3FF2A

Crystal structure of an uncharacterized cystatin fold protein (saro_2299) from novosphingobium aromaticivorans dsm at 1.90 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
GMSNLETAKAMIAAYNAQDVDTYVSYMTDDACEANYRGDVVREGKEGTRSGLAAAFARWPQNHAEIKDAQQVGTYVLMREHVTRGPATDGSPLVEPFDVVAVYSFEGDKCSRVEFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized cystatin fold protein (YP_497570.1) from NTF
publication title Crystal structure of uncharacterized cystatin fold protein (YP_497570.1) from NTF2 superfamily (YP_497570.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.90 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Unknown function
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ff2A00
2RCDA 4LMIA 2XRXB 1JN5B 4XB5A 2A15A 6STDA 2STDA 1E3VA 3B8LA 1VZZA 1ZX2A 3RGAA 3KKGA 1OPYA 2IMJA 5JPUA 1OH0A 2YFIB 3STDA 3OXAA 3MKIA 2Z76A 1NU3A 1Q40B 3GWRA 5D82A 3HZPA 2K54A 3K7CA 1UUWB 3JUMA 2BMRB 7STDA 3WMDA 5IG0A 4XBXA 3H51A 3MG3A 5D83A 3CPOA 1NDOB 1GY5A 4R9KA 3EN8A 1JB4A 5AEUB 1WQLB 3OV4A 3K0ZA 3ROBA 3MYTA 4HM2B 3E99A 3OWYA 1W00A 4HM3B 2BNGA 3OX9A 5DREA 4HJLB 1QJGA 2INXA 5TGNA 4HM5B 1A2KA 1SJWA 3F40A 4I4KA 5IENA 2HMJB 1O7NB 3GRDA 5AI1A 3DMCA 3B7CA 3MHEA 3CNMA 2HMNB 4XDWA 2PZVA 3B4OA 1ULJB 3NV0B 1OF5A 5IEPA 1OHOA 3LZAA 1W02A 3MG2A 1HKXA 4IIAA 5BXQA 4K1VA 4L8PA 1GS3A 3EN1B 4FCJA 4HM6B 3M8CA 4H3UA 1GY6A 2F99A 1OHSA 3DXOA 3T8NA 3RGRA 1DMNA 3FZWA 3NUVA 4U13A 3GZRA 3UJMA 2F86B 3IPTA 4Q53A 5CK6A 2XSOB 5KP4A 4WP5A 5JPPA 5CF1A 1OHPA 4FCMA 1W6YA 2GBWB 1Z1SA 1ASKA 2GXFA 3GZXB 3NHXA 3NBRA 4XDVA 5DRVA 4CDLA 4RZMA 2XR8B 4X2OA 2YFLB 1OCVA 3BLZA 1OUNA 3VSYA 1AR0A 4HM7B 4HZ9B 5IG4A 5BVBA 3S5CA 2F98A 5G2GA 3NXJA 3LYGA 1JKGA 1U5OA 4R9LA 2B24B 4KVHA 4WYKA 3KSPA 3HX8A 3JUNA 3Q90A 3ECFA 4XBTA 3T8UA 5HGRA 4L7KA 4HKVB 3MSOA 3FH1A 1W01A 2BMQB 2I9WA 3GZYB 4MJDA 1Q42A 3FSDA 1IDPA 3EBTA 3OWSA 1TP6A 2RGQA 1O7GB 4XM4A 2UX0A 4PEJA 1JKGB 1O7HB 3UNLA 3DZLA 3VGNA 5IEOA 3FKAA 3CNXA 2JQ5A 1JN5A 2HMMB 4WYKB 2OWPA 2HMKB 5AIIA 1BUQA 3JUOA 4J8TA 2Z77A 3A76A 5D81A 1C7HA 1EG9B 1DMQA 3H3HA 5CLKA 4OVMA 3SEDA 1CQSA 5KP1A 5IG3A 1ISKA 1ZO2A 2W2CA 1DMMA 3FF0A 3JUQA 1S5AA 5AIFA 1Q40A 2XSHB 3CU3A 1EA2A 3HK4A 3EQQB 3FGYA 4LGQA 4HVNA 3DM8A 4GB5A 1OF5B 1JB5A 5CF2A 5IERA 3FF2A 3NM2A 4ORLA 4K1UA 1K41A 5KP3A 2Z7AA 1NWWA 5AIGA 2YFJB 2GEYA 3FLJA 4L8OA 4OUQA 3EHCA 3OWUA 4X2HA 3I0YA 3F9SA 4HM0B 8CHOA 5AIHA 4HM8B 4STDA 1E3RA 3F8HA 5IG5A 3F8XA 1OGXA 1OGZA 5EVHA 2CKFB 2QIYA 3GZBA 4WWUC 4HZBB 2CHCA 3NV0A 3KE7A 5AEWB 3F7SA 2QGUA 5STDA 1UUVB 2GBXB 3JUPA 3DUKA 1O7PB 3MG1A 3F14A 1E97A 3B4PA 5IF6A 1TUHA 3BB9A 3EF8A 4N3VA 1STDA 2BMOB 2B1XB 2R4IA 4R1KA 3KZTA 3EC9A 4LEHA 4HM4B 5CXOA 3F7XA 3D9RA 3G8ZA 3SOAA 1GY7A 1ULIB 2RFRA 1JB2A 3EX9A 2HMLB 3G0KA 1GYBA 2GEXA 3SOYA 5FW5A 4HM1B 1O7MB 2HMOB 3EJVA 1O7WB 3ER7A 1QMAA 3EBYA 4J9AA 4XBYA 3G16A
chains in the Genus database with same CATH superfamily
2RCDA 1UCKA 4LMIA 2XRXB 4TX4A 2F4YA 3NQZA 2Y74A 3BIRA 4N6V0 1JRQA 1T2IA 2FGTA 4CCVA 1JN5B 3D3LA 1IVUA 1W2B2 4XB5A 2OQEC 2A15A 6STDA 4KT3B 4DKIA 2STDA 1EKMA 1RGLA 1JBSA 1E3VA 1HYFA 1RRHA 1RGHA 3B8LA 1VZZA 1ZX2A 2AADA 4J5KA 3RGAA 2P0MA 1CH0A 3KKGA 1MWUA 1OPYA 2XFTA 2GU1A 2IMJA 5JPUA 1OH0A 2KF5A 2ML6A 1BVIA 2YFIB 3WA2X 3CCU3 1YGWA 1YIJ3 3WOFB 1RMSA 2ZL8A 2HOHA 3ZFZA 1A67A 3DGLA 3WOEB 3V98A 1QAKA 1DETA 1QVF2 3STDA 1RGKA 2F5MA 6GSPA 1UDII 1BRJA 3MKIA 3OXAA 2Z76A 3PZWA 1N5PA 6RNTA 2KXGA 3X3YA 1NU3A 2KAAA 4CJNA 1Q40B 1W6GA 3GWRA 7GSPA 1B2SA 1RGEA 3HZPA 5D82A 1YIT3 1ZS7A 3SLUA 2K54A 4O02B 2CG0A 1LXEA 3K7CA 1UUWB 3JUMA 1J2BA 1VQN3 1A90A 2CW9A 2BMRB 7STDA 1I3FA 4K61A 3WMDA 3L0RA 1N9EA 1I2GA 4XBXA 3H51A 5IG0A 3MG3A 1DVDA 1MWSA 5D83A 1RCLA 1X1YA 3LT9A 1RJOA 2CFWA 3CPOA 1IQYA 1NDOB 1GY5A 4LYLB 4BIRA 3OW22 1M1K4 1LOYA 3BNCA 1YVSA 4R9KA 3CME3 5EQLA 1JV2B 3QK9A 1IK3A 3EN8A 2KCDA 4HAAA 1JB4A 1N9JA 5AEUB 1WQLB 4R80A 2Q07A 2XGLA 1S723 3OV4A 3K0ZA 3QRDA 3ROBA 1NB5I 3UL6A 3MYTA 4H61A 4HM2B 3E99A 3OWYA 3KSED 1BNIA 1W00A 1AVKA 2KRTA 2LYXA 4HM3B 1BOXA 1RCKA 2BNGA 3OX9A 2W04A 5DREA 4HJLB 1BNFA 1QJGA 2INXA 2RBIA 5TGNA 1BRGA 4HM5B 1A2KA 4MMYB 4RNYA 1G02A 2PNCA 1RLSA 1SJWA 4FMCA 2D42A 4O3VA 1RN4A 4O2HA 1MGRA 1SIIA 5M18A 4ZM8A 1A2PA 4EV2A 1KSIA 1RGAA 3F40A 4I4KA 3G713 2XGNA 4CPKA 5GSPA 5IENA 1B27A 1A2VA 4G1MB 1IVWA 2HMJB 1O7NB 3GRDA 5AI1A 3DMCA 2BU4A 1GOYA 5AYSC 1GD4A 2UGIA 5EEOA 1OACA 1FGOA 1T2HA 3PCSA 3B7CA 4IT7A 2P05A 3PYJA 1SIHA 1RTUA 3MHEA 3CNMA 1RGCA 3X3ZA 1V58A 1R4YA 4NPBA 5M1AA 3KN4A 1TTOA 1Q7Y4 4KZ1A 2HMNB 2XF3A 4KFFA 4XDWA 1BRHA 2PZVA 3B4OA 2F56A 3X3XA 1IQXA 1F8NA 3X42A 1ULJB 2CC3A 3NV0B 1BSEA 2ZHXB 1BRNL 1VQ83 1OF5A 5IEPA 1RN1A 1OHOA 5RNTA 3LZAA 1W02A 3MG2A 1FYSA 4EV5A 3CCQ3 1HKXA 4IIAA 5BXQA 2OTL3 1L5GB 3PXMA 4K1VA 1I2EA 4N6LA 3CCE3 1CYUA 1FGQA 4L8PA 1R4CA 3VF1A 1RGFA 1GS3A 3EN1B 4FCJA 1BIRA 3D79A 4HM6B 3M8CA 4H3UA 1LRAA 3LTDA 4WFOA 4RNTA 1GY6A 1W2ZA 2F99A 1OHSA 3DXOA 1LNIA 3T8NA 3S27A 1TJDA 3RGRA 1DMNA 3FZWA 3NUVA 1UGHI 4U13A 3GZRA 1I2FA 4BTXA 1RDSA 3LXUX 3UJMA 2F86B 2J8XB 3IPTA 4Q53A 3UB1A 3WDGB 1BNRA 1BUJA 1FW7A 2MF7A 3ZG5A 1B3SA 5CK6A 2XSOB 5KP4A 1M1XB 2C11A 4WP5A 4BTYA 3G6E3 5JPPA 3CCS3 4AKZA 5CF1A 1Q814 1OHPA 1N8QA 3O8YA 2W56A 3AGOA 2R41A 1DYUA 3CCR3 3V92A 4FCMA 2OQEA 1K9M4 4FMAA 1VQ93 2RNTA 1W6YA 2GBWB 2CWUA 2H0IA 2K3DA 4QWTA 1PY3A 1MGWA 3D5GA 1Q864 1VQ73 2BHMA 1LOWA 1YGEA 1BNGA 2GU3A 1Z1SA 3CCM3 3U97A 1Q9EA 1HU9A 3LTCA 1ASKA 2ML5A 2GXFA 4FMBA 3NBBA 8RNTA 3GZXB 3DGNA 3NHXA 3NBRA 4XDVA 5DRVA 3S29A 4CDLA 4RZMA 2P09A 1Y4KA 3LMLA 3MPHA 3NX0A 2XR8B 4X2OA 2IY2A 1PFPA 3TDGA 1VQ53 2WOHA 1IU7A 1YI23 2YFLB 3Q3FA 3MWZA 1OCVA 3BLZA 1OUNA 3VSYA 1AR0A 4HM7B 1VQM3 4LSOA 4HZ9B 5IG4A 5BVBA 1B2XA 3S5CA 2F98A 1AY7A 5G2GA 1BAOA 3NXJA 3LYGA 1JKGA 3D5IA 3BU4A 2CFDA 1GSPA 1U5OA 3CC73 2QA43 3CMA3 4R9LA 2WGOA 3DH2A 1BSCA 2B24B 2SBLA 4KVHA 1X1XA 1VQ63 4WYKA 3KSPA 4I5QA 1I70A 3HX8A 3JUNA 3Q90A 2KF4A 3ECFA 1BSAA 4XBTA 3LH4A 3T8UA 1ZGXA 4RBNA 4L7KA 5HGRA 2FXTA 4NREA 5ELUA 2F5WA 1TFKA 4HKVB 1BSBA 2ZA4A 2JDIH 3RNTA 1VQK3 2OOVA 3U1WA 3NBJA 3MSOA 1LOXA 1FUSA 3FH1A 4K90B 4BU4A 1M904 1W01A 2BMQB 2GSPA 1EEJA 4N6TA 2UUGC 3X40A 1I0XA 1STFI 2I9WA 3GZYB 3FG3A 4N6UA 7RNTA 4MJDA 3IJEB 3AMOA 1FA3A 4RNZA 5HOHA 1Q7HA 3GAXA 1RSNA 2CFKA 1GOUA 1Q42A 2K0MA 3FSDA 1IDPA 4MMXB 3EBTA 1BANA 1W5ZA 5LC7A 2W03A 1WTHA 3OWSA 1TP6A 4FMDA 2RGQA 1O7GB 4ILFA 1VQP3 1HZ1A 4XM4A 2UX0A 1YVBI 4PEJA 2W9QA 1BNSA 1UCJA 4AKYA 1LVNA 1JKGB 1O7HB 3URPA 1TRPA 1RNTA 3DZLA 3UNLA 1AQZA 3K5TA 3VGNA 1VQL3 4N6NB 5IEOA 1US1A 3FKAA 2CH9A 1BSDA 4GSPA 3CNXA 5G1KA 3RDEA 4GHOA 1GOVA 1JN5A 2JQ5A 3CCV3 2HMMB 4WYKB 1D6ZA 1IQ8A 2HMKB 2OWPA 1UCIA 1U8CB 1ROVA 2XH9A 5AIIA 4O8SA 3X41A 1BUQA 2IUJA 3JUOA 1BNJA 4J8TA 2Z77A 3A76A 4R4KA 5D81A 3T0UA 1C7HA 1EG9B 1DMQA 2WGQA 3H3HA 1CEWI 4LZIA 5G1LA 1DE3A 1SARA 1VQQA 2P38A 1WNHA 5CLKA 3ZG0A 4OVMA 1BRKA 3IMAB 2KF6A 3NM7A 3FG4A 5AYRB 1UI7A 1IT8A 1JZOA 1QALA 2CK3H 3SEDA 3K9MC 1UUGB 1YJW3 1CQSA 1I3IA 5KP1A 3FG1A 2ZDJA 3GSPA 4FR9A 1D6YA 5IG3A 5M19A 4EBGA 1WMOA 3S67A 1ISKA 1ZO2A 2W2CA 1UI8A 3JVCA 3I563 1MWTA 1QVG2 1DMMA 3FF0A 4MMZB 3JUQA 1S5AA 5AIFA 1B2MA 1Q40A 1FGMA 2XSHB 1KQS2 2CIUA 4N6MA 5IW9A 4EC6A 3CXC2 1EQKA 3CU3A 1JBRA 1EA2A 3HK4A 3EQQB 1AV4A 1UW1A 2M7OA 3CCJ3 1RN7A 2CX0A 3FGYA 5BU4A 1NB3I 1T5YA 3N54B 1IVXA 2Z6BA 4LGQA 1IV7A 3N9HA 3BNDA 3PS8A 1FUWA 1X1UA 4HYZA 2XEPA 3J7Yd 3CC23 4HVNA 1B21A 3FCSB 2W6JH 2CG1A 1YJ93 2BO9B 3DM8A 4GB5A 5ELJA 1AVLA 1JJ22 1JNQA 1B20A 1LQMB 1OF5B 1C54A 1JB5A 1FGRA 2LQVA 2E2VA 2RSXA 5CF2A 1BNEA 1FZUA 2QEX3 5IERA 3FF2A 3KFQC 2FNQA 2OCTA 1YJN3 3NM2A 1TIJA 1GMPA 2BT3A 4K1UA 4ORLA 1K41A 5KP3A 2E2TA 2Z7AA 2CWVA 1W4NA 1NWWA 5AIGA 3WA3A 2H0HA 2YFJB 2GEYA 4EW5A 3G4S3 3SXXA 3LOYA 4JF8A 3D4AA 1LQGC 3FLJA 4L8OA 4OUQA 3EHCA 1RGGA 3OWUA 4X2HA 3I0YA 1M9GA 2C10A 3F9SA 1X1WA 1LOVA 4HM0B 2L4VA 3AHWA 1WMPA 1YNVX 1Q824 8CHOA 5AIHA 2BIRA 3BNEA 3HIIA 1V57A 2YX9A 2O3OA 4HM8B 3ALAA 1BGSA 3AHSA 2L1SA 3LT8A 4STDA 1E3RA 1DVCA 1MWRA 3F8HA 3F8XA 4AEQA 5IG5A 1KC84 1SQWA 1N8R4 2E2UA 2IUKA 3DGOA 1N5HA 1K28A 9RNTA 1BRSA 3DGMA 2W56B 1KD14 1VQO3 3A5EA 1UCLA 1OGXA 2MC8A 3UL5A 2OTJ3 3NQYA 1OGZA 3HOHA 5EVHA 2CKFB 3CD63 5FGOA 1TU5A 2CFGA 2QIYA 2OOVC 4BTWA 1I8VA 3GZBA 3S28A 4WWUC 2H0GA 1SPUA 4HZBB 1RKYA 3KIIA 2W0QA 3CC43 4EYCA 2CHCA 3WODG 3WR2A 3NV0A 3KE7A 1G96A 1IYYA 1NNVA 1BRIA 1FUTA 4IPBA 1I0VA 5AEWB 1MNLA 3F7SA 3Q2PA 2AAEA 2QGUA 1LNHA 4HOHA 2C4BA 3KCHA 5STDA 5I97A 1IVVA 3CCL3 1UUVB 2GBXB 3JUPA 1VQ43 4KFEA 3DUKA 4FCZA 4MEIA 3I553 3SYUA 1O7PB 3MG1A 5BIRA 3F14A 3LTAA 4JRFA 3HI7A 1W7CA 3N8BA 1E97A 3K63A 3BNBA 2D1WA 3Q1CA 2V1LA 3B4PA 3DY5A 1BU4A 5IF6A 4J5GA 4N6OB 2IYJA 2CX1A 1TUHA 2SARA 3BB9A 1K8A4 1YHQ3 3EF8A 1TRQA 1W6CA 4N3VA 1STDA 3PGBA 1MOLA 4BL2A 2W9PA 2BMOB 1RNBA 1WMNA 2B1XB 2R4IA 4HBRA 1QAFA 4R1KA 2O9UX 3KZTA 4WHAA 4KFDA 3DGYA 2Y73A 3EC9A 1GMRA 1T3BA 4LEHA 4HM4B 1IV9A 1V74A 5CXOA 4NHFA 3F7XA 4EXRA 3V99A 2WOFA 3D9RA 3G8ZA 1GD3A 1JZDA 1KWIA 5LC6A 1GY7A 1ULIB 2RFRA 3SOAA 4BL3A 1JB2A 2P0XA 2HMLB 3EX9A 1NJI4 1TFOA 2CWTA 1GMQA 3AGNA 3G0KA 3SX1A 5A0OB 2IA7A 1GYBA 3AMOB 1JBTA 1D6UA 1PYLA 3EB8A 1EUIC 1FGTA 1RHLA 3LTBA 1UGIA 4OK0A 1G0TA 3SVAA 1K734 2GEXA 3SOYA 1RRLA 5FW5A 1CYVA 4HM1B 1O7MB 1NO3A 3HIGA 5JBSA 1B2ZA 1B2UA 2HMOB 3EJVA 3WHOA 1O7WB 3CPW2 3ER7A 1PU4A 1ROAA 4GL6A 1QMAA 3EE1A 2CFLA 3EBYA 2XFSA 1IT7A 4J9AA 2KF3A 4XBYA 2WO0A 3G16A 3PCRA
chains in the Genus database with same CATH topology
2RCDA 4LMIA 2XRXB 4TX4A 3NQZA 2Y74A 4N6V0 1JRQA 2FGTA 4CCVA 1JN5B 3D3LA 1IVUA 1W2B2 4XB5A 2OQEC 2A15A 6STDA 2STDA 1EKMA 1E3VA 1RRHA 3B8LA 1VZZA 1ZX2A 3RGAA 2P0MA 3KKGA 1OPYA 2XFTA 2GU1A 2IMJA 5JPUA 1OH0A 2ML6A 2YFIB 3WA2X 3CCU3 1YIJ3 3WOFB 2ZL8A 1A67A 3DGLA 3WOEB 3V98A 1QAKA 1QVF2 3STDA 3OXAA 3MKIA 2Z76A 3PZWA 1N5PA 2KXGA 3X3YA 1NU3A 1Q40B 1W6GA 3GWRA 5D82A 3HZPA 1YIT3 3SLUA 2K54A 4O02B 2CG0A 1LXEA 3K7CA 1UUWB 3JUMA 1J2BA 1VQN3 1A90A 2CW9A 2BMRB 7STDA 4K61A 3WMDA 3L0RA 1N9EA 5IG0A 4XBXA 3H51A 1DVDA 3MG3A 5D83A 3LT9A 1RJOA 2CFWA 3CPOA 1IQYA 1NDOB 1GY5A 3OW22 1M1K4 3BNCA 4R9KA 3CME3 5EQLA 1JV2B 3QK9A 1IK3A 3EN8A 2KCDA 1JB4A 1N9JA 5AEUB 1WQLB 4R80A 2Q07A 2XGLA 1S723 3OV4A 3K0ZA 3QRDA 3ROBA 1NB5I 3UL6A 3MYTA 4H61A 4HM2B 3E99A 3OWYA 3KSED 1W00A 1AVKA 2KRTA 2LYXA 4HM3B 2BNGA 3OX9A 2W04A 5DREA 4HJLB 1QJGA 2INXA 5TGNA 4HM5B 1A2KA 4MMYB 4RNYA 2PNCA 1SJWA 4O3VA 4FMCA 2D42A 4O2HA 1SIIA 4ZM8A 4EV2A 1KSIA 3F40A 4I4KA 3G713 2XGNA 5IENA 1A2VA 4G1MB 1IVWA 2HMJB 1O7NB 3GRDA 5AI1A 3DMCA 5AYSC 1GD4A 5EEOA 1OACA 1FGOA 3PCSA 4IT7A 3B7CA 2P05A 3PYJA 1SIHA 3MHEA 3CNMA 3X3ZA 3KN4A 1Q7Y4 4KZ1A 2HMNB 2XF3A 4KFFA 4XDWA 2PZVA 3B4OA 3X3XA 1IQXA 1F8NA 3X42A 1ULJB 2CC3A 3NV0B 1VQ83 1OF5A 5IEPA 1OHOA 3LZAA 1W02A 3MG2A 3CCQ3 4EV5A 1HKXA 4IIAA 5BXQA 2OTL3 1L5GB 3PXMA 4K1VA 4N6LA 3CCE3 1CYUA 1FGQA 4L8PA 1R4CA 3VF1A 1GS3A 3EN1B 4FCJA 4HM6B 3M8CA 4H3UA 3LTDA 4WFOA 1GY6A 1W2ZA 2F99A 1OHSA 3DXOA 3T8NA 3S27A 3RGRA 1DMNA 3FZWA 3NUVA 4U13A 3GZRA 4BTXA 3LXUX 3UJMA 2F86B 3IPTA 4Q53A 3WDGB 3UB1A 2MF7A 5CK6A 2XSOB 5KP4A 1M1XB 2C11A 4WP5A 4BTYA 3G6E3 5JPPA 3CCS3 4AKZA 5CF1A 1Q814 1OHPA 1N8QA 3O8YA 2W56A 1DYUA 3CCR3 3V92A 4FCMA 2OQEA 1K9M4 4FMAA 1VQ93 1W6YA 2GBWB 2CWUA 4QWTA 1Q864 1VQ73 2BHMA 1YGEA 2GU3A 1Z1SA 3CCM3 3U97A 1HU9A 3LTCA 1ASKA 2ML5A 2GXFA 4FMBA 3NBBA 3GZXB 3DGNA 3NHXA 3NBRA 4XDVA 5DRVA 3S29A 4CDLA 4RZMA 2P09A 1Y4KA 3LMLA 3MPHA 3NX0A 2XR8B 4X2OA 1VQ53 1PFPA 3TDGA 2WOHA 1IU7A 1YI23 2YFLB 3MWZA 1OCVA 3BLZA 1OUNA 3VSYA 1AR0A 4HM7B 1VQM3 4LSOA 4HZ9B 5IG4A 5BVBA 3S5CA 2F98A 5G2GA 3NXJA 3LYGA 1JKGA 2CFDA 1U5OA 3CC73 2QA43 3CMA3 4R9LA 2WGOA 2SBLA 2B24B 4KVHA 1VQ63 4WYKA 3KSPA 3HX8A 3JUNA 3Q90A 3ECFA 4XBTA 3LH4A 3T8UA 4RBNA 4L7KA 5HGRA 2FXTA 4NREA 5ELUA 1TFKA 4HKVB 2JDIH 1VQK3 2OOVA 3U1WA 3NBJA 3MSOA 1LOXA 3FH1A 4K90B 1M904 1W01A 2BMQB 4N6TA 3X40A 1STFI 2I9WA 3GZYB 3FG3A 4N6UA 4MJDA 3IJEB 3AMOA 1FA3A 4RNZA 3GAXA 2CFKA 1Q42A 2K0MA 3FSDA 1IDPA 4MMXB 3EBTA 1W5ZA 5LC7A 2W03A 1WTHA 3OWSA 1TP6A 4FMDA 2RGQA 1O7GB 1VQP3 4XM4A 2UX0A 1YVBI 4PEJA 2W9QA 4AKYA 1LVNA 1JKGB 1O7HB 3UNLA 3DZLA 3VGNA 3K5TA 1VQL3 4N6NB 5IEOA 1US1A 3FKAA 2CH9A 3CNXA 3RDEA 2JQ5A 1JN5A 3CCV3 2HMMB 4WYKB 1D6ZA 1IQ8A 2HMKB 2OWPA 2XH9A 1U8CB 1ROVA 5AIIA 1BUQA 4O8SA 3X41A 2IUJA 3JUOA 4J8TA 2Z77A 3A76A 4R4KA 5D81A 3T0UA 1C7HA 1EG9B 1DMQA 2WGQA 3H3HA 1CEWI 4LZIA 2P38A 1WNHA 5CLKA 4OVMA 3IMAB 3NM7A 3FG4A 5AYRB 1UI7A 1IT8A 1QALA 2CK3H 3SEDA 3K9MC 1YJW3 1CQSA 5KP1A 3FG1A 2ZDJA 4FR9A 1D6YA 5IG3A 4EBGA 1WMOA 3S67A 1ISKA 1ZO2A 2W2CA 1UI8A 3JVCA 3I563 1QVG2 1DMMA 3FF0A 4MMZB 3JUQA 1S5AA 5AIFA 1Q40A 1FGMA 2XSHB 1KQS2 2CIUA 4N6MA 5IW9A 4EC6A 3CXC2 1EQKA 3CU3A 1EA2A 3HK4A 3EQQB 1AV4A 1UW1A 2M7OA 3CCJ3 1RN7A 3FGYA 1NB3I 1T5YA 3N54B 2Z6BA 1IVXA 4LGQA 1IV7A 3N9HA 3BNDA 3PS8A 1FUWA 4HYZA 2XEPA 3J7Yd 3CC23 4HVNA 3FCSB 2W6JH 2CG1A 1YJ93 2BO9B 3DM8A 4GB5A 5ELJA 1AVLA 1JJ22 1JNQA 1OF5B 1JB5A 1FGRA 2LQVA 2E2VA 2RSXA 5CF2A 2QEX3 5IERA 3FF2A 3KFQC 2FNQA 2OCTA 1YJN3 3NM2A 1TIJA 2BT3A 4ORLA 4K1UA 1K41A 5KP3A 2E2TA 2Z7AA 2CWVA 1W4NA 1NWWA 5AIGA 3WA3A 2YFJB 2GEYA 3G4S3 3SXXA 3LOYA 4JF8A 3FLJA 4L8OA 4OUQA 3EHCA 3OWUA 4X2HA 3I0YA 1M9GA 2C10A 3F9SA 4HM0B 2L4VA 1WMPA 1Q824 8CHOA 5AIHA 3BNEA 3HIIA 2YX9A 2O3OA 4HM8B 3ALAA 4STDA 3LT8A 1E3RA 1DVCA 3F8HA 4AEQA 3F8XA 5IG5A 1KC84 1N8R4 1SQWA 2E2UA 2IUKA 3DGOA 1N5HA 1K28A 3DGMA 2W56B 1KD14 1VQO3 3UL5A 2OTJ3 1OGXA 2MC8A 3NQYA 1OGZA 5EVHA 2CKFB 3CD63 5FGOA 1TU5A 2CFGA 2QIYA 2OOVC 4BTWA 3GZBA 3S28A 4WWUC 1RKYA 1SPUA 4HZBB 3KIIA 2W0QA 3CC43 4EYCA 2CHCA 3WODG 3NV0A 3KE7A 1G96A 4IPBA 5AEWB 1MNLA 3F7SA 3Q2PA 2QGUA 1LNHA 5STDA 5I97A 1IVVA 3CCL3 1UUVB 2GBXB 3JUPA 1VQ43 4KFEA 3DUKA 4FCZA 4MEIA 3I553 1O7PB 3MG1A 3F14A 3LTAA 4JRFA 3HI7A 1W7CA 3N8BA 1E97A 3K63A 3BNBA 2D1WA 3Q1CA 2V1LA 3B4PA 3DY5A 5IF6A 4N6OB 1TUHA 1K8A4 3BB9A 1YHQ3 3EF8A 1W6CA 4N3VA 1STDA 3PGBA 1MOLA 2W9PA 2BMOB 1WMNA 2B1XB 2R4IA 4HBRA 1QAFA 4R1KA 2O9UX 3KZTA 4WHAA 4KFDA 2Y73A 3EC9A 4LEHA 4HM4B 1IV9A 1V74A 5CXOA 4NHFA 3F7XA 4EXRA 3V99A 2WOFA 3D9RA 3G8ZA 1KWIA 1GD3A 5LC6A 3SOAA 1GY7A 2RFRA 1ULIB 1JB2A 2P0XA 2HMLB 3EX9A 1NJI4 1TFOA 2CWTA 3G0KA 3SX1A 5A0OB 2IA7A 1GYBA 3AMOB 1D6UA 3EB8A 3LTBA 1FGTA 4OK0A 3SVAA 1K734 2GEXA 3SOYA 1RRLA 5FW5A 1CYVA 4HM1B 1O7MB 1NO3A 3HIGA 5JBSA 2HMOB 3EJVA 1O7WB 3CPW2 3ER7A 1PU4A 1ROAA 4GL6A 1QMAA 3EE1A 2CFLA 3EBYA 2XFSA 1IT7A 4J9AA 4XBYA 2WO0A 3G16A 3PCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCD A;  4LMI A;  2XRX B;  1JN5 B;  4XB5 A;  2A15 A;  6STD A;  2STD A;  1E3V A;  3B8L A;  1VZZ A;  1ZX2 A;  3RGA A;  3KKG A;  1OPY A;  2IMJ A;  5JPU A;  1OH0 A;  2YFI B;  3STD A;  3OXA A;  3MKI A;  2Z76 A;  1NU3 A;  1Q40 B;  3GWR A;  5D82 A;  3HZP A;  2K54 A;  3K7C A;  1UUW B;  3JUM A;  2BMR B;  7STD A;  3WMD A;  5IG0 A;  4XBX A;  3H51 A;  3MG3 A;  5D83 A;  3CPO A;  1NDO B;  1GY5 A;  4R9K A;  3EN8 A;  1JB4 A;  5AEU B;  1WQL B;  3OV4 A;  3K0Z A;  3ROB A;  3MYT A;  4HM2 B;  3E99 A;  3OWY A;  1W00 A;  4HM3 B;  2BNG A;  3OX9 A;  5DRE A;  4HJL B;  1QJG A;  2INX A;  5TGN A;  4HM5 B;  1A2K A;  1SJW A;  3F40 A;  4I4K A;  5IEN A;  2HMJ B;  1O7N B;  3GRD A;  5AI1 A;  3DMC A;  3B7C A;  3MHE A;  3CNM A;  2HMN B;  4XDW A;  2PZV A;  3B4O A;  1ULJ B;  3NV0 B;  1OF5 A;  5IEP A;  1OHO A;  3LZA A;  1W02 A;  3MG2 A;  1HKX A;  4IIA A;  5BXQ A;  4K1V A;  4L8P A;  1GS3 A;  3EN1 B;  4FCJ A;  4HM6 B;  3M8C A;  4H3U A;  1GY6 A;  2F99 A;  1OHS A;  3DXO A;  3T8N A;  3RGR A;  1DMN A;  3FZW A;  3NUV A;  4U13 A;  3GZR A;  3UJM A;  2F86 B;  3IPT A;  4Q53 A;  5CK6 A;  2XSO B;  5KP4 A;  4WP5 A;  5JPP A;  5CF1 A;  1OHP A;  4FCM A;  1W6Y A;  2GBW B;  1Z1S A;  1ASK A;  2GXF A;  3GZX B;  3NHX A;  3NBR A;  4XDV A;  5DRV A;  4CDL A;  4RZM A;  2XR8 B;  4X2O A;  2YFL B;  1OCV A;  3BLZ A;  1OUN A;  3VSY A;  1AR0 A;  4HM7 B;  4HZ9 B;  5IG4 A;  5BVB A;  3S5C A;  2F98 A;  5G2G A;  3NXJ A;  3LYG A;  1JKG A;  1U5O A;  4R9L A;  2B24 B;  4KVH A;  4WYK A;  3KSP A;  3HX8 A;  3JUN A;  3Q90 A;  3ECF A;  4XBT A;  3T8U A;  5HGR A;  4L7K A;  4HKV B;  3MSO A;  3FH1 A;  1W01 A;  2BMQ B;  2I9W A;  3GZY B;  4MJD A;  1Q42 A;  3FSD A;  1IDP A;  3EBT A;  3OWS A;  1TP6 A;  2RGQ A;  1O7G B;  4XM4 A;  2UX0 A;  4PEJ A;  1JKG B;  1O7H B;  3UNL A;  3DZL A;  3VGN A;  5IEO A;  3FKA A;  3CNX A;  2JQ5 A;  1JN5 A;  2HMM B;  4WYK B;  2OWP A;  2HMK B;  5AII A;  1BUQ A;  3JUO A;  4J8T A;  2Z77 A;  3A76 A;  5D81 A;  1C7H A;  1EG9 B;  1DMQ A;  3H3H A;  5CLK A;  4OVM A;  3SED A;  1CQS A;  5KP1 A;  5IG3 A;  1ISK A;  1ZO2 A;  2W2C A;  1DMM A;  3FF0 A;  3JUQ A;  1S5A A;  5AIF A;  1Q40 A;  2XSH B;  3CU3 A;  1EA2 A;  3HK4 A;  3EQQ B;  3FGY A;  4LGQ A;  4HVN A;  3DM8 A;  4GB5 A;  1OF5 B;  1JB5 A;  5CF2 A;  5IER A;  3FF2 A;  3NM2 A;  4ORL A;  4K1U A;  1K41 A;  5KP3 A;  2Z7A A;  1NWW A;  5AIG A;  2YFJ B;  2GEY A;  3FLJ A;  4L8O A;  4OUQ A;  3EHC A;  3OWU A;  4X2H A;  3I0Y A;  3F9S A;  4HM0 B;  8CHO A;  5AIH A;  4HM8 B;  4STD A;  1E3R A;  3F8H A;  5IG5 A;  3F8X A;  1OGX A;  1OGZ A;  5EVH A;  2CKF B;  2QIY A;  3GZB A;  4WWU C;  4HZB B;  2CHC A;  3NV0 A;  3KE7 A;  5AEW B;  3F7S A;  2QGU A;  5STD A;  1UUV B;  2GBX B;  3JUP A;  3DUK A;  1O7P B;  3MG1 A;  3F14 A;  1E97 A;  3B4P A;  5IF6 A;  1TUH A;  3BB9 A;  3EF8 A;  4N3V A;  1STD A;  2BMO B;  2B1X B;  2R4I A;  4R1K A;  3KZT A;  3EC9 A;  4LEH A;  4HM4 B;  5CXO A;  3F7X A;  3D9R A;  3G8Z A;  3SOA A;  1GY7 A;  1ULI B;  2RFR A;  1JB2 A;  3EX9 A;  2HML B;  3G0K A;  1GYB A;  2GEX A;  3SOY A;  5FW5 A;  4HM1 B;  1O7M B;  2HMO B;  3EJV A;  1O7W B;  3ER7 A;  1QMA A;  3EBY A;  4J9A A;  4XBY A;  3G16 A; 
#chains in the Genus database with same CATH topology
 2RCD A;  1UCK A;  4LMI A;  2XRX B;  4TX4 A;  2F4Y A;  3NQZ A;  2Y74 A;  3BIR A;  4N6V 0;  1JRQ A;  1T2I A;  2FGT A;  4CCV A;  1JN5 B;  3D3L A;  1IVU A;  1W2B 2;  4XB5 A;  2OQE C;  2A15 A;  6STD A;  4KT3 B;  4DKI A;  2STD A;  1EKM A;  1RGL A;  1JBS A;  1E3V A;  1HYF A;  1RRH A;  1RGH A;  3B8L A;  1VZZ A;  1ZX2 A;  2AAD A;  4J5K A;  3RGA A;  2P0M A;  1CH0 A;  3KKG A;  1MWU A;  1OPY A;  2XFT A;  2GU1 A;  2IMJ A;  5JPU A;  1OH0 A;  2KF5 A;  2ML6 A;  1BVI A;  2YFI B;  3WA2 X;  3CCU 3;  1YGW A;  1YIJ 3;  3WOF B;  1RMS A;  2ZL8 A;  2HOH A;  3ZFZ A;  1A67 A;  3DGL A;  3WOE B;  3V98 A;  1QAK A;  1DET A;  1QVF 2;  3STD A;  1RGK A;  2F5M A;  6GSP A;  1UDI I;  1BRJ A;  3MKI A;  3OXA A;  2Z76 A;  3PZW A;  1N5P A;  6RNT A;  2KXG A;  3X3Y A;  1NU3 A;  2KAA A;  4CJN A;  1Q40 B;  1W6G A;  3GWR A;  7GSP A;  1B2S A;  1RGE A;  3HZP A;  5D82 A;  1YIT 3;  1ZS7 A;  3SLU A;  2K54 A;  4O02 B;  2CG0 A;  1LXE A;  3K7C A;  1UUW B;  3JUM A;  1J2B A;  1VQN 3;  1A90 A;  2CW9 A;  2BMR B;  7STD A;  1I3F A;  4K61 A;  3WMD A;  3L0R A;  1N9E A;  1I2G A;  4XBX A;  3H51 A;  5IG0 A;  3MG3 A;  1DVD A;  1MWS A;  5D83 A;  1RCL A;  1X1Y A;  3LT9 A;  1RJO A;  2CFW A;  3CPO A;  1IQY A;  1NDO B;  1GY5 A;  4LYL B;  4BIR A;  3OW2 2;  1M1K 4;  1LOY A;  3BNC A;  1YVS A;  4R9K A;  3CME 3;  5EQL A;  1JV2 B;  3QK9 A;  1IK3 A;  3EN8 A;  2KCD A;  4HAA A;  1JB4 A;  1N9J A;  5AEU B;  1WQL B;  4R80 A;  2Q07 A;  2XGL A;  1S72 3;  3OV4 A;  3K0Z A;  3QRD A;  3ROB A;  1NB5 I;  3UL6 A;  3MYT A;  4H61 A;  4HM2 B;  3E99 A;  3OWY A;  3KSE D;  1BNI A;  1W00 A;  1AVK A;  2KRT A;  2LYX A;  4HM3 B;  1BOX A;  1RCK A;  2BNG A;  3OX9 A;  2W04 A;  5DRE A;  4HJL B;  1BNF A;  1QJG A;  2INX A;  2RBI A;  5TGN A;  1BRG A;  4HM5 B;  1A2K A;  4MMY B;  4RNY A;  1G02 A;  2PNC A;  1RLS A;  1SJW A;  4FMC A;  2D42 A;  4O3V A;  1RN4 A;  4O2H A;  1MGR A;  1SII A;  5M18 A;  4ZM8 A;  1A2P A;  4EV2 A;  1KSI A;  1RGA A;  3F40 A;  4I4K A;  3G71 3;  2XGN A;  4CPK A;  5GSP A;  5IEN A;  1B27 A;  1A2V A;  4G1M B;  1IVW A;  2HMJ B;  1O7N B;  3GRD A;  5AI1 A;  3DMC A;  2BU4 A;  1GOY A;  5AYS C;  1GD4 A;  2UGI A;  5EEO A;  1OAC A;  1FGO A;  1T2H A;  3PCS A;  3B7C A;  4IT7 A;  2P05 A;  3PYJ A;  1SIH A;  1RTU A;  3MHE A;  3CNM A;  1RGC A;  3X3Z A;  1V58 A;  1R4Y A;  4NPB A;  5M1A A;  3KN4 A;  1TTO A;  1Q7Y 4;  4KZ1 A;  2HMN B;  2XF3 A;  4KFF A;  4XDW A;  1BRH A;  2PZV A;  3B4O A;  2F56 A;  3X3X A;  1IQX A;  1F8N A;  3X42 A;  1ULJ B;  2CC3 A;  3NV0 B;  1BSE A;  2ZHX B;  1BRN L;  1VQ8 3;  1OF5 A;  5IEP A;  1RN1 A;  1OHO A;  5RNT A;  3LZA A;  1W02 A;  3MG2 A;  1FYS A;  4EV5 A;  3CCQ 3;  1HKX A;  4IIA A;  5BXQ A;  2OTL 3;  1L5G B;  3PXM A;  4K1V A;  1I2E A;  4N6L A;  3CCE 3;  1CYU A;  1FGQ A;  4L8P A;  1R4C A;  3VF1 A;  1RGF A;  1GS3 A;  3EN1 B;  4FCJ A;  1BIR A;  3D79 A;  4HM6 B;  3M8C A;  4H3U A;  1LRA A;  3LTD A;  4WFO A;  4RNT A;  1GY6 A;  1W2Z A;  2F99 A;  1OHS A;  3DXO A;  1LNI A;  3T8N A;  3S27 A;  1TJD A;  3RGR A;  1DMN A;  3FZW A;  3NUV A;  1UGH I;  4U13 A;  3GZR A;  1I2F A;  4BTX A;  1RDS A;  3LXU X;  3UJM A;  2F86 B;  2J8X B;  3IPT A;  4Q53 A;  3UB1 A;  3WDG B;  1BNR A;  1BUJ A;  1FW7 A;  2MF7 A;  3ZG5 A;  1B3S A;  5CK6 A;  2XSO B;  5KP4 A;  1M1X B;  2C11 A;  4WP5 A;  4BTY A;  3G6E 3;  5JPP A;  3CCS 3;  4AKZ A;  5CF1 A;  1Q81 4;  1OHP A;  1N8Q A;  3O8Y A;  2W56 A;  3AGO A;  2R41 A;  1DYU A;  3CCR 3;  3V92 A;  4FCM A;  2OQE A;  1K9M 4;  4FMA A;  1VQ9 3;  2RNT A;  1W6Y A;  2GBW B;  2CWU A;  2H0I A;  2K3D A;  4QWT A;  1PY3 A;  1MGW A;  3D5G A;  1Q86 4;  1VQ7 3;  2BHM A;  1LOW A;  1YGE A;  1BNG A;  2GU3 A;  1Z1S A;  3CCM 3;  3U97 A;  1Q9E A;  1HU9 A;  3LTC A;  1ASK A;  2ML5 A;  2GXF A;  4FMB A;  3NBB A;  8RNT A;  3GZX B;  3DGN A;  3NHX A;  3NBR A;  4XDV A;  5DRV A;  3S29 A;  4CDL A;  4RZM A;  2P09 A;  1Y4K A;  3LML A;  3MPH A;  3NX0 A;  2XR8 B;  4X2O A;  2IY2 A;  1PFP A;  3TDG A;  1VQ5 3;  2WOH A;  1IU7 A;  1YI2 3;  2YFL B;  3Q3F A;  3MWZ A;  1OCV A;  3BLZ A;  1OUN A;  3VSY A;  1AR0 A;  4HM7 B;  1VQM 3;  4LSO A;  4HZ9 B;  5IG4 A;  5BVB A;  1B2X A;  3S5C A;  2F98 A;  1AY7 A;  5G2G A;  1BAO A;  3NXJ A;  3LYG A;  1JKG A;  3D5I A;  3BU4 A;  2CFD A;  1GSP A;  1U5O A;  3CC7 3;  2QA4 3;  3CMA 3;  4R9L A;  2WGO A;  3DH2 A;  1BSC A;  2B24 B;  2SBL A;  4KVH A;  1X1X A;  1VQ6 3;  4WYK A;  3KSP A;  4I5Q A;  1I70 A;  3HX8 A;  3JUN A;  3Q90 A;  2KF4 A;  3ECF A;  1BSA A;  4XBT A;  3LH4 A;  3T8U A;  1ZGX A;  4RBN A;  4L7K A;  5HGR A;  2FXT A;  4NRE A;  5ELU A;  2F5W A;  1TFK A;  4HKV B;  1BSB A;  2ZA4 A;  2JDI H;  3RNT A;  1VQK 3;  2OOV A;  3U1W A;  3NBJ A;  3MSO A;  1LOX A;  1FUS A;  3FH1 A;  4K90 B;  4BU4 A;  1M90 4;  1W01 A;  2BMQ B;  2GSP A;  1EEJ A;  4N6T A;  2UUG C;  3X40 A;  1I0X A;  1STF I;  2I9W A;  3GZY B;  3FG3 A;  4N6U A;  7RNT A;  4MJD A;  3IJE B;  3AMO A;  1FA3 A;  4RNZ A;  5HOH A;  1Q7H A;  3GAX A;  1RSN A;  2CFK A;  1GOU A;  1Q42 A;  2K0M A;  3FSD A;  1IDP A;  4MMX B;  3EBT A;  1BAN A;  1W5Z A;  5LC7 A;  2W03 A;  1WTH A;  3OWS A;  1TP6 A;  4FMD A;  2RGQ A;  1O7G B;  4ILF A;  1VQP 3;  1HZ1 A;  4XM4 A;  2UX0 A;  1YVB I;  4PEJ A;  2W9Q A;  1BNS A;  1UCJ A;  4AKY A;  1LVN A;  1JKG B;  1O7H B;  3URP A;  1TRP A;  1RNT A;  3DZL A;  3UNL A;  1AQZ A;  3K5T A;  3VGN A;  1VQL 3;  4N6N B;  5IEO A;  1US1 A;  3FKA A;  2CH9 A;  1BSD A;  4GSP A;  3CNX A;  5G1K A;  3RDE A;  4GHO A;  1GOV A;  1JN5 A;  2JQ5 A;  3CCV 3;  2HMM B;  4WYK B;  1D6Z A;  1IQ8 A;  2HMK B;  2OWP A;  1UCI A;  1U8C B;  1ROV A;  2XH9 A;  5AII A;  4O8S A;  3X41 A;  1BUQ A;  2IUJ A;  3JUO A;  1BNJ A;  4J8T A;  2Z77 A;  3A76 A;  4R4K A;  5D81 A;  3T0U A;  1C7H A;  1EG9 B;  1DMQ A;  2WGQ A;  3H3H A;  1CEW I;  4LZI A;  5G1L A;  1DE3 A;  1SAR A;  1VQQ A;  2P38 A;  1WNH A;  5CLK A;  3ZG0 A;  4OVM A;  1BRK A;  3IMA B;  2KF6 A;  3NM7 A;  3FG4 A;  5AYR B;  1UI7 A;  1IT8 A;  1JZO A;  1QAL A;  2CK3 H;  3SED A;  3K9M C;  1UUG B;  1YJW 3;  1CQS A;  1I3I A;  5KP1 A;  3FG1 A;  2ZDJ A;  3GSP A;  4FR9 A;  1D6Y A;  5IG3 A;  5M19 A;  4EBG A;  1WMO A;  3S67 A;  1ISK A;  1ZO2 A;  2W2C A;  1UI8 A;  3JVC A;  3I56 3;  1MWT A;  1QVG 2;  1DMM A;  3FF0 A;  4MMZ B;  3JUQ A;  1S5A A;  5AIF A;  1B2M A;  1Q40 A;  1FGM A;  2XSH B;  1KQS 2;  2CIU A;  4N6M A;  5IW9 A;  4EC6 A;  3CXC 2;  1EQK A;  3CU3 A;  1JBR A;  1EA2 A;  3HK4 A;  3EQQ B;  1AV4 A;  1UW1 A;  2M7O A;  3CCJ 3;  1RN7 A;  2CX0 A;  3FGY A;  5BU4 A;  1NB3 I;  1T5Y A;  3N54 B;  1IVX A;  2Z6B A;  4LGQ A;  1IV7 A;  3N9H A;  3BND A;  3PS8 A;  1FUW A;  1X1U A;  4HYZ A;  2XEP A;  3J7Y d;  3CC2 3;  4HVN A;  1B21 A;  3FCS B;  2W6J H;  2CG1 A;  1YJ9 3;  2BO9 B;  3DM8 A;  4GB5 A;  5ELJ A;  1AVL A;  1JJ2 2;  1JNQ A;  1B20 A;  1LQM B;  1OF5 B;  1C54 A;  1JB5 A;  1FGR A;  2LQV A;  2E2V A;  2RSX A;  5CF2 A;  1BNE A;  1FZU A;  2QEX 3;  5IER A;  3FF2 A;  3KFQ C;  2FNQ A;  2OCT A;  1YJN 3;  3NM2 A;  1TIJ A;  1GMP A;  2BT3 A;  4K1U A;  4ORL A;  1K41 A;  5KP3 A;  2E2T A;  2Z7A A;  2CWV A;  1W4N A;  1NWW A;  5AIG A;  3WA3 A;  2H0H A;  2YFJ B;  2GEY A;  4EW5 A;  3G4S 3;  3SXX A;  3LOY A;  4JF8 A;  3D4A A;  1LQG C;  3FLJ A;  4L8O A;  4OUQ A;  3EHC A;  1RGG A;  3OWU A;  4X2H A;  3I0Y A;  1M9G A;  2C10 A;  3F9S A;  1X1W A;  1LOV A;  4HM0 B;  2L4V A;  3AHW A;  1WMP A;  1YNV X;  1Q82 4;  8CHO A;  5AIH A;  2BIR A;  3BNE A;  3HII A;  1V57 A;  2YX9 A;  2O3O A;  4HM8 B;  3ALA A;  1BGS A;  3AHS A;  2L1S A;  3LT8 A;  4STD A;  1E3R A;  1DVC A;  1MWR A;  3F8H A;  3F8X A;  4AEQ A;  5IG5 A;  1KC8 4;  1SQW A;  1N8R 4;  2E2U A;  2IUK A;  3DGO A;  1N5H A;  1K28 A;  9RNT A;  1BRS A;  3DGM A;  2W56 B;  1KD1 4;  1VQO 3;  3A5E A;  1UCL A;  1OGX A;  2MC8 A;  3UL5 A;  2OTJ 3;  3NQY A;  1OGZ A;  3HOH A;  5EVH A;  2CKF B;  3CD6 3;  5FGO A;  1TU5 A;  2CFG A;  2QIY A;  2OOV C;  4BTW A;  1I8V A;  3GZB A;  3S28 A;  4WWU C;  2H0G A;  1SPU A;  4HZB B;  1RKY A;  3KII A;  2W0Q A;  3CC4 3;  4EYC A;  2CHC A;  3WOD G;  3WR2 A;  3NV0 A;  3KE7 A;  1G96 A;  1IYY A;  1NNV A;  1BRI A;  1FUT A;  4IPB A;  1I0V A;  5AEW B;  1MNL A;  3F7S A;  3Q2P A;  2AAE A;  2QGU A;  1LNH A;  4HOH A;  2C4B A;  3KCH A;  5STD A;  5I97 A;  1IVV A;  3CCL 3;  1UUV B;  2GBX B;  3JUP A;  1VQ4 3;  4KFE A;  3DUK A;  4FCZ A;  4MEI A;  3I55 3;  3SYU A;  1O7P B;  3MG1 A;  5BIR A;  3F14 A;  3LTA A;  4JRF A;  3HI7 A;  1W7C A;  3N8B A;  1E97 A;  3K63 A;  3BNB A;  2D1W A;  3Q1C A;  2V1L A;  3B4P A;  3DY5 A;  1BU4 A;  5IF6 A;  4J5G A;  4N6O B;  2IYJ A;  2CX1 A;  1TUH A;  2SAR A;  3BB9 A;  1K8A 4;  1YHQ 3;  3EF8 A;  1TRQ A;  1W6C A;  4N3V A;  1STD A;  3PGB A;  1MOL A;  4BL2 A;  2W9P A;  2BMO B;  1RNB A;  1WMN A;  2B1X B;  2R4I A;  4HBR A;  1QAF A;  4R1K A;  2O9U X;  3KZT A;  4WHA A;  4KFD A;  3DGY A;  2Y73 A;  3EC9 A;  1GMR A;  1T3B A;  4LEH A;  4HM4 B;  1IV9 A;  1V74 A;  5CXO A;  4NHF A;  3F7X A;  4EXR A;  3V99 A;  2WOF A;  3D9R A;  3G8Z A;  1GD3 A;  1JZD A;  1KWI A;  5LC6 A;  1GY7 A;  1ULI B;  2RFR A;  3SOA A;  4BL3 A;  1JB2 A;  2P0X A;  2HML B;  3EX9 A;  1NJI 4;  1TFO A;  2CWT A;  1GMQ A;  3AGN A;  3G0K A;  3SX1 A;  5A0O B;  2IA7 A;  1GYB A;  3AMO B;  1JBT A;  1D6U A;  1PYL A;  3EB8 A;  1EUI C;  1FGT A;  1RHL A;  3LTB A;  1UGI A;  4OK0 A;  1G0T A;  3SVA A;  1K73 4;  2GEX A;  3SOY A;  1RRL A;  5FW5 A;  1CYV A;  4HM1 B;  1O7M B;  1NO3 A;  3HIG A;  5JBS A;  1B2Z A;  1B2U A;  2HMO B;  3EJV A;  3WHO A;  1O7W B;  3CPW 2;  3ER7 A;  1PU4 A;  1ROA A;  4GL6 A;  1QMA A;  3EE1 A;  2CFL A;  3EBY A;  2XFS A;  1IT7 A;  4J9A A;  2KF3 A;  4XBY A;  2WO0 A;  3G16 A;  3PCR A; 
#chains in the Genus database with same CATH homology
 2RCD A;  4LMI A;  2XRX B;  4TX4 A;  3NQZ A;  2Y74 A;  4N6V 0;  1JRQ A;  2FGT A;  4CCV A;  1JN5 B;  3D3L A;  1IVU A;  1W2B 2;  4XB5 A;  2OQE C;  2A15 A;  6STD A;  2STD A;  1EKM A;  1E3V A;  1RRH A;  3B8L A;  1VZZ A;  1ZX2 A;  3RGA A;  2P0M A;  3KKG A;  1OPY A;  2XFT A;  2GU1 A;  2IMJ A;  5JPU A;  1OH0 A;  2ML6 A;  2YFI B;  3WA2 X;  3CCU 3;  1YIJ 3;  3WOF B;  2ZL8 A;  1A67 A;  3DGL A;  3WOE B;  3V98 A;  1QAK A;  1QVF 2;  3STD A;  3OXA A;  3MKI A;  2Z76 A;  3PZW A;  1N5P A;  2KXG A;  3X3Y A;  1NU3 A;  1Q40 B;  1W6G A;  3GWR A;  5D82 A;  3HZP A;  1YIT 3;  3SLU A;  2K54 A;  4O02 B;  2CG0 A;  1LXE A;  3K7C A;  1UUW B;  3JUM A;  1J2B A;  1VQN 3;  1A90 A;  2CW9 A;  2BMR B;  7STD A;  4K61 A;  3WMD A;  3L0R A;  1N9E A;  5IG0 A;  4XBX A;  3H51 A;  1DVD A;  3MG3 A;  5D83 A;  3LT9 A;  1RJO A;  2CFW A;  3CPO A;  1IQY A;  1NDO B;  1GY5 A;  3OW2 2;  1M1K 4;  3BNC A;  4R9K A;  3CME 3;  5EQL A;  1JV2 B;  3QK9 A;  1IK3 A;  3EN8 A;  2KCD A;  1JB4 A;  1N9J A;  5AEU B;  1WQL B;  4R80 A;  2Q07 A;  2XGL A;  1S72 3;  3OV4 A;  3K0Z A;  3QRD A;  3ROB A;  1NB5 I;  3UL6 A;  3MYT A;  4H61 A;  4HM2 B;  3E99 A;  3OWY A;  3KSE D;  1W00 A;  1AVK A;  2KRT A;  2LYX A;  4HM3 B;  2BNG A;  3OX9 A;  2W04 A;  5DRE A;  4HJL B;  1QJG A;  2INX A;  5TGN A;  4HM5 B;  1A2K A;  4MMY B;  4RNY A;  2PNC A;  1SJW A;  4O3V A;  4FMC A;  2D42 A;  4O2H A;  1SII A;  4ZM8 A;  4EV2 A;  1KSI A;  3F40 A;  4I4K A;  3G71 3;  2XGN A;  5IEN A;  1A2V A;  4G1M B;  1IVW A;  2HMJ B;  1O7N B;  3GRD A;  5AI1 A;  3DMC A;  5AYS C;  1GD4 A;  5EEO A;  1OAC A;  1FGO A;  3PCS A;  4IT7 A;  3B7C A;  2P05 A;  3PYJ A;  1SIH A;  3MHE A;  3CNM A;  3X3Z A;  3KN4 A;  1Q7Y 4;  4KZ1 A;  2HMN B;  2XF3 A;  4KFF A;  4XDW A;  2PZV A;  3B4O A;  3X3X A;  1IQX A;  1F8N A;  3X42 A;  1ULJ B;  2CC3 A;  3NV0 B;  1VQ8 3;  1OF5 A;  5IEP A;  1OHO A;  3LZA A;  1W02 A;  3MG2 A;  3CCQ 3;  4EV5 A;  1HKX A;  4IIA A;  5BXQ A;  2OTL 3;  1L5G B;  3PXM A;  4K1V A;  4N6L A;  3CCE 3;  1CYU A;  1FGQ A;  4L8P A;  1R4C A;  3VF1 A;  1GS3 A;  3EN1 B;  4FCJ A;  4HM6 B;  3M8C A;  4H3U A;  3LTD A;  4WFO A;  1GY6 A;  1W2Z A;  2F99 A;  1OHS A;  3DXO A;  3T8N A;  3S27 A;  3RGR A;  1DMN A;  3FZW A;  3NUV A;  4U13 A;  3GZR A;  4BTX A;  3LXU X;  3UJM A;  2F86 B;  3IPT A;  4Q53 A;  3WDG B;  3UB1 A;  2MF7 A;  5CK6 A;  2XSO B;  5KP4 A;  1M1X B;  2C11 A;  4WP5 A;  4BTY A;  3G6E 3;  5JPP A;  3CCS 3;  4AKZ A;  5CF1 A;  1Q81 4;  1OHP A;  1N8Q A;  3O8Y A;  2W56 A;  1DYU A;  3CCR 3;  3V92 A;  4FCM A;  2OQE A;  1K9M 4;  4FMA A;  1VQ9 3;  1W6Y A;  2GBW B;  2CWU A;  4QWT A;  1Q86 4;  1VQ7 3;  2BHM A;  1YGE A;  2GU3 A;  1Z1S A;  3CCM 3;  3U97 A;  1HU9 A;  3LTC A;  1ASK A;  2ML5 A;  2GXF A;  4FMB A;  3NBB A;  3GZX B;  3DGN A;  3NHX A;  3NBR A;  4XDV A;  5DRV A;  3S29 A;  4CDL A;  4RZM A;  2P09 A;  1Y4K A;  3LML A;  3MPH A;  3NX0 A;  2XR8 B;  4X2O A;  1VQ5 3;  1PFP A;  3TDG A;  2WOH A;  1IU7 A;  1YI2 3;  2YFL B;  3MWZ A;  1OCV A;  3BLZ A;  1OUN A;  3VSY A;  1AR0 A;  4HM7 B;  1VQM 3;  4LSO A;  4HZ9 B;  5IG4 A;  5BVB A;  3S5C A;  2F98 A;  5G2G A;  3NXJ A;  3LYG A;  1JKG A;  2CFD A;  1U5O A;  3CC7 3;  2QA4 3;  3CMA 3;  4R9L A;  2WGO A;  2SBL A;  2B24 B;  4KVH A;  1VQ6 3;  4WYK A;  3KSP A;  3HX8 A;  3JUN A;  3Q90 A;  3ECF A;  4XBT A;  3LH4 A;  3T8U A;  4RBN A;  4L7K A;  5HGR A;  2FXT A;  4NRE A;  5ELU A;  1TFK A;  4HKV B;  2JDI H;  1VQK 3;  2OOV A;  3U1W A;  3NBJ A;  3MSO A;  1LOX A;  3FH1 A;  4K90 B;  1M90 4;  1W01 A;  2BMQ B;  4N6T A;  3X40 A;  1STF I;  2I9W A;  3GZY B;  3FG3 A;  4N6U A;  4MJD A;  3IJE B;  3AMO A;  1FA3 A;  4RNZ A;  3GAX A;  2CFK A;  1Q42 A;  2K0M A;  3FSD A;  1IDP A;  4MMX B;  3EBT A;  1W5Z A;  5LC7 A;  2W03 A;  1WTH A;  3OWS A;  1TP6 A;  4FMD A;  2RGQ A;  1O7G B;  1VQP 3;  4XM4 A;  2UX0 A;  1YVB I;  4PEJ A;  2W9Q A;  4AKY A;  1LVN A;  1JKG B;  1O7H B;  3UNL A;  3DZL A;  3VGN A;  3K5T A;  1VQL 3;  4N6N B;  5IEO A;  1US1 A;  3FKA A;  2CH9 A;  3CNX A;  3RDE A;  2JQ5 A;  1JN5 A;  3CCV 3;  2HMM B;  4WYK B;  1D6Z A;  1IQ8 A;  2HMK B;  2OWP A;  2XH9 A;  1U8C B;  1ROV A;  5AII A;  1BUQ A;  4O8S A;  3X41 A;  2IUJ A;  3JUO A;  4J8T A;  2Z77 A;  3A76 A;  4R4K A;  5D81 A;  3T0U A;  1C7H A;  1EG9 B;  1DMQ A;  2WGQ A;  3H3H A;  1CEW I;  4LZI A;  2P38 A;  1WNH A;  5CLK A;  4OVM A;  3IMA B;  3NM7 A;  3FG4 A;  5AYR B;  1UI7 A;  1IT8 A;  1QAL A;  2CK3 H;  3SED A;  3K9M C;  1YJW 3;  1CQS A;  5KP1 A;  3FG1 A;  2ZDJ A;  4FR9 A;  1D6Y A;  5IG3 A;  4EBG A;  1WMO A;  3S67 A;  1ISK A;  1ZO2 A;  2W2C A;  1UI8 A;  3JVC A;  3I56 3;  1QVG 2;  1DMM A;  3FF0 A;  4MMZ B;  3JUQ A;  1S5A A;  5AIF A;  1Q40 A;  1FGM A;  2XSH B;  1KQS 2;  2CIU A;  4N6M A;  5IW9 A;  4EC6 A;  3CXC 2;  1EQK A;  3CU3 A;  1EA2 A;  3HK4 A;  3EQQ B;  1AV4 A;  1UW1 A;  2M7O A;  3CCJ 3;  1RN7 A;  3FGY A;  1NB3 I;  1T5Y A;  3N54 B;  2Z6B A;  1IVX A;  4LGQ A;  1IV7 A;  3N9H A;  3BND A;  3PS8 A;  1FUW A;  4HYZ A;  2XEP A;  3J7Y d;  3CC2 3;  4HVN A;  3FCS B;  2W6J H;  2CG1 A;  1YJ9 3;  2BO9 B;  3DM8 A;  4GB5 A;  5ELJ A;  1AVL A;  1JJ2 2;  1JNQ A;  1OF5 B;  1JB5 A;  1FGR A;  2LQV A;  2E2V A;  2RSX A;  5CF2 A;  2QEX 3;  5IER A;  3FF2 A;  3KFQ C;  2FNQ A;  2OCT A;  1YJN 3;  3NM2 A;  1TIJ A;  2BT3 A;  4ORL A;  4K1U A;  1K41 A;  5KP3 A;  2E2T A;  2Z7A A;  2CWV A;  1W4N A;  1NWW A;  5AIG A;  3WA3 A;  2YFJ B;  2GEY A;  3G4S 3;  3SXX A;  3LOY A;  4JF8 A;  3FLJ A;  4L8O A;  4OUQ A;  3EHC A;  3OWU A;  4X2H A;  3I0Y A;  1M9G A;  2C10 A;  3F9S A;  4HM0 B;  2L4V A;  1WMP A;  1Q82 4;  8CHO A;  5AIH A;  3BNE A;  3HII A;  2YX9 A;  2O3O A;  4HM8 B;  3ALA A;  4STD A;  3LT8 A;  1E3R A;  1DVC A;  3F8H A;  4AEQ A;  3F8X A;  5IG5 A;  1KC8 4;  1N8R 4;  1SQW A;  2E2U A;  2IUK A;  3DGO A;  1N5H A;  1K28 A;  3DGM A;  2W56 B;  1KD1 4;  1VQO 3;  3UL5 A;  2OTJ 3;  1OGX A;  2MC8 A;  3NQY A;  1OGZ A;  5EVH A;  2CKF B;  3CD6 3;  5FGO A;  1TU5 A;  2CFG A;  2QIY A;  2OOV C;  4BTW A;  3GZB A;  3S28 A;  4WWU C;  1RKY A;  1SPU A;  4HZB B;  3KII A;  2W0Q A;  3CC4 3;  4EYC A;  2CHC A;  3WOD G;  3NV0 A;  3KE7 A;  1G96 A;  4IPB A;  5AEW B;  1MNL A;  3F7S A;  3Q2P A;  2QGU A;  1LNH A;  5STD A;  5I97 A;  1IVV A;  3CCL 3;  1UUV B;  2GBX B;  3JUP A;  1VQ4 3;  4KFE A;  3DUK A;  4FCZ A;  4MEI A;  3I55 3;  1O7P B;  3MG1 A;  3F14 A;  3LTA A;  4JRF A;  3HI7 A;  1W7C A;  3N8B A;  1E97 A;  3K63 A;  3BNB A;  2D1W A;  3Q1C A;  2V1L A;  3B4P A;  3DY5 A;  5IF6 A;  4N6O B;  1TUH A;  1K8A 4;  3BB9 A;  1YHQ 3;  3EF8 A;  1W6C A;  4N3V A;  1STD A;  3PGB A;  1MOL A;  2W9P A;  2BMO B;  1WMN A;  2B1X B;  2R4I A;  4HBR A;  1QAF A;  4R1K A;  2O9U X;  3KZT A;  4WHA A;  4KFD A;  2Y73 A;  3EC9 A;  4LEH A;  4HM4 B;  1IV9 A;  1V74 A;  5CXO A;  4NHF A;  3F7X A;  4EXR A;  3V99 A;  2WOF A;  3D9R A;  3G8Z A;  1KWI A;  1GD3 A;  5LC6 A;  3SOA A;  1GY7 A;  2RFR A;  1ULI B;  1JB2 A;  2P0X A;  2HML B;  3EX9 A;  1NJI 4;  1TFO A;  2CWT A;  3G0K A;  3SX1 A;  5A0O B;  2IA7 A;  1GYB A;  3AMO B;  1D6U A;  3EB8 A;  3LTB A;  1FGT A;  4OK0 A;  3SVA A;  1K73 4;  2GEX A;  3SOY A;  1RRL A;  5FW5 A;  1CYV A;  4HM1 B;  1O7M B;  1NO3 A;  3HIG A;  5JBS A;  2HMO B;  3EJV A;  1O7W B;  3CPW 2;  3ER7 A;  1PU4 A;  1ROA A;  4GL6 A;  1QMA A;  3EE1 A;  2CFL A;  3EBY A;  2XFS A;  1IT7 A;  4J9A A;  4XBY A;  2WO0 A;  3G16 A;  3PCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...