40 A;  2W0Q A;  3X3X A;  1EQK A;  3JUM A;  3AGO A;  5CXO A;  3DMC A;  2IYJ A;  5FW5 A;  1KWI A;  1W7C A;  1AQZ A;  4L8P A;  1A90 A;  2L4V A;  3D5G A;  4BIR A;  4RNT A;  2CG1 A;  1JRQ A;  2GEY A;  3VF1 A;  1JB5 A;  1A67 A;  3CCR 3;  2W56 B;  3MG3 A;  1BUQ A;  1UI8 A;  3EN1 B;  4HYZ A;  5M18 A;  1IQX A;  3FLJ A;  1LXE A;  1TU5 A;  2BMO B;  1X1W A;  5IER A;  4MJD A;  2HMK B;  1BRG A;  1X1X A;  1DVC A;  2H0G A;  3NQY A;  3CCL 3;  1BSB A;  3BIR A;  4WYK B;  5AIF A;  2CK3 H;  2P38 A;  4FCJ A;  4WP5 A;  3CCV 3;  4HKV B;  3F9S A;  5KP1 A;  2YX9 A;  1LNI A;  1DET A;  3KFQ C;  2W2C A;  1K73 4;  1JV2 B;  1O7G B;  3DGL A;  5BIR A;  4FMB A;  2SAR A;  4MMX B;  3LTA A;  4RNZ A;  3QRD A;  3OXA A;  5EVH A;  1IVW A;  4H61 A;  1UDI I;  1EA2 A;  4AEQ A;  1MWU A;  1HZ1 A;  1N9J A;  4Q53 A;  5EEO A;  3G4S 3;  1K8A 4;  2OCT A;  1LQG C;  2OOV C;  1RRL A;  3FF0 A;  2OOV A;  1JBS A;  3S5C A;  3CCU 3;  2CW9 A;  2CWU A;  3AGN A;  5JBS A;  1PY3 A;  1Q40 B;  1FGT A;  1JN5 B;  1NO3 A;  3HIG A;  3OX9 A;  4HM8 B;  3RDE A;  1SIH A;  1OGX A;  4CDL A;  5A0O B;  1Q40 A;  1UI7 A;  1JN5 A;  2CH9 A;  4MMZ B;  3TDG A;  4EV5 A;  1YJ9 3;  1QMA A;  4KZ1 A;  4LGQ A;  1ULJ B;  1DYU A;  1RNT A;  1GYB A;  1STD A;  4XBY A;  1I2F A;  1SAR A;  3KCH A;  3ZG5 A;  1VQO 3;  1NDO B;  1VQ8 3;  1W2Z A;  2CFD A;  1W6Y A;  3VGN A;  3WHO A;  3ZFZ A;  3O8Y A;  1RKY A;  6STD A;  2BNG A;  1K9M 4;  2P0M A;  3S29 A;  8RNT A;  2BHM A;  2F56 A;  5CK6 A;  3F8H A;  3EQQ B;  1BAO A;  4CPK A;  2BMQ B;  1OCV A;  4DKI A;  1G02 A;  1BRK A;  1AV4 A;  5ELJ A;  2E2U A;  1BRH A;  3D4A A;  1RGF A;  2RBI A;  4EW5 A;  3B8L A;  1UUW B;  3SLU A;  3U97 A;  5AEW B;  4HOH A;  1IU7 A;  4HZ9 B;  1FA3 A;  1TJD A;  2R41 A;  3A76 A;  1L5G B;  1FGQ A;  1X1U A;  1N5H A;  2KF5 A;  2WO0 A;  3BNC A;  1YIJ 3;  1UGH I;  3WOE B;  5D82 A;  5G1L A;  4HM2 B;  2KCD A;  4HZB B;  1V57 A;  4RZM A;  5AYS C;  3NM2 A;  1RGH A;  3X3Z A;  1WNH A;  3GSP A;  5IEN A;  1NJI 4;  5IG4 A;  3SOY A;  1M1K 4;  3BND A;  1O7M B;  3NBB A;  1TFK A;  3BU4 A;  3LTC A;  4PEJ A;  1QVG 2;  3MHE A;  3LXU X;  1NWW A;  7GSP A;  2STD A;  4KFD A;  2BO9 B;  1GMP A;  4N6V 0;  2K0M A;  4J8T A;  4EYC A;  2CIU A;  4J9A A;  1IVX A;  4ILF A;  4L7K A;  1D6U A;  3FH1 A;  5IEP A;  1HYF A;  1IT7 A;  2CWV A;  1N9E A;  3K9M C;  3JUN A;  2K3D A;  4GSP A;  1LOW A;  2HOH A;  4K61 A;  3T0U A;  2FNQ A;  1UUV B;  3LOY A;  3NQZ A;  4XB5 A;  1FZU A;  4EC6 A;  3CC2 3;  3LTD A;  1Q81 4;  4FMD A;  4N6T A;  4HM1 B;  2GBW B;  1SJW A;  4RNY A;  1WQL B;  4OK0 A;  4N3V A;  2CHC A;  1A2P A;  1VZZ A;  2SBL A;  4HJL B;  1WMP A;  1LNH A;  1OUN A;  5BVB A;  4HBR A;  4KFE A;  3SX1 A;  1MGW A;  4XBX A;  4R1K A;  1Q9E A;  1GOY A;  1CYV A;  1FYS A;  1UGI A;  7RNT A;  1GMQ A;  3J7Y d;  1OHS A;  1GY5 A;  2OWP A;  5RNT A;  2HMN B;  2O9U X;  4I4K A;  3GWR A;  1JB2 A;  1M1X B;  4OUQ A;  4GL6 A;  3CCS 3;  2W9Q A;  3EBT A;  1O7W B;  3DGY A;  3N9H A;  3X42 A;  4HM6 B;  4WWU C;  3CNX A;  1B2Z A;  3LT8 A;  1RCK A;  1VQ6 3;  2JDI H;  2XFT A;  3NBJ A;  1QAL A;  2KF6 A;  2C4B A;  1W2B 2;  1ROA A;  4H3U A;  1GD4 A;  4X2O A;  3WOF B;  1YVS A;  2F99 A;  1JZD A;  2ZHX B;  3MKI A;  1GOV A;  1MWT A;  3CNM A;  2XGN A;  2F86 B;  3PXM A;  1YVB I;  2CG0 A;  1K28 A;  1TRQ A;  3PCR A;  2V1L A;  2ZDJ A;  1VQ9 3;  1IV9 A;  1SQW A;  1JBR A;  1AR0 A;  1IK3 A;  4K1V A;  3CPW 2;  4N6M A;  2W56 A;  3I56 3;  1ZO2 A;  1QVF 2;  2H0I A;  1LVN A;  4LEH A;  1JB4 A;  3NM7 A;  4J5G A;  3N8B A;  4KVH A;  5DRV A;  3SOA A;  1RN7 A;  4R80 A;  1RCL A;  1CYU A;  1I8V A;  2E2V A;  3F8X A;  3T8N A;  5CF2 A;  3MPH A;  1VQ4 3;  4J5K A;  4WYK A;  1YJN 3;  4HM3 B;  4HM4 B;  2M7O A;  3FGY A;  3SXX A;  5IG5 A;  1ISK A;  3EB8 A;  1KC8 4;  3ZG0 A;  1DMN A;  1OGZ A;  1ZGX A;  3DGO A;  1O7N B;  2ML5 A;  3CMA 3;  4NPB A;  2CX0 A;  4FMA A;  2XF3 A;  3PS8 A;  3DY5 A;  1U5O A;  3D5I A;  2F4Y A;  3MYT A;  1LOY A;  3JUP A;  4R9L A;  4BL3 A;  2WOF A;  3FSD A;  1TFO A;  3KKG A;  2IMJ A;  3GRD A;  5AEU B;  2XGL A;  1D6Y A;  3WA2 X;  3H51 A;  2RGQ A;  1Q86 4;  4WHA A;  2Y73 A;  3LML A;  3CC4 3;  5AIG A;  2KF4 A;  2UUG C;  3WOD G;  1BNF A;  2YFJ B;  2H0H A;  3PCS A;  3OW2 2;  5IEO A;  2P09 A;  1R4Y A;  1RN1 A;  2O3O A;  4IPB A;  2INX A;  4BTX A;  1AVL A;  1B3S A;  1DMQ A;  3CCQ 3;  1BU4 A;  1EKM A;  1IVV A;  2Q07 A;  2Z6B A;  2OQE C;  1BRS A;  3G8Z A;  3M8C A;  2OQE A;  4ZM8 A;  3UL5 A;  1JNQ A;  1UCJ A;  5I97 A;  2HMO B;  3CCE 3;  3JUQ A;  1DVD A;  3E99 A;  2UX0 A;  3MSO A;  1Q82 4;  1T5Y A;  1W5Z A;  3EN8 A;  1OH0 A;  1TTO A;  5HGR A;  4U13 A;  2YFI B;  5AI1 A;  2HML B;  3EJV A;  1BNJ A;  2ML6 A;  1J2B A;  2OTJ 3;  1WMN A;  4I5Q A;  4KFF A;  1B21 A;  3K0Z A;  3UL6 A;  1B2M A;  1LOX A;  1NNV A;  2D1W A;  3ECF A;  3KII A;  5AII A;  2QA4 3;  1QAK A;  1AVK A;  1FUS A;  3STD A;  4AKY A;  2XH9 A;  1GSP A;  3ALA A;  1YJW 3;  4XDW A;  2XFS A;  5GSP A;  1VQP 3;  1MNL A;  1RMS A;  1I70 A;  1RHL A;  2E2T A;  2K54 A;  4K90 B;  3NXJ A;  4O8S A;  5LC7 A;  3HX8 A;  3WDG B;  1I2G A;  5AIH A;  1YI2 3;  2IUJ A;  2LQV A;  5IG0 A;  1FGM A;  1BNI A;  5DRE A;  3CCJ 3;  1F8N A;  2XEP A;  3DGM A;  1BSD A;  1UCI A;  1B27 A;  1W6G A;  3DZL A;  3NUV A;  2QGU A;  2HMJ B;  3GZR A;  4NHF A;  3WMD A;  1E3V A;  5M1A A;  3Q90 A;  1RNB A;  3U1W A;  3BLZ A;  3KSE D;  1BNE A;  1D6Z A;  1RGC A;  1M90 4;  4RBN A;  1DMM A;  1O7H B;  1O7P B;  1IVU A;  1ZS7 A;  4FMC A;  4XM4 A;  2OTL 3;  4XBT A;  2P0X A;  4GHO A;  3FZW A;  1BIR A;  1RGE A;  4KT3 B;  2IY2 A;  3F14 A;  1I0X A;  1SII A;  1UCK A;  5JPU A;  2RSX A;  4LZI A;  2BMR B;  1W01 A;  3F40 A;  1BVI A;  3EX9 A;  3HOH A;  1IQY A;  1FGO A;  1RN4 A;  1ROV A;  3B7C A;  2Y74 A;  1KSI A;  1JKG B;  3NV0 B;  1C54 A;  2IUK A;  1T3B A;  2F5M A;  2XR8 B;  2Z76 A;  3SED A;  2I9W A;  1GS3 A;  1UCL A;  2BT3 A;  3L0R A;  3CXC 2;  1YIT 3;  4MEI A;  1I2E A;  6RNT A;  3D79 A;  1JZO A;  2GBX B;  3BNB A;  2W04 A;  3G71 3;  3CC7 3;  2F98 A;  3G0K A;  3V99 A;  4STD A;  2AAD A;  2XRX B;  1BGS A;  3X3Y A;  1CQS A;  2WGQ A;  1E3R A;  1RGL A;  3WA3 A;  2Z77 A;  4JRF A;  3A5E A;  2QIY A;  1V58 A;  1S72 3;  1IDP A;  1UW1 A;  1R4C A;  1YNV X;  3VSY A;  3GZB A;  5HOH A;  5IG3 A;  1GY7 A;  2KRT A;  3JVC A;  1ASK A;  4CJN A;  1W02 A;  1NB5 I;  1B2X A;  1BOX A;  3G16 A;  3PYJ A;  1BUJ A;  2CC3 A;  2PZV A; 
#chains in the Genus database with same CATH homology
 8RNT A;  1BRJ A;  3D5I A;  2F56 A;  1BRN L;  2F5W A;  1BSC A;  2F4Y A;  1BAO A;  1RGK A;  3SYU A;  1LOY A;  9RNT A;  1G02 A;  1BRK A;  2BIR A;  1BRH A;  3D4A A;  1DE3 A;  1RGF A;  1YGW A;  2RBI A;  1CH0 A;  1RGG A;  4HOH A;  4BU4 A;  2ZA4 A;  1FUT A;  5BU4 A;  1BNR A;  2KF4 A;  1BNF A;  1X1U A;  1LRA A;  2KF5 A;  1R4Y A;  1RN1 A;  1BNS A;  1RTU A;  3RNT A;  1B3S A;  1RDS A;  1BU4 A;  2GSP A;  1RGH A;  1BRS A;  1I3I A;  3GSP A;  3AHW A;  1UCJ A;  2RNT A;  2KF3 A;  3BU4 A;  1TTO A;  3AHS A;  7GSP A;  2AAE A;  1GMP A;  1BNJ A;  3Q3F A;  1BAN A;  1RSN A;  1B21 A;  1IYY A;  1I0V A;  1PYL A;  1B2M A;  1HYF A;  4GSP A;  1I3F A;  1FUS A;  1LOW A;  2HOH A;  1B20 A;  1GSP A;  5GSP A;  3AGO A;  1FZU A;  1RMS A;  1BSA A;  1B2U A;  1I70 A;  1RHL A;  1RGA A;  1AQZ A;  1I2G A;  1A2P A;  1BNI A;  1BRI A;  3D5G A;  4BIR A;  4RNT A;  1BSD A;  1UCI A;  1B27 A;  1MGW A;  1Q9E A;  1GOY A;  1FYS A;  7RNT A;  1RNB A;  1GMQ A;  1BNE A;  1FW7 A;  1RGC A;  1T2H A;  5RNT A;  1GMR A;  1X1W A;  1BRG A;  2BU4 A;  1X1X A;  3URP A;  4GHO A;  3DGY A;  4HAA A;  1BIR A;  1BSB A;  1RGE A;  3BIR A;  1BSE A;  1I0X A;  1B2Z A;  1UCK A;  1RCK A;  1LNI A;  1DET A;  1AY7 A;  2KF6 A;  2C4B A;  5BIR A;  1BVI A;  2SAR A;  3HOH A;  1B2S A;  1RN4 A;  1C54 A;  1YVS A;  2F5M A;  1HZ1 A;  1RLS A;  1LOV A;  1T2I A;  1GOV A;  1UCL A;  1TRQ A;  1JBS A;  1JBR A;  1I2E A;  6RNT A;  3AGN A;  1PY3 A;  1TRP A;  2AAD A;  4J5G A;  1BGS A;  1X1Y A;  3WR2 A;  1RCL A;  1I8V A;  1RGL A;  3A5E A;  1RNT A;  1I2F A;  1SAR A;  3KCH A;  4J5K A;  1YNV X;  5HOH A;  3WHO A;  1MGR A;  3DH2 A;  1GOU A;  1JBT A;  1B2X A;  1ZGX A;  1BOX A;  2KAA A;  1BUJ A;  1BNG A;  6GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...