3FF2A

Crystal structure of an uncharacterized cystatin fold protein (saro_2299) from novosphingobium aromaticivorans dsm at 1.90 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
GMSNLETAKAMIAAYNAQDVDTYVSYMTDDACEANYRGDVVREGKEGTRSGLAAAFARWPQNHAEIKDAQQVGTYVLMREHVTRGPATDGSPLVEPFDVVAVYSFEGDKCSRVEFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized cystatin fold protein (YP_497570.1) from NTF2 superfamily (YP_497570.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.90 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Unknown function
molecule keywords uncharacterized cystatin fold protein (YP_497570.1) from NTF
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ff2A00
1ASKA 1UUWB 3KSPA 4H3UA 3EBYA 2GBXB 4K1UA 2INXA 2IMJA 1JN5B 3K7CA 1OUNA 1W6YA 4L8PA 3F8XA 2Z77A 4R1KA 3EF8A 1TUHA 1HKXA 1W00A 1Q42A 1STDA 3G0KA 1CQSA 1OGXA 3G8ZA 4FCMA 4N3VA 3B7CA 5HGRA 4XB5A 2F99A 1NWWA 3FZWA 6STDA 3GZBA 1ZO2A 4R9KA 3T8NA 3MG1A 3F8HA 4RZMA 3G16A 3NBRA 1QJGA 1W01A 3NV0B 2HMOB 2B24B 3FF0A 2BMQB 3KKGA 4HM3B 1GY5A 4L7KA 4L8OA 1JB5A 5IERA 5DRVA 4XM4A 3S5CA 3B8LA 4HM6B 2GBWB 2XSOB 1OGZA 3MG2A 4U13A 3A76A 4WYKA 4OUQA 5CF2A 3F40A 5EVHA 2XSHB 4FCJA 3NXJA 1OHOA 4WYKB 3H51A 1TP6A 4HZBB 1WQLB 1O7HB 3GZXB 4XBXA 3ER7A 3F9SA 3OWUA 5BVBA 3FF2A 1GY6A 1GYBA 4HZ9B 2HMKB 4I4KA 1JKGB 4HM7B 2GXFA 4LGQA 1DMNA 5AIIA 5IF6A 1E97A 3OX9A 3KZTA 4XDWA 3CU3A 1Z1SA 3Q90A 1OF5A 3DXOA 3ECFA 3UJMA 5IEPA 3MG3A 5TGNA 1E3VA 2RGQA 3F7XA 1E3RA 1U5OA 4HM5B 4R9LA 2HMNB 3GZRA 8CHOA 4HM0B 4XDVA 3GZYB 4XBTA 2XRXB 3MSOA 1IDPA 2PZVA 3NV0A 5CLKA 3WMDA 5IG4A 3EC9A 3EJVA 5KP3A 3OXAA 1W02A 4HM1B 3OWSA 3BLZA 3EN1B 3NM2A 2A15A 3EBTA 4OVMA 5D81A 5STDA 2OWPA 3JUOA 3DMCA 4K1VA 4HM4B 3EN8A 4MJDA 3RGAA 4LMIA 3RGRA 5JPUA 5KP4A 5FW5A 1O7GB 3JUQA 2QGUA 2Z7AA 4HKVB 5AI1A 1A2KA 1S5AA 4WP5A 5AIHA 5IG0A 5AEUB 2F98A 2W2CA 2HMLB 2GEXA 2F86B 3HZPA 3JUMA 3MKIA 1VZZA 1EA2A 2B1XB 2I9WA 2BNGA 3CNXA 4ORLA 1JN5A 1O7MB 5CK6A 2STDA 3GRDA 2YFLB 1OH0A 2K54A 1OF5B 2RCDA 3HX8A 3LYGA 4Q53A 1NDOB 3DM8A 3FH1A 2RFRA 3K0ZA 2CKFB 2UX0A 3T8UA 5G2GA 5IEOA 5JPPA 3JUPA 1O7PB 1ULJB 1QMAA 3B4PA 5CF1A 1OHSA 1OCVA 4HVNA 4WWUC 4CDLA 1BUQA 2YFJB 3HK4A 3LZAA 2GEYA 1O7WB 3CNMA 3JUNA 1DMQA 3H3HA 2BMRB 1DMMA 4J8TA 1K41A 3DZLA 3FSDA 5BXQA 4GB5A 1JKGA 3UNLA 1OHPA 1SJWA 1EG9B 2QIYA 1NU3A 3I0YA 3M8CA 3NUVA 4HM8B 3E99A 3FGYA 4J9AA 4HM2B 3ROBA 1GS3A 5IG3A 3MYTA 3D9RA 5AIFA 3SOYA 1JB4A 3GWRA 2YFIB 3VSYA 2R4IA 4PEJA 3F14A 4X2HA 5AEWB 1OPYA 3KE7A 1GY7A 1AR0A 2CHCA 3EQQB 5D83A 5IG5A 5KP1A 4KVHA 5IENA 2HMJB 4LEHA 3STDA 5AIGA 2JQ5A 4STDA 5CXOA 5D82A 2BMOB 1C7HA 3DUKA 4HJLB 3SOAA 1Q40A 1ULIB 5DREA 3NHXA 1ISKA 4XBYA 1ZX2A 3B4OA 1Q40B 3OV4A 3BB9A 3FLJA 3VGNA 3IPTA 2XR8B 3MHEA 1O7NB 7STDA 3EHCA 1UUVB 2Z76A 3CPOA 4IIAA 3SEDA 4X2OA 3F7SA 1JB2A 3FKAA 3OWYA 3EX9A 2HMMB
chains in the Genus database with same CATH superfamily
3AGNA 1UUWB 4FCZA 1IVWA 1HU9A 4H3UA 2GBXB 2IMJA 1WMPA 1A2PA 5A0OB 3CPW2 2OTL3 1A67A 1FA3A 1W6CA 2LQVA 4O3VA 4AKYA 5D82A 3EF8A 5BU4A 4FCMA 3G8ZA 1OGXA 1NB3I 3FG3A 3SLUA 1WMNA 5HGRA 7STDA 3T8NA 1FUTA 1QJGA 4IIAA 3WDGB 5IERA 4HM3B 4L8OA 5G1KA 4FMAA 1YHQ3 2XF3A 3WOFB 3B8LA 4HM6B 2GBWB 2XFSA 3MWZA 3A76A 4WYKA 4OUQA 1TFOA 1BNEA 2XSHB 3N9HA 1W4NA 4FCJA 1OHOA 4WYKB 1A2VA 3ZG5A 4HZBB 4N6V0 1D6UA 1YNVX 3V98A 5BVBA 3FF2A 1GY6A 4HZ9B 4N6LA 1HZ1A 3L0RA 3WODG 4LGQA 4O02B 3CCV3 3OX9A 2OOVA 3KZTA 2CFLA 1K734 1OF5A 2CG1A 1CYUA 1BRSA 3J7Yd 2KCDA 4LYLB 4G1MB 4HM5B 1E3RA 1AV4A 2HMNB 3GZRA 1W6GA 3Q3FA 8CHOA 1B2MA 4XDVA 3CCE3 1RKYA 1BSAA 5M1AA 5M19A 1BRIA 3NV0A 3NQZA 1C54A 5KP3A 1W02A 2H0HA 4OVMA 3EBTA 5LC6A 1RJOA 3SX1A 3RGAA 3EN8A 1STFI 3U97A 1BVIA 1W7CA 1Q814 1MGRA 3SXXA 1FGOA 4HKVB 5AI1A 1A2KA 5AIHA 3BIRA 6GSPA 3LTAA 3JUMA 1AVLA 1VZZA 1EA2A 1FZUA 1I0VA 4GHOA 2C10A 3LT9A 2WGQA 4RNYA 1QVG2 1YJ93 2YFLB 3HX8A 3FH1A 3K0ZA 3D5IA 2XEPA 4K90B 1GSPA 4GSPA 3T8UA 3LT8A 3CME3 5JPPA 3JUPA 3NBJA 5HOHA 3GAXA 2FGTA 1OHSA 3V92A 4R4KA 1BUQA 1W2B2 1G0TA 1I3IA 3FKAA 3HK4A 3LZAA 1DMQA 1WMOA 2BMRB 1DMMA 2E2TA 2KF4A 3KN4A 1K41A 1GMQA 3T0UA 3G6E3 4GB5A 3UNLA 1Y4KA 2XFTA 2Z6BA 5IW9A 3CCQ3 2KAAA 1K28A 3M8CA 3LH4A 4HM8B 3E99A 2O9UX 3BNBA 4FR9A 4KFDA 9RNTA 3X42A 4BIRA 3CC43 1JJ22 5IG3A 3CD63 3D79A 3DGMA 3MYTA 1BGSA 3SOYA 1TIJA 2YFIB 3VSYA 1SPUA 2CFDA 3LTCA 1G96A 1JBSA 1GD3A 5IG5A 1I3FA 3KE7A 1AR0A 3LOYA 4HBRA 5EEOA 1BNSA 1N8R4 3A5EA 5IENA 5FGOA 4IPBA 1BRKA 3STDA 1ZGXA 4AEQA 2R41A 3SOAA 1PYLA 2P09A 2YX9A 2FNQA 3NHXA 4ZM8A 4N6UA 1ISKA 1FUSA 1IT7A 1IVVA 3BB9A 3FLJA 3OV4A 1RDSA 1O7NB 5ELJA 1RHLA 1GMPA 2UGIA 3CC23 2CIUA 1MGWA 1LRAA 5G1LA 3DGNA 1BNFA 4EXRA 3ALAA 1YVSA 3K7CA 4KFEA 4EBGA 2F5MA 3F8XA 2C4BA 4R1KA 4TX4A 1UUGB 2CW9A 3PXMA 4WFOA 4N3VA 3NBBA 1RN1A 2F99A 2P38A 1ZO2A 4QWTA 4RZMA 2WGOA 1HYFA 3NV0B 3AMOB 1GD4A 2HMOB 2B24B 4DKIA 2BMQB 1GOUA 2CWTA 2KXGA 1UGHI 1UCJA 2W0QA 3D3LA 3HOHA 1MWRA 3S5CA 1YJN3 2XSOB 5RNTA 1OGZA 1RGHA 4U13A 1VQQA 3NQYA 3S28A 1UGIA 1RGEA 1KC84 4NREA 4HYZA 3X41A 1TP6A 2CK3H 1IT8A 3JVCA 3OWUA 1RRHA 3CCJ3 1UDII 3K9MC 3N54B 1B2XA 1D6YA 1JKGB 2GU1A 3PCSA 3WOEB 4XDWA 1IQXA 1BRGA 1Z1SA 3UJMA 3S27A 3DXOA 1KD14 5IEPA 2JDIH 3KIIA 1BSBA 1E3VA 2CX0A 2BIRA 3CC73 1BNGA 3WR2A 1LOXA 4HM0B 1BNRA 4XBTA 1U8CB 4WHAA 1A90A 1IDPA 3WMDA 3EC9A 1LQMB 3NM2A 4J5GA 2A15A 3JUOA 4K1VA 1YIJ3 4HM4B 2IUJA 1O7GB 5M18A 3SYUA 1T2HA 1NNVA 2Z7AA 1S5AA 4WP5A 1K9M4 2F98A 2W2CA 4LZIA 2HMLB 3PCRA 2ZHXB 4BL3A 3S67A 1K8A4 1N5HA 3URPA 1S723 3V99A 3X3ZA 1JN5A 3AHWA 1RCKA 1IK3A 1ZS7A 2P05A 4N6TA 4BTYA 2K54A 2RCDA 3LYGA 4STDA 1NDOB 3DM8A 1B2SA 1RSNA 2P0XA 3DGLA 4N6OB 1L5GB 4R80A 1JV2B 2H0GA 2MC8A 1O7PB 2CC3A 1QMAA 3B4PA 4MMZB 4EV2A 1US1A 2ML6A 1I2GA 2CWUA 2RNTA 2XGNA 1YVBI 1IQYA 3JUNA 1LOVA 1UCIA 1VQ73 1IYYA 3DZLA 3FSDA 1D6ZA 3DH2A 1RTUA 1WNHA 2W9PA 3K5TA 1QALA 1SJWA 3FGYA 4FMBA 3G4S3 2ZL8A 2H0IA 1CH0A 2GSPA 1GS3A 2K3DA 3KSED 5AIFA 3D9RA 3CCL3 1BRJA 2V1LA 2R4IA 1T2IA 1RLSA 1OPYA 3D5GA 3BNDA 1T5YA 2KF6A 1BSDA 4KVHA 2CFKA 2HMJB 4EYCA 4KT3B 5AIGA 2JQ5A 1FUWA 2BMOB 3DUKA 3X3YA 4XBYA 1ZX2A 4HOHA 4CPKA 3B4OA 1NB5I 4JF8A 1UI8A 3IPTA 5JBSA 3MHEA 2F4YA 1J2BA 2P0MA 1LXEA 4X2OA 3F7SA 3HIGA 1VQP3 3OWYA 1BANA 2HMMB 3EX9A 4KZ1A 1TTOA 3FCSB 3EBYA 1MWSA 3KSPA 2INXA 2W56B 1W6YA 4EV5A 3DGOA 5BIRA 2BU4A 3U1WA 4MEIA 1X1XA 1HKXA 3G0KA 1STDA 4EW5A 1CQSA 1F8NA 3B7CA 4LSOA 4XB5A 3FZWA 1NWWA 4OK0A 6STDA 1Q7Y4 8RNTA 2SBLA 6RNTA 1ROVA 3MG1A 2MF7A 3G16A 3NBRA 4HM7B 1YI23 4L7KA 3FF0A 2RSXA 2IUKA 3KKGA 1GY5A 1Q7HA 1JB5A 1IU7A 1RN7A 2OQEC 4XM4A 1I70A 5DRVA 1MWUA 1VQL3 3X40A 1JRQA 2W9QA 1V74A 2KF3A 3SVAA 3F40A 1KQS2 1QAFA 7RNTA 3NXJA 3G713 3H51A 1FGMA 1WQLB 1O7HB 3GZXB 4N6MA 4XBXA 3ER7A 3F9SA 1EKMA 3ZG0A 1RNBA 4I4KA 1GYBA 1M904 2HMKB 1JBTA 5AIIA 1QVF2 2GXFA 5IF6A 4FMCA 1E97A 4N6NB 1DETA 3CU3A 3Q90A 2L1SA 3VF1A 1TJDA 3S29A 1LOYA 4O8SA 1G02A 1IVUA 1TRPA 1X1WA 3UB1A 1M1XB 1VQN3 1LNIA 2OCTA 4R9LA 2IA7A 1VQO3 1UCKA 1MOLA 2XRXB 2PZVA 2AADA 5IG4A 4HM1B 3OWSA 3BLZA 5STDA 3QK9A 2OWPA 3DMCA 1GMRA 1CYVA 1YGWA 1UW1A 3PYJA 4LMIA 1LQGC 4AKZA 5JPUA 5KP4A 3BU4A 1T3BA 1N8QA 2CH9A 4GL6A 5IG0A 7GSPA 1M9GA 3DGYA 1SQWA 2GEXA 2F86B 3HZPA 2D42A 4O2HA 1AVKA 4CCVA 2B1XB 1N9EA 2F5WA 2Y74A 1O7MB 4ORLA 1VQ53 2STDA 3WA3A 1VQ93 4Q53A 3PS8A 1NO3A 2RFRA 2CKFB 2UX0A 2W03A 4RNTA 1RN4A 2AAEA 4NHFA 2ML5A 1QAKA 5G2GA 3X3XA 2KF5A 3WA2X 4HVNA 5GSPA 3GSPA 4CDLA 1UI7A 3FG1A 3K63A 3HI7A 2GEYA 1O7WB 3CCS3 4BTWA 2D1WA 2K0MA 1V57A 3FG4A 3H3HA 3PGBA 3OW22 1X1YA 4RBNA 1JBRA 1FW7A 1RCLA 4CJNA 1JKGA 2L4VA 3I0YA 2E2UA 1ROAA 1N9JA 2WOHA 3LTDA 4HM2B 3GWRA 1IQ8A 4PEJA 1AQZA 4HAAA 3F14A 1YIT3 5AEWB 5KP1A 1SIIA 2CHCA 1IV7A 1YGEA 3EQQB 5D83A 1FGRA 2CWVA 1TFKA 4LEHA 3BNCA 1BAOA 4BL2A 2O3OA 1VQK3 5CXOA 4HJLB 4H61A 1ULIB 1FGQA 2C11A 4IT7A 1BRHA 1B3SA 1TRQA 2XR8B 3EHCA 3SEDA 1B2ZA 1SARA 2W6JH 2XH9A 4BTXA 1FGTA 3TDGA 1ASKA 4ILFA 3ZFZA 2F56A 4K1UA 1RGLA 1JN5B 1OUNA 4L8PA 3MPHA 1BIRA 1Q864 2Z77A 3CCM3 1WTHA 1R4CA 1TUHA 1W00A 1Q42A 1BSCA 1EUIC 3I553 2HOHA 1MNLA 3BNEA 3I563 3GZBA 4R9KA 4FMDA 3F8HA 4K61A 1W2ZA 1JNQA 1W01A 1RGGA 2CG0A 1YJW3 2WOFA 1KWIA 2OOVC 3EE1A 1BRNL 5AYSC 1B27A 1BU4A 4NPBA 3MG2A 5CF2A 1DE3A 3QRDA 3UL5A 5EVHA 1B2UA 1DVCA 2LYXA 3AHSA 3LTBA 4KFFA 3N8BA 3LXUX 1W5ZA 4EC6A 2ZDJA 1DYUA 1I2EA 2PNCA 3IJEB 1DMNA 1X1UA 2OTJ3 3ECFA 1V58A 2CFGA 3MG3A 5TGNA 2SARA 1MWTA 2Y73A 1EEJA 3AMOA 3AGOA 1VQ83 2RGQA 1LNHA 3F7XA 1OACA 1U5OA 2E2VA 1KSIA 2XGLA 3GZYB 1FYSA 3IMAB 2BT3A 1JZOA 2J8XB 3MSOA 5ELUA 5CLKA 2WO0A 5EQLA 3RNTA 1RNTA 2QEX3 3EJVA 3Q1CA 3OXAA 3EN1B 3KCHA 5D81A 4MJDA 1PU4A 3RGRA 1RRLA 2RBIA 5LC7A 5FW5A 3JUQA 1I8VA 2W56A 2QGUA 1IVXA 1B21A 5AEUB 3MKIA 1M1K4 1JZDA 2I9WA 2BNGA 4I5QA 1VQM3 1I0XA 2M7OA 2BHMA 3CNXA 4MMYB 1PFPA 3DY5A 4RNZA 5CK6A 3GRDA 1GOYA 1OH0A 1OF5B 1UCLA 1LVNA 4BU4A 1RGFA 4JRFA 3CCR3 5IEOA 1ULJB 5CF1A 3CCU3 1RMSA 3CMA3 3LMLA 1OCVA 4WWUC 1Q824 2Q07A 2YFJB 3O8YA 1BSEA 3PZWA 3WHOA 3CNMA 4MMXB 1TU5A 4J8TA 1LOWA 3NM7A 5BXQA 1IV9A 1VQ63 1RGCA 2W04A 1CEWI 1EG9B 1OHPA 1PY3A 1NU3A 2QIYA 2ZA4A 3NUVA 3NX0A 4J9AA 3RDEA 3ROBA 3D4AA 1BUJA 2FXTA 1JB4A 1BNIA 1VQ43 4X2HA 1EQKA 1GY7A 1I2FA 3Q2PA 2QA43 1BNJA 2CX1A 5I97A 1R4YA 5AYRB 2IY2A 1Q9EA 1GOVA 1C7HA 3EB8A 2GU3A 3HIIA 2OQEA 1Q40A 5DREA 2UUGC 2CFWA 3KFQC 1Q40B 4J5KA 1RGAA 3CXC2 3VGNA 1NJI4 1SIHA 1RGKA 1UUVB 2Z76A 3CPOA 1DVDA 3UL6A 1AY7A 1BOXA 2IYJA 2BO9B 1JB2A 1N5PA 1B20A 2KRTA
chains in the Genus database with same CATH topology
4FCZA 1UUWB 1IVWA 1HU9A 4H3UA 2GBXB 2IMJA 1WMPA 3CPW2 5A0OB 2OTL3 1FA3A 1A67A 1W6CA 2LQVA 4O3VA 4AKYA 5D82A 3EF8A 4FCMA 3G8ZA 1OGXA 1NB3I 3FG3A 3SLUA 1WMNA 5HGRA 7STDA 3T8NA 1QJGA 4IIAA 3WDGB 5IERA 4HM3B 4L8OA 4FMAA 1YHQ3 2XF3A 3WOFB 3B8LA 4HM6B 2GBWB 2XFSA 3MWZA 3A76A 4WYKA 4OUQA 1TFOA 2XSHB 3N9HA 1W4NA 4FCJA 1OHOA 4WYKB 1A2VA 4HZBB 4N6V0 1D6UA 3V98A 5BVBA 3FF2A 1GY6A 4HZ9B 4N6LA 3WODG 3L0RA 4LGQA 4O02B 3CCV3 3OX9A 2OOVA 3KZTA 2CFLA 1K734 1OF5A 2CG1A 1CYUA 3J7Yd 2KCDA 4G1MB 4HM5B 1E3RA 1AV4A 2HMNB 3GZRA 1W6GA 8CHOA 4XDVA 3CCE3 1RKYA 3NV0A 3NQZA 5KP3A 1W02A 4OVMA 3EBTA 5LC6A 1RJOA 3SX1A 3RGAA 3EN8A 1STFI 3U97A 1Q814 1W7CA 3SXXA 1FGOA 4HKVB 5AI1A 1A2KA 5AIHA 3LTAA 3JUMA 1AVLA 1VZZA 1EA2A 2C10A 3LT9A 2WGQA 4RNYA 1QVG2 1YJ93 2YFLB 3HX8A 3FH1A 3K0ZA 2XEPA 4K90B 3T8UA 3LT8A 3CME3 5JPPA 3JUPA 3NBJA 3GAXA 2FGTA 1OHSA 3V92A 4R4KA 1BUQA 1W2B2 3HK4A 3FKAA 3LZAA 1DMQA 1WMOA 2BMRB 1DMMA 2E2TA 3KN4A 1K41A 3T0UA 3G6E3 4GB5A 3UNLA 1Y4KA 2Z6BA 2XFTA 5IW9A 3CCQ3 1K28A 3M8CA 3LH4A 4HM8B 3E99A 2O9UX 3BNBA 4FR9A 4KFDA 3X42A 3CC43 1JJ22 5IG3A 3CD63 3DGMA 3MYTA 3SOYA 1TIJA 2YFIB 3VSYA 1SPUA 2CFDA 3LTCA 1G96A 1GD3A 5IG5A 3KE7A 1AR0A 3LOYA 4HBRA 5EEOA 1N8R4 5IENA 5FGOA 4IPBA 3STDA 4AEQA 3SOAA 2P09A 2YX9A 2FNQA 3NHXA 4ZM8A 4N6UA 1ISKA 1IT7A 1IVVA 3BB9A 3FLJA 3OV4A 5ELJA 1O7NB 3CC23 2CIUA 3DGNA 4EXRA 3ALAA 3K7CA 4KFEA 4EBGA 3F8XA 4TX4A 4R1KA 2CW9A 4WFOA 3PXMA 4N3VA 3NBBA 2F99A 2P38A 1ZO2A 4QWTA 4RZMA 2WGOA 3NV0B 3AMOB 1GD4A 2HMOB 2B24B 2BMQB 2CWTA 2W0QA 2KXGA 3D3LA 3S5CA 1YJN3 2XSOB 1OGZA 4U13A 3NQYA 3S28A 1KC84 4NREA 4HYZA 3X41A 1TP6A 2CK3H 1IT8A 3JVCA 3OWUA 1RRHA 3CCJ3 3K9MC 3N54B 1D6YA 3PCSA 1JKGB 2GU1A 3WOEB 4XDWA 1IQXA 1Z1SA 3UJMA 3S27A 3DXOA 1KD14 5IEPA 2JDIH 3KIIA 1E3VA 3CC73 1LOXA 4HM0B 4XBTA 1U8CB 4WHAA 1A90A 1IDPA 3WMDA 3EC9A 3NM2A 2A15A 3JUOA 4K1VA 1YIJ3 4HM4B 2IUJA 1O7GB 2Z7AA 1S5AA 4WP5A 1K9M4 2F98A 2W2CA 4LZIA 2HMLB 3PCRA 3S67A 1K8A4 1N5HA 1S723 3V99A 3X3ZA 1JN5A 1IK3A 2P05A 4N6TA 4BTYA 2K54A 2RCDA 3LYGA 4STDA 1NDOB 3DM8A 4N6OB 2P0XA 3DGLA 1L5GB 4R80A 1JV2B 2MC8A 1O7PB 2CC3A 1QMAA 3B4PA 4MMZB 4EV2A 1US1A 2ML6A 2CWUA 2XGNA 1YVBI 1IQYA 3JUNA 1VQ73 3DZLA 3FSDA 1D6ZA 3K5TA 1WNHA 2W9PA 1QALA 1SJWA 3FGYA 4FMBA 3G4S3 2ZL8A 3CCL3 1GS3A 3KSED 5AIFA 3D9RA 2V1LA 2R4IA 1OPYA 3BNDA 1T5YA 4KVHA 2CFKA 2HMJB 4EYCA 5AIGA 2JQ5A 1FUWA 2BMOB 3DUKA 3X3YA 4XBYA 1ZX2A 3B4OA 1NB5I 4JF8A 1UI8A 3IPTA 5JBSA 3MHEA 1J2BA 2P0MA 1LXEA 4X2OA 3F7SA 3HIGA 1VQP3 3OWYA 3EX9A 2HMMB 4KZ1A 3KSPA 3FCSB 3EBYA 2INXA 2W56B 1W6YA 4EV5A 3DGOA 3U1WA 4MEIA 1HKXA 3G0KA 1STDA 1CQSA 1F8NA 3B7CA 4LSOA 4XB5A 3FZWA 1NWWA 4OK0A 6STDA 1Q7Y4 2SBLA 1ROVA 3MG1A 2MF7A 3G16A 3NBRA 4HM7B 1YI23 4L7KA 3FF0A 2RSXA 2IUKA 3KKGA 1GY5A 1JB5A 1IU7A 1RN7A 2OQEC 4XM4A 5DRVA 1VQL3 3X40A 1JRQA 2W9QA 1V74A 3SVAA 3F40A 1KQS2 1QAFA 3NXJA 3G713 3H51A 1FGMA 1WQLB 1O7HB 3GZXB 4N6MA 4XBXA 3ER7A 3F9SA 1EKMA 4I4KA 1GYBA 1M904 2HMKB 5AIIA 1QVF2 2GXFA 5IF6A 4FMCA 1E97A 4N6NB 3CU3A 3Q90A 3VF1A 3S29A 4O8SA 3UB1A 1IVUA 1M1XB 1VQN3 2OCTA 4R9LA 2IA7A 1VQO3 1MOLA 2XRXB 2PZVA 5IG4A 4HM1B 3OWSA 3BLZA 5STDA 3QK9A 2OWPA 3DMCA 1CYVA 1UW1A 3PYJA 4LMIA 5JPUA 4AKZA 5KP4A 1N8QA 2CH9A 4GL6A 5IG0A 1M9GA 1SQWA 2GEXA 2F86B 3HZPA 2D42A 4O2HA 1AVKA 4CCVA 2B1XB 1N9EA 2Y74A 1O7MB 4ORLA 1VQ53 2STDA 3WA3A 1VQ93 4Q53A 3PS8A 1NO3A 2RFRA 2CKFB 2UX0A 2W03A 5G2GA 4NHFA 2ML5A 1QAKA 3X3XA 3WA2X 4HVNA 4CDLA 1UI7A 3FG1A 3K63A 3HI7A 2GEYA 1O7WB 3CCS3 4BTWA 2D1WA 2K0MA 3FG4A 3H3HA 3OW22 3PGBA 4RBNA 1JKGA 2L4VA 3I0YA 2E2UA 1ROAA 1N9JA 2WOHA 3LTDA 4HM2B 3GWRA 1IQ8A 4PEJA 3F14A 1YIT3 5AEWB 5KP1A 1SIIA 2CHCA 1IV7A 1YGEA 3EQQB 5D83A 1FGRA 2CWVA 1TFKA 4LEHA 3BNCA 1VQK3 2O3OA 5CXOA 4HJLB 4H61A 1ULIB 1FGQA 2C11A 4IT7A 2XR8B 3EHCA 3SEDA 2W6JH 2XH9A 4BTXA 1FGTA 3TDGA 1ASKA 4K1UA 1JN5B 1OUNA 4L8PA 3MPHA 1Q864 2Z77A 3CCM3 1WTHA 1R4CA 1TUHA 1W00A 1Q42A 3I553 1MNLA 3BNEA 3I563 3GZBA 4R9KA 4FMDA 3F8HA 4K61A 1W2ZA 1JNQA 1W01A 2CG0A 1YJW3 2WOFA 1KWIA 2OOVC 3EE1A 5AYSC 3MG2A 5CF2A 3QRDA 3UL5A 5EVHA 1DVCA 2LYXA 3LTBA 4KFFA 3N8BA 3LXUX 1W5ZA 4EC6A 2ZDJA 1DYUA 2PNCA 3IJEB 1DMNA 2OTJ3 3ECFA 2CFGA 3MG3A 5TGNA 2Y73A 3AMOA 1VQ83 2RGQA 1LNHA 3F7XA 1OACA 1U5OA 2E2VA 1KSIA 2XGLA 3GZYB 3IMAB 2BT3A 3MSOA 5ELUA 5EQLA 5CLKA 2WO0A 2QEX3 3EJVA 3Q1CA 3OXAA 3EN1B 5D81A 4MJDA 1PU4A 3RGRA 1RRLA 5LC7A 5FW5A 3JUQA 2W56A 2QGUA 1IVXA 5AEUB 3MKIA 1M1K4 2I9WA 2BNGA 1VQM3 2M7OA 2BHMA 3CNXA 4MMYB 1PFPA 3DY5A 4RNZA 5CK6A 3GRDA 1OH0A 1OF5B 1LVNA 4JRFA 3CCR3 5IEOA 1ULJB 5CF1A 3CCU3 3CMA3 3LMLA 1OCVA 4WWUC 1Q824 2Q07A 2YFJB 3O8YA 3PZWA 3CNMA 4MMXB 1TU5A 4J8TA 3NM7A 5BXQA 1IV9A 1VQ63 2W04A 1CEWI 1EG9B 1OHPA 2QIYA 1NU3A 3NUVA 3NX0A 4J9AA 3RDEA 3ROBA 2FXTA 1JB4A 1VQ43 4X2HA 1EQKA 1GY7A 3Q2PA 2QA43 5I97A 5AYRB 1C7HA 3EB8A 2GU3A 3HIIA 2OQEA 1Q40A 5DREA 2CFWA 3KFQC 1Q40B 1NJI4 3CXC2 3VGNA 1SIHA 1UUVB 2Z76A 3CPOA 1DVDA 3UL6A 2BO9B 1JB2A 1N5PA 2KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASK A;  1UUW B;  3KSP A;  4H3U A;  3EBY A;  2GBX B;  4K1U A;  2INX A;  2IMJ A;  1JN5 B;  3K7C A;  1OUN A;  1W6Y A;  4L8P A;  3F8X A;  2Z77 A;  4R1K A;  3EF8 A;  1TUH A;  1HKX A;  1W00 A;  1Q42 A;  1STD A;  3G0K A;  1CQS A;  1OGX A;  3G8Z A;  4FCM A;  4N3V A;  3B7C A;  5HGR A;  4XB5 A;  2F99 A;  1NWW A;  3FZW A;  6STD A;  3GZB A;  1ZO2 A;  4R9K A;  3T8N A;  3MG1 A;  3F8H A;  4RZM A;  3G16 A;  3NBR A;  1QJG A;  1W01 A;  3NV0 B;  2HMO B;  2B24 B;  3FF0 A;  2BMQ B;  3KKG A;  4HM3 B;  1GY5 A;  4L7K A;  4L8O A;  1JB5 A;  5IER A;  5DRV A;  4XM4 A;  3S5C A;  3B8L A;  4HM6 B;  2GBW B;  2XSO B;  1OGZ A;  3MG2 A;  4U13 A;  3A76 A;  4WYK A;  4OUQ A;  5CF2 A;  3F40 A;  5EVH A;  2XSH B;  4FCJ A;  3NXJ A;  1OHO A;  4WYK B;  3H51 A;  1TP6 A;  4HZB B;  1WQL B;  1O7H B;  3GZX B;  4XBX A;  3ER7 A;  3F9S A;  3OWU A;  5BVB A;  3FF2 A;  1GY6 A;  1GYB A;  4HZ9 B;  2HMK B;  4I4K A;  1JKG B;  4HM7 B;  2GXF A;  4LGQ A;  1DMN A;  5AII A;  5IF6 A;  1E97 A;  3OX9 A;  3KZT A;  4XDW A;  3CU3 A;  1Z1S A;  3Q90 A;  1OF5 A;  3DXO A;  3ECF A;  3UJM A;  5IEP A;  3MG3 A;  5TGN A;  1E3V A;  2RGQ A;  3F7X A;  1E3R A;  1U5O A;  4HM5 B;  4R9L A;  2HMN B;  3GZR A;  8CHO A;  4HM0 B;  4XDV A;  3GZY B;  4XBT A;  2XRX B;  3MSO A;  1IDP A;  2PZV A;  3NV0 A;  5CLK A;  3WMD A;  5IG4 A;  3EC9 A;  3EJV A;  5KP3 A;  3OXA A;  1W02 A;  4HM1 B;  3OWS A;  3BLZ A;  3EN1 B;  3NM2 A;  2A15 A;  3EBT A;  4OVM A;  5D81 A;  5STD A;  2OWP A;  3JUO A;  3DMC A;  4K1V A;  4HM4 B;  3EN8 A;  4MJD A;  3RGA A;  4LMI A;  3RGR A;  5JPU A;  5KP4 A;  5FW5 A;  1O7G B;  3JUQ A;  2QGU A;  2Z7A A;  4HKV B;  5AI1 A;  1A2K A;  1S5A A;  4WP5 A;  5AIH A;  5IG0 A;  5AEU B;  2F98 A;  2W2C A;  2HML B;  2GEX A;  2F86 B;  3HZP A;  3JUM A;  3MKI A;  1VZZ A;  1EA2 A;  2B1X B;  2I9W A;  2BNG A;  3CNX A;  4ORL A;  1JN5 A;  1O7M B;  5CK6 A;  2STD A;  3GRD A;  2YFL B;  1OH0 A;  2K54 A;  1OF5 B;  2RCD A;  3HX8 A;  3LYG A;  4Q53 A;  1NDO B;  3DM8 A;  3FH1 A;  2RFR A;  3K0Z A;  2CKF B;  2UX0 A;  3T8U A;  5G2G A;  5IEO A;  5JPP A;  3JUP A;  1O7P B;  1ULJ B;  1QMA A;  3B4P A;  5CF1 A;  1OHS A;  1OCV A;  4HVN A;  4WWU C;  4CDL A;  1BUQ A;  2YFJ B;  3HK4 A;  3LZA A;  2GEY A;  1O7W B;  3CNM A;  3JUN A;  1DMQ A;  3H3H A;  2BMR B;  1DMM A;  4J8T A;  1K41 A;  3DZL A;  3FSD A;  5BXQ A;  4GB5 A;  1JKG A;  3UNL A;  1OHP A;  1SJW A;  1EG9 B;  2QIY A;  1NU3 A;  3I0Y A;  3M8C A;  3NUV A;  4HM8 B;  3E99 A;  3FGY A;  4J9A A;  4HM2 B;  3ROB A;  1GS3 A;  5IG3 A;  3MYT A;  3D9R A;  5AIF A;  3SOY A;  1JB4 A;  3GWR A;  2YFI B;  3VSY A;  2R4I A;  4PEJ A;  3F14 A;  4X2H A;  5AEW B;  1OPY A;  3KE7 A;  1GY7 A;  1AR0 A;  2CHC A;  3EQQ B;  5D83 A;  5IG5 A;  5KP1 A;  4KVH A;  5IEN A;  2HMJ B;  4LEH A;  3STD A;  5AIG A;  2JQ5 A;  4STD A;  5CXO A;  5D82 A;  2BMO B;  1C7H A;  3DUK A;  4HJL B;  3SOA A;  1Q40 A;  1ULI B;  5DRE A;  3NHX A;  1ISK A;  4XBY A;  1ZX2 A;  3B4O A;  1Q40 B;  3OV4 A;  3BB9 A;  3FLJ A;  3VGN A;  3IPT A;  2XR8 B;  3MHE A;  1O7N B;  7STD A;  3EHC A;  1UUV B;  2Z76 A;  3CPO A;  4IIA A;  3SED A;  4X2O A;  3F7S A;  1JB2 A;  3FKA A;  3OWY A;  3EX9 A;  2HMM B; 
#chains in the Genus database with same CATH topology
 3AGN A;  1UUW B;  4FCZ A;  1IVW A;  1HU9 A;  4H3U A;  2GBX B;  2IMJ A;  1WMP A;  1A2P A;  5A0O B;  3CPW 2;  2OTL 3;  1A67 A;  1FA3 A;  1W6C A;  2LQV A;  4O3V A;  4AKY A;  5D82 A;  3EF8 A;  5BU4 A;  4FCM A;  3G8Z A;  1OGX A;  1NB3 I;  3FG3 A;  3SLU A;  1WMN A;  5HGR A;  7STD A;  3T8N A;  1FUT A;  1QJG A;  4IIA A;  3WDG B;  5IER A;  4HM3 B;  4L8O A;  5G1K A;  4FMA A;  1YHQ 3;  2XF3 A;  3WOF B;  3B8L A;  4HM6 B;  2GBW B;  2XFS A;  3MWZ A;  3A76 A;  4WYK A;  4OUQ A;  1TFO A;  1BNE A;  2XSH B;  3N9H A;  1W4N A;  4FCJ A;  1OHO A;  4WYK B;  1A2V A;  3ZG5 A;  4HZB B;  4N6V 0;  1D6U A;  1YNV X;  3V98 A;  5BVB A;  3FF2 A;  1GY6 A;  4HZ9 B;  4N6L A;  1HZ1 A;  3L0R A;  3WOD G;  4LGQ A;  4O02 B;  3CCV 3;  3OX9 A;  2OOV A;  3KZT A;  2CFL A;  1K73 4;  1OF5 A;  2CG1 A;  1CYU A;  1BRS A;  3J7Y d;  2KCD A;  4LYL B;  4G1M B;  4HM5 B;  1E3R A;  1AV4 A;  2HMN B;  3GZR A;  1W6G A;  3Q3F A;  8CHO A;  1B2M A;  4XDV A;  3CCE 3;  1RKY A;  1BSA A;  5M1A A;  5M19 A;  1BRI A;  3NV0 A;  3NQZ A;  1C54 A;  5KP3 A;  1W02 A;  2H0H A;  4OVM A;  3EBT A;  5LC6 A;  1RJO A;  3SX1 A;  3RGA A;  3EN8 A;  1STF I;  3U97 A;  1BVI A;  1W7C A;  1Q81 4;  1MGR A;  3SXX A;  1FGO A;  4HKV B;  5AI1 A;  1A2K A;  5AIH A;  3BIR A;  6GSP A;  3LTA A;  3JUM A;  1AVL A;  1VZZ A;  1EA2 A;  1FZU A;  1I0V A;  4GHO A;  2C10 A;  3LT9 A;  2WGQ A;  4RNY A;  1QVG 2;  1YJ9 3;  2YFL B;  3HX8 A;  3FH1 A;  3K0Z A;  3D5I A;  2XEP A;  4K90 B;  1GSP A;  4GSP A;  3T8U A;  3LT8 A;  3CME 3;  5JPP A;  3JUP A;  3NBJ A;  5HOH A;  3GAX A;  2FGT A;  1OHS A;  3V92 A;  4R4K A;  1BUQ A;  1W2B 2;  1G0T A;  1I3I A;  3FKA A;  3HK4 A;  3LZA A;  1DMQ A;  1WMO A;  2BMR B;  1DMM A;  2E2T A;  2KF4 A;  3KN4 A;  1K41 A;  1GMQ A;  3T0U A;  3G6E 3;  4GB5 A;  3UNL A;  1Y4K A;  2XFT A;  2Z6B A;  5IW9 A;  3CCQ 3;  2KAA A;  1K28 A;  3M8C A;  3LH4 A;  4HM8 B;  3E99 A;  2O9U X;  3BNB A;  4FR9 A;  4KFD A;  9RNT A;  3X42 A;  4BIR A;  3CC4 3;  1JJ2 2;  5IG3 A;  3CD6 3;  3D79 A;  3DGM A;  3MYT A;  1BGS A;  3SOY A;  1TIJ A;  2YFI B;  3VSY A;  1SPU A;  2CFD A;  3LTC A;  1G96 A;  1JBS A;  1GD3 A;  5IG5 A;  1I3F A;  3KE7 A;  1AR0 A;  3LOY A;  4HBR A;  5EEO A;  1BNS A;  1N8R 4;  3A5E A;  5IEN A;  5FGO A;  4IPB A;  1BRK A;  3STD A;  1ZGX A;  4AEQ A;  2R41 A;  3SOA A;  1PYL A;  2P09 A;  2YX9 A;  2FNQ A;  3NHX A;  4ZM8 A;  4N6U A;  1ISK A;  1FUS A;  1IT7 A;  1IVV A;  3BB9 A;  3FLJ A;  3OV4 A;  1RDS A;  1O7N B;  5ELJ A;  1RHL A;  1GMP A;  2UGI A;  3CC2 3;  2CIU A;  1MGW A;  1LRA A;  5G1L A;  3DGN A;  1BNF A;  4EXR A;  3ALA A;  1YVS A;  3K7C A;  4KFE A;  4EBG A;  2F5M A;  3F8X A;  2C4B A;  4R1K A;  4TX4 A;  1UUG B;  2CW9 A;  3PXM A;  4WFO A;  4N3V A;  3NBB A;  1RN1 A;  2F99 A;  2P38 A;  1ZO2 A;  4QWT A;  4RZM A;  2WGO A;  1HYF A;  3NV0 B;  3AMO B;  1GD4 A;  2HMO B;  2B24 B;  4DKI A;  2BMQ B;  1GOU A;  2CWT A;  2KXG A;  1UGH I;  1UCJ A;  2W0Q A;  3D3L A;  3HOH A;  1MWR A;  3S5C A;  1YJN 3;  2XSO B;  5RNT A;  1OGZ A;  1RGH A;  4U13 A;  1VQQ A;  3NQY A;  3S28 A;  1UGI A;  1RGE A;  1KC8 4;  4NRE A;  4HYZ A;  3X41 A;  1TP6 A;  2CK3 H;  1IT8 A;  3JVC A;  3OWU A;  1RRH A;  3CCJ 3;  1UDI I;  3K9M C;  3N54 B;  1B2X A;  1D6Y A;  1JKG B;  2GU1 A;  3PCS A;  3WOE B;  4XDW A;  1IQX A;  1BRG A;  1Z1S A;  3UJM A;  3S27 A;  3DXO A;  1KD1 4;  5IEP A;  2JDI H;  3KII A;  1BSB A;  1E3V A;  2CX0 A;  2BIR A;  3CC7 3;  1BNG A;  3WR2 A;  1LOX A;  4HM0 B;  1BNR A;  4XBT A;  1U8C B;  4WHA A;  1A90 A;  1IDP A;  3WMD A;  3EC9 A;  1LQM B;  3NM2 A;  4J5G A;  2A15 A;  3JUO A;  4K1V A;  1YIJ 3;  4HM4 B;  2IUJ A;  1O7G B;  5M18 A;  3SYU A;  1T2H A;  1NNV A;  2Z7A A;  1S5A A;  4WP5 A;  1K9M 4;  2F98 A;  2W2C A;  4LZI A;  2HML B;  3PCR A;  2ZHX B;  4BL3 A;  3S67 A;  1K8A 4;  1N5H A;  3URP A;  1S72 3;  3V99 A;  3X3Z A;  1JN5 A;  3AHW A;  1RCK A;  1IK3 A;  1ZS7 A;  2P05 A;  4N6T A;  4BTY A;  2K54 A;  2RCD A;  3LYG A;  4STD A;  1NDO B;  3DM8 A;  1B2S A;  1RSN A;  2P0X A;  3DGL A;  4N6O B;  1L5G B;  4R80 A;  1JV2 B;  2H0G A;  2MC8 A;  1O7P B;  2CC3 A;  1QMA A;  3B4P A;  4MMZ B;  4EV2 A;  1US1 A;  2ML6 A;  1I2G A;  2CWU A;  2RNT A;  2XGN A;  1YVB I;  1IQY A;  3JUN A;  1LOV A;  1UCI A;  1VQ7 3;  1IYY A;  3DZL A;  3FSD A;  1D6Z A;  3DH2 A;  1RTU A;  1WNH A;  2W9P A;  3K5T A;  1QAL A;  1SJW A;  3FGY A;  4FMB A;  3G4S 3;  2ZL8 A;  2H0I A;  1CH0 A;  2GSP A;  1GS3 A;  2K3D A;  3KSE D;  5AIF A;  3D9R A;  3CCL 3;  1BRJ A;  2V1L A;  2R4I A;  1T2I A;  1RLS A;  1OPY A;  3D5G A;  3BND A;  1T5Y A;  2KF6 A;  1BSD A;  4KVH A;  2CFK A;  2HMJ B;  4EYC A;  4KT3 B;  5AIG A;  2JQ5 A;  1FUW A;  2BMO B;  3DUK A;  3X3Y A;  4XBY A;  1ZX2 A;  4HOH A;  4CPK A;  3B4O A;  1NB5 I;  4JF8 A;  1UI8 A;  3IPT A;  5JBS A;  3MHE A;  2F4Y A;  1J2B A;  2P0M A;  1LXE A;  4X2O A;  3F7S A;  3HIG A;  1VQP 3;  3OWY A;  1BAN A;  2HMM B;  3EX9 A;  4KZ1 A;  1TTO A;  3FCS B;  3EBY A;  1MWS A;  3KSP A;  2INX A;  2W56 B;  1W6Y A;  4EV5 A;  3DGO A;  5BIR A;  2BU4 A;  3U1W A;  4MEI A;  1X1X A;  1HKX A;  3G0K A;  1STD A;  4EW5 A;  1CQS A;  1F8N A;  3B7C A;  4LSO A;  4XB5 A;  3FZW A;  1NWW A;  4OK0 A;  6STD A;  1Q7Y 4;  8RNT A;  2SBL A;  6RNT A;  1ROV A;  3MG1 A;  2MF7 A;  3G16 A;  3NBR A;  4HM7 B;  1YI2 3;  4L7K A;  3FF0 A;  2RSX A;  2IUK A;  3KKG A;  1GY5 A;  1Q7H A;  1JB5 A;  1IU7 A;  1RN7 A;  2OQE C;  4XM4 A;  1I70 A;  5DRV A;  1MWU A;  1VQL 3;  3X40 A;  1JRQ A;  2W9Q A;  1V74 A;  2KF3 A;  3SVA A;  3F40 A;  1KQS 2;  1QAF A;  7RNT A;  3NXJ A;  3G71 3;  3H51 A;  1FGM A;  1WQL B;  1O7H B;  3GZX B;  4N6M A;  4XBX A;  3ER7 A;  3F9S A;  1EKM A;  3ZG0 A;  1RNB A;  4I4K A;  1GYB A;  1M90 4;  2HMK B;  1JBT A;  5AII A;  1QVF 2;  2GXF A;  5IF6 A;  4FMC A;  1E97 A;  4N6N B;  1DET A;  3CU3 A;  3Q90 A;  2L1S A;  3VF1 A;  1TJD A;  3S29 A;  1LOY A;  4O8S A;  1G02 A;  1IVU A;  1TRP A;  1X1W A;  3UB1 A;  1M1X B;  1VQN 3;  1LNI A;  2OCT A;  4R9L A;  2IA7 A;  1VQO 3;  1UCK A;  1MOL A;  2XRX B;  2PZV A;  2AAD A;  5IG4 A;  4HM1 B;  3OWS A;  3BLZ A;  5STD A;  3QK9 A;  2OWP A;  3DMC A;  1GMR A;  1CYV A;  1YGW A;  1UW1 A;  3PYJ A;  4LMI A;  1LQG C;  4AKZ A;  5JPU A;  5KP4 A;  3BU4 A;  1T3B A;  1N8Q A;  2CH9 A;  4GL6 A;  5IG0 A;  7GSP A;  1M9G A;  3DGY A;  1SQW A;  2GEX A;  2F86 B;  3HZP A;  2D42 A;  4O2H A;  1AVK A;  4CCV A;  2B1X B;  1N9E A;  2F5W A;  2Y74 A;  1O7M B;  4ORL A;  1VQ5 3;  2STD A;  3WA3 A;  1VQ9 3;  4Q53 A;  3PS8 A;  1NO3 A;  2RFR A;  2CKF B;  2UX0 A;  2W03 A;  4RNT A;  1RN4 A;  2AAE A;  4NHF A;  2ML5 A;  1QAK A;  5G2G A;  3X3X A;  2KF5 A;  3WA2 X;  4HVN A;  5GSP A;  3GSP A;  4CDL A;  1UI7 A;  3FG1 A;  3K63 A;  3HI7 A;  2GEY A;  1O7W B;  3CCS 3;  4BTW A;  2D1W A;  2K0M A;  1V57 A;  3FG4 A;  3H3H A;  3PGB A;  3OW2 2;  1X1Y A;  4RBN A;  1JBR A;  1FW7 A;  1RCL A;  4CJN A;  1JKG A;  2L4V A;  3I0Y A;  2E2U A;  1ROA A;  1N9J A;  2WOH A;  3LTD A;  4HM2 B;  3GWR A;  1IQ8 A;  4PEJ A;  1AQZ A;  4HAA A;  3F14 A;  1YIT 3;  5AEW B;  5KP1 A;  1SII A;  2CHC A;  1IV7 A;  1YGE A;  3EQQ B;  5D83 A;  1FGR A;  2CWV A;  1TFK A;  4LEH A;  3BNC A;  1BAO A;  4BL2 A;  2O3O A;  1VQK 3;  5CXO A;  4HJL B;  4H61 A;  1ULI B;  1FGQ A;  2C11 A;  4IT7 A;  1BRH A;  1B3S A;  1TRQ A;  2XR8 B;  3EHC A;  3SED A;  1B2Z A;  1SAR A;  2W6J H;  2XH9 A;  4BTX A;  1FGT A;  3TDG A;  1ASK A;  4ILF A;  3ZFZ A;  2F56 A;  4K1U A;  1RGL A;  1JN5 B;  1OUN A;  4L8P A;  3MPH A;  1BIR A;  1Q86 4;  2Z77 A;  3CCM 3;  1WTH A;  1R4C A;  1TUH A;  1W00 A;  1Q42 A;  1BSC A;  1EUI C;  3I55 3;  2HOH A;  1MNL A;  3BNE A;  3I56 3;  3GZB A;  4R9K A;  4FMD A;  3F8H A;  4K61 A;  1W2Z A;  1JNQ A;  1W01 A;  1RGG A;  2CG0 A;  1YJW 3;  2WOF A;  1KWI A;  2OOV C;  3EE1 A;  1BRN L;  5AYS C;  1B27 A;  1BU4 A;  4NPB A;  3MG2 A;  5CF2 A;  1DE3 A;  3QRD A;  3UL5 A;  5EVH A;  1B2U A;  1DVC A;  2LYX A;  3AHS A;  3LTB A;  4KFF A;  3N8B A;  3LXU X;  1W5Z A;  4EC6 A;  2ZDJ A;  1DYU A;  1I2E A;  2PNC A;  3IJE B;  1DMN A;  1X1U A;  2OTJ 3;  3ECF A;  1V58 A;  2CFG A;  3MG3 A;  5TGN A;  2SAR A;  1MWT A;  2Y73 A;  1EEJ A;  3AMO A;  3AGO A;  1VQ8 3;  2RGQ A;  1LNH A;  3F7X A;  1OAC A;  1U5O A;  2E2V A;  1KSI A;  2XGL A;  3GZY B;  1FYS A;  3IMA B;  2BT3 A;  1JZO A;  2J8X B;  3MSO A;  5ELU A;  5CLK A;  2WO0 A;  5EQL A;  3RNT A;  1RNT A;  2QEX 3;  3EJV A;  3Q1C A;  3OXA A;  3EN1 B;  3KCH A;  5D81 A;  4MJD A;  1PU4 A;  3RGR A;  1RRL A;  2RBI A;  5LC7 A;  5FW5 A;  3JUQ A;  1I8V A;  2W56 A;  2QGU A;  1IVX A;  1B21 A;  5AEU B;  3MKI A;  1M1K 4;  1JZD A;  2I9W A;  2BNG A;  4I5Q A;  1VQM 3;  1I0X A;  2M7O A;  2BHM A;  3CNX A;  4MMY B;  1PFP A;  3DY5 A;  4RNZ A;  5CK6 A;  3GRD A;  1GOY A;  1OH0 A;  1OF5 B;  1UCL A;  1LVN A;  4BU4 A;  1RGF A;  4JRF A;  3CCR 3;  5IEO A;  1ULJ B;  5CF1 A;  3CCU 3;  1RMS A;  3CMA 3;  3LML A;  1OCV A;  4WWU C;  1Q82 4;  2Q07 A;  2YFJ B;  3O8Y A;  1BSE A;  3PZW A;  3WHO A;  3CNM A;  4MMX B;  1TU5 A;  4J8T A;  1LOW A;  3NM7 A;  5BXQ A;  1IV9 A;  1VQ6 3;  1RGC A;  2W04 A;  1CEW I;  1EG9 B;  1OHP A;  1PY3 A;  1NU3 A;  2QIY A;  2ZA4 A;  3NUV A;  3NX0 A;  4J9A A;  3RDE A;  3ROB A;  3D4A A;  1BUJ A;  2FXT A;  1JB4 A;  1BNI A;  1VQ4 3;  4X2H A;  1EQK A;  1GY7 A;  1I2F A;  3Q2P A;  2QA4 3;  1BNJ A;  2CX1 A;  5I97 A;  1R4Y A;  5AYR B;  2IY2 A;  1Q9E A;  1GOV A;  1C7H A;  3EB8 A;  2GU3 A;  3HII A;  2OQE A;  1Q40 A;  5DRE A;  2UUG C;  2CFW A;  3KFQ C;  1Q40 B;  4J5K A;  1RGA A;  3CXC 2;  3VGN A;  1NJI 4;  1SIH A;  1RGK A;  1UUV B;  2Z76 A;  3CPO A;  1DVD A;  3UL6 A;  1AY7 A;  1BOX A;  2IYJ A;  2BO9 B;  1JB2 A;  1N5P A;  1B20 A;  2KRT A; 
#chains in the Genus database with same CATH homology
 4FCZ A;  1UUW B;  1IVW A;  1HU9 A;  4H3U A;  2GBX B;  2IMJ A;  1WMP A;  3CPW 2;  5A0O B;  2OTL 3;  1FA3 A;  1A67 A;  1W6C A;  2LQV A;  4O3V A;  4AKY A;  5D82 A;  3EF8 A;  4FCM A;  3G8Z A;  1OGX A;  1NB3 I;  3FG3 A;  3SLU A;  1WMN A;  5HGR A;  7STD A;  3T8N A;  1QJG A;  4IIA A;  3WDG B;  5IER A;  4HM3 B;  4L8O A;  4FMA A;  1YHQ 3;  2XF3 A;  3WOF B;  3B8L A;  4HM6 B;  2GBW B;  2XFS A;  3MWZ A;  3A76 A;  4WYK A;  4OUQ A;  1TFO A;  2XSH B;  3N9H A;  1W4N A;  4FCJ A;  1OHO A;  4WYK B;  1A2V A;  4HZB B;  4N6V 0;  1D6U A;  3V98 A;  5BVB A;  3FF2 A;  1GY6 A;  4HZ9 B;  4N6L A;  3WOD G;  3L0R A;  4LGQ A;  4O02 B;  3CCV 3;  3OX9 A;  2OOV A;  3KZT A;  2CFL A;  1K73 4;  1OF5 A;  2CG1 A;  1CYU A;  3J7Y d;  2KCD A;  4G1M B;  4HM5 B;  1E3R A;  1AV4 A;  2HMN B;  3GZR A;  1W6G A;  8CHO A;  4XDV A;  3CCE 3;  1RKY A;  3NV0 A;  3NQZ A;  5KP3 A;  1W02 A;  4OVM A;  3EBT A;  5LC6 A;  1RJO A;  3SX1 A;  3RGA A;  3EN8 A;  1STF I;  3U97 A;  1Q81 4;  1W7C A;  3SXX A;  1FGO A;  4HKV B;  5AI1 A;  1A2K A;  5AIH A;  3LTA A;  3JUM A;  1AVL A;  1VZZ A;  1EA2 A;  2C10 A;  3LT9 A;  2WGQ A;  4RNY A;  1QVG 2;  1YJ9 3;  2YFL B;  3HX8 A;  3FH1 A;  3K0Z A;  2XEP A;  4K90 B;  3T8U A;  3LT8 A;  3CME 3;  5JPP A;  3JUP A;  3NBJ A;  3GAX A;  2FGT A;  1OHS A;  3V92 A;  4R4K A;  1BUQ A;  1W2B 2;  3HK4 A;  3FKA A;  3LZA A;  1DMQ A;  1WMO A;  2BMR B;  1DMM A;  2E2T A;  3KN4 A;  1K41 A;  3T0U A;  3G6E 3;  4GB5 A;  3UNL A;  1Y4K A;  2Z6B A;  2XFT A;  5IW9 A;  3CCQ 3;  1K28 A;  3M8C A;  3LH4 A;  4HM8 B;  3E99 A;  2O9U X;  3BNB A;  4FR9 A;  4KFD A;  3X42 A;  3CC4 3;  1JJ2 2;  5IG3 A;  3CD6 3;  3DGM A;  3MYT A;  3SOY A;  1TIJ A;  2YFI B;  3VSY A;  1SPU A;  2CFD A;  3LTC A;  1G96 A;  1GD3 A;  5IG5 A;  3KE7 A;  1AR0 A;  3LOY A;  4HBR A;  5EEO A;  1N8R 4;  5IEN A;  5FGO A;  4IPB A;  3STD A;  4AEQ A;  3SOA A;  2P09 A;  2YX9 A;  2FNQ A;  3NHX A;  4ZM8 A;  4N6U A;  1ISK A;  1IT7 A;  1IVV A;  3BB9 A;  3FLJ A;  3OV4 A;  5ELJ A;  1O7N B;  3CC2 3;  2CIU A;  3DGN A;  4EXR A;  3ALA A;  3K7C A;  4KFE A;  4EBG A;  3F8X A;  4TX4 A;  4R1K A;  2CW9 A;  4WFO A;  3PXM A;  4N3V A;  3NBB A;  2F99 A;  2P38 A;  1ZO2 A;  4QWT A;  4RZM A;  2WGO A;  3NV0 B;  3AMO B;  1GD4 A;  2HMO B;  2B24 B;  2BMQ B;  2CWT A;  2W0Q A;  2KXG A;  3D3L A;  3S5C A;  1YJN 3;  2XSO B;  1OGZ A;  4U13 A;  3NQY A;  3S28 A;  1KC8 4;  4NRE A;  4HYZ A;  3X41 A;  1TP6 A;  2CK3 H;  1IT8 A;  3JVC A;  3OWU A;  1RRH A;  3CCJ 3;  3K9M C;  3N54 B;  1D6Y A;  3PCS A;  1JKG B;  2GU1 A;  3WOE B;  4XDW A;  1IQX A;  1Z1S A;  3UJM A;  3S27 A;  3DXO A;  1KD1 4;  5IEP A;  2JDI H;  3KII A;  1E3V A;  3CC7 3;  1LOX A;  4HM0 B;  4XBT A;  1U8C B;  4WHA A;  1A90 A;  1IDP A;  3WMD A;  3EC9 A;  3NM2 A;  2A15 A;  3JUO A;  4K1V A;  1YIJ 3;  4HM4 B;  2IUJ A;  1O7G B;  2Z7A A;  1S5A A;  4WP5 A;  1K9M 4;  2F98 A;  2W2C A;  4LZI A;  2HML B;  3PCR A;  3S67 A;  1K8A 4;  1N5H A;  1S72 3;  3V99 A;  3X3Z A;  1JN5 A;  1IK3 A;  2P05 A;  4N6T A;  4BTY A;  2K54 A;  2RCD A;  3LYG A;  4STD A;  1NDO B;  3DM8 A;  4N6O B;  2P0X A;  3DGL A;  1L5G B;  4R80 A;  1JV2 B;  2MC8 A;  1O7P B;  2CC3 A;  1QMA A;  3B4P A;  4MMZ B;  4EV2 A;  1US1 A;  2ML6 A;  2CWU A;  2XGN A;  1YVB I;  1IQY A;  3JUN A;  1VQ7 3;  3DZL A;  3FSD A;  1D6Z A;  3K5T A;  1WNH A;  2W9P A;  1QAL A;  1SJW A;  3FGY A;  4FMB A;  3G4S 3;  2ZL8 A;  3CCL 3;  1GS3 A;  3KSE D;  5AIF A;  3D9R A;  2V1L A;  2R4I A;  1OPY A;  3BND A;  1T5Y A;  4KVH A;  2CFK A;  2HMJ B;  4EYC A;  5AIG A;  2JQ5 A;  1FUW A;  2BMO B;  3DUK A;  3X3Y A;  4XBY A;  1ZX2 A;  3B4O A;  1NB5 I;  4JF8 A;  1UI8 A;  3IPT A;  5JBS A;  3MHE A;  1J2B A;  2P0M A;  1LXE A;  4X2O A;  3F7S A;  3HIG A;  1VQP 3;  3OWY A;  3EX9 A;  2HMM B;  4KZ1 A;  3KSP A;  3FCS B;  3EBY A;  2INX A;  2W56 B;  1W6Y A;  4EV5 A;  3DGO A;  3U1W A;  4MEI A;  1HKX A;  3G0K A;  1STD A;  1CQS A;  1F8N A;  3B7C A;  4LSO A;  4XB5 A;  3FZW A;  1NWW A;  4OK0 A;  6STD A;  1Q7Y 4;  2SBL A;  1ROV A;  3MG1 A;  2MF7 A;  3G16 A;  3NBR A;  4HM7 B;  1YI2 3;  4L7K A;  3FF0 A;  2RSX A;  2IUK A;  3KKG A;  1GY5 A;  1JB5 A;  1IU7 A;  1RN7 A;  2OQE C;  4XM4 A;  5DRV A;  1VQL 3;  3X40 A;  1JRQ A;  2W9Q A;  1V74 A;  3SVA A;  3F40 A;  1KQS 2;  1QAF A;  3NXJ A;  3G71 3;  3H51 A;  1FGM A;  1WQL B;  1O7H B;  3GZX B;  4N6M A;  4XBX A;  3ER7 A;  3F9S A;  1EKM A;  4I4K A;  1GYB A;  1M90 4;  2HMK B;  5AII A;  1QVF 2;  2GXF A;  5IF6 A;  4FMC A;  1E97 A;  4N6N B;  3CU3 A;  3Q90 A;  3VF1 A;  3S29 A;  4O8S A;  3UB1 A;  1IVU A;  1M1X B;  1VQN 3;  2OCT A;  4R9L A;  2IA7 A;  1VQO 3;  1MOL A;  2XRX B;  2PZV A;  5IG4 A;  4HM1 B;  3OWS A;  3BLZ A;  5STD A;  3QK9 A;  2OWP A;  3DMC A;  1CYV A;  1UW1 A;  3PYJ A;  4LMI A;  5JPU A;  4AKZ A;  5KP4 A;  1N8Q A;  2CH9 A;  4GL6 A;  5IG0 A;  1M9G A;  1SQW A;  2GEX A;  2F86 B;  3HZP A;  2D42 A;  4O2H A;  1AVK A;  4CCV A;  2B1X B;  1N9E A;  2Y74 A;  1O7M B;  4ORL A;  1VQ5 3;  2STD A;  3WA3 A;  1VQ9 3;  4Q53 A;  3PS8 A;  1NO3 A;  2RFR A;  2CKF B;  2UX0 A;  2W03 A;  5G2G A;  4NHF A;  2ML5 A;  1QAK A;  3X3X A;  3WA2 X;  4HVN A;  4CDL A;  1UI7 A;  3FG1 A;  3K63 A;  3HI7 A;  2GEY A;  1O7W B;  3CCS 3;  4BTW A;  2D1W A;  2K0M A;  3FG4 A;  3H3H A;  3OW2 2;  3PGB A;  4RBN A;  1JKG A;  2L4V A;  3I0Y A;  2E2U A;  1ROA A;  1N9J A;  2WOH A;  3LTD A;  4HM2 B;  3GWR A;  1IQ8 A;  4PEJ A;  3F14 A;  1YIT 3;  5AEW B;  5KP1 A;  1SII A;  2CHC A;  1IV7 A;  1YGE A;  3EQQ B;  5D83 A;  1FGR A;  2CWV A;  1TFK A;  4LEH A;  3BNC A;  1VQK 3;  2O3O A;  5CXO A;  4HJL B;  4H61 A;  1ULI B;  1FGQ A;  2C11 A;  4IT7 A;  2XR8 B;  3EHC A;  3SED A;  2W6J H;  2XH9 A;  4BTX A;  1FGT A;  3TDG A;  1ASK A;  4K1U A;  1JN5 B;  1OUN A;  4L8P A;  3MPH A;  1Q86 4;  2Z77 A;  3CCM 3;  1WTH A;  1R4C A;  1TUH A;  1W00 A;  1Q42 A;  3I55 3;  1MNL A;  3BNE A;  3I56 3;  3GZB A;  4R9K A;  4FMD A;  3F8H A;  4K61 A;  1W2Z A;  1JNQ A;  1W01 A;  2CG0 A;  1YJW 3;  2WOF A;  1KWI A;  2OOV C;  3EE1 A;  5AYS C;  3MG2 A;  5CF2 A;  3QRD A;  3UL5 A;  5EVH A;  1DVC A;  2LYX A;  3LTB A;  4KFF A;  3N8B A;  3LXU X;  1W5Z A;  4EC6 A;  2ZDJ A;  1DYU A;  2PNC A;  3IJE B;  1DMN A;  2OTJ 3;  3ECF A;  2CFG A;  3MG3 A;  5TGN A;  2Y73 A;  3AMO A;  1VQ8 3;  2RGQ A;  1LNH A;  3F7X A;  1OAC A;  1U5O A;  2E2V A;  1KSI A;  2XGL A;  3GZY B;  3IMA B;  2BT3 A;  3MSO A;  5ELU A;  5EQL A;  5CLK A;  2WO0 A;  2QEX 3;  3EJV A;  3Q1C A;  3OXA A;  3EN1 B;  5D81 A;  4MJD A;  1PU4 A;  3RGR A;  1RRL A;  5LC7 A;  5FW5 A;  3JUQ A;  2W56 A;  2QGU A;  1IVX A;  5AEU B;  3MKI A;  1M1K 4;  2I9W A;  2BNG A;  1VQM 3;  2M7O A;  2BHM A;  3CNX A;  4MMY B;  1PFP A;  3DY5 A;  4RNZ A;  5CK6 A;  3GRD A;  1OH0 A;  1OF5 B;  1LVN A;  4JRF A;  3CCR 3;  5IEO A;  1ULJ B;  5CF1 A;  3CCU 3;  3CMA 3;  3LML A;  1OCV A;  4WWU C;  1Q82 4;  2Q07 A;  2YFJ B;  3O8Y A;  3PZW A;  3CNM A;  4MMX B;  1TU5 A;  4J8T A;  3NM7 A;  5BXQ A;  1IV9 A;  1VQ6 3;  2W04 A;  1CEW I;  1EG9 B;  1OHP A;  2QIY A;  1NU3 A;  3NUV A;  3NX0 A;  4J9A A;  3RDE A;  3ROB A;  2FXT A;  1JB4 A;  1VQ4 3;  4X2H A;  1EQK A;  1GY7 A;  3Q2P A;  2QA4 3;  5I97 A;  5AYR B;  1C7H A;  3EB8 A;  2GU3 A;  3HII A;  2OQE A;  1Q40 A;  5DRE A;  2CFW A;  3KFQ C;  1Q40 B;  1NJI 4;  3CXC 2;  3VGN A;  1SIH A;  1UUV B;  2Z76 A;  3CPO A;  1DVD A;  3UL6 A;  2BO9 B;  1JB2 A;  1N5P A;  2KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...