3FF2A

Crystal structure of an uncharacterized cystatin fold protein (saro_2299) from novosphingobium aromaticivorans dsm at 1.90 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
GMSNLETAKAMIAAYNAQDVDTYVSYMTDDACEANYRGDVVREGKEGTRSGLAAAFARWPQNHAEIKDAQQVGTYVLMREHVTRGPATDGSPLVEPFDVVAVYSFEGDKCSRVEFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized cystatin fold protein (YP_497570.1) from NTF
publication title Crystal structure of uncharacterized cystatin fold protein (YP_497570.1) from NTF2 superfamily (YP_497570.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.90 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
total genus 33
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ff2A00
1O7PB 1W01A 3JUNA 4J9AA 4KVHA 3EF8A 3G8ZA 3EX9A 3HK4A 5JPUA 1O7HB 1W02A 1DMQA 3NM2A 3JUQA 2PZVA 3WMDA 4GB5A 3SOAA 3K0ZA 1STDA 2CHCA 4WWUC 3FLJA 1E97A 8CHOA 5IG5A 1VZZA 5D81A 5JPPA 3EN1B 3NUVA 2GXFA 3VSYA 3KZTA 1JKGA 1O7GB 3NV0B 3FZWA 3KKGA 2XSHB 2Z76A 1K41A 3EHCA 2BMOB 3OWSA 3EJVA 5FW5A 2F99A 3DZLA 3UNLA 2QGUA 1OHOA 1GY5A 4J8TA 4HM6B 3MKIA 2INXA 4HVNA 3VGNA 1E3RA 1OGXA 2B1XB 6STDA 2QIYA 5CF2A 4HM1B 4OUQA 2XSOB 1JN5A 5BVBA 2A15A 1E3VA 3CNMA 5AIGA 3A76A 5TGNA 2YFLB 5IG3A 3GZYB 4L8OA 1JKGB 2W2CA 4XBTA 1GYBA 1OUNA 3F7SA 5IF6A 4WYKA 3FF0A 2OWPA 3DMCA 4FCJA 2Z77A 3FH1A 4HZ9B 4R9LA 4U13A 1O7WB 3LYGA 4R9KA 1DMMA 1OCVA 2RFRA 4HM0B 1BUQA 3FSDA 1JB4A 1OH0A 2GBWB 1GS3A 3ECFA 3F8HA 3EQQB 3MG3A 7STDA 1JN5B 5BXQA 4Q53A 5EVHA 3EC9A 3BLZA 3I0YA 4K1VA 4CDLA 4L8PA 3SEDA 3CPOA 3ER7A 1EA2A 1OPYA 2I9WA 3JUOA 4WYKB 1TUHA 5IG4A 3B4OA 4LMIA 1GY6A 3B8LA 5DREA 2XR8B 1W6YA 3MG1A 3K7CA 2B24B 1QJGA 4HKVB 4FCMA 1NWWA 2BMRB 1JB5A 3OXAA 1Z1SA 4L7KA 3T8NA 4XB5A 4XDWA 5AEUB 1UUWB 3GWRA 4STDA 3Q90A 1C7HA 4HJLB 5CXOA 3GZXB 3IPTA 1CQSA 3OX9A 2HMJB 3NBRA 2JQ5A 3RGRA 5CK6A 4PEJA 3GRDA 3OWYA 1O7NB 1W00A 3DXOA 2BMQB 2HMMB 1UUVB 3F7XA 3F40A 3HX8A 2Z7AA 4HM4B 4XM4A 1ULJB 4HM5B 1U5OA 4K1UA 4HM3B 3DUKA 2CKFB 1DMNA 2HMLB 4HZBB 1ZX2A 3M8CA 3BB9A 2F98A 5G2GA 1Q40A 4RZMA 5AIFA 3E99A 4MJDA 4X2OA 3MG2A 5AIHA 1IDPA 2IMJA 2HMKB 3JUMA 4LEHA 3F8XA 4R1KA 2UX0A 3OV4A 4OVMA 5KP1A 1ZO2A 2RCDA 1GY7A 3RGAA 2F86B 5AIIA 5D83A 3SOYA 3MYTA 5IERA 4HM8B 3OWUA 3H3HA 1SJWA 4N3VA 2HMNB 5STDA 1ASKA 5IG0A 3S5CA 2GEYA 3MHEA 1Q40B 5CF1A 4XBYA 1WQLB 4ORLA 3ROBA 2YFJB 3UJMA 1HKXA 3B7CA 1EG9B 1O7MB 1ISKA 5AEWB 3EBYA 5DRVA 5IEOA 1TP6A 3JUPA 3H51A 3KSPA 1S5AA 2BNGA 2K54A 3EBTA 3FF2A 5AI1A 4LGQA 1OHPA 5KP3A 3GZRA 1AR0A 1NDOB 4X2HA 3CU3A 4WP5A 3G0KA 1OF5A 2STDA 5D82A 2R4IA 3STDA 3G16A 1Q42A 5HGRA 3T8UA 3CNXA 3HZPA 2XRXB 4I4KA 1NU3A 5IENA 3D9RA 3KE7A 4H3UA 3MSOA 2HMOB 2GBXB 3LZAA 1A2KA 1JB2A 5IEPA 5CLKA 3NHXA 1OGZA 3FKAA 2GEXA 2YFIB 3DM8A 3FGYA 3GZBA 3F14A 3NXJA 3EN8A 1OF5B 4HM7B 5KP4A 4IIAA 1QMAA 2RGQA 3B4PA 4HM2B 3F9SA 4XBXA 1ULIB 4XDVA 1OHSA 3NV0A
chains in the Genus database with same CATH superfamily
1O7PB 1FGTA 2KF3A 3LTDA 1W01A 3WR2A 1VQ53 1IQYA 1BSEA 1UCKA 3G6E3 3JUNA 4J9AA 7RNTA 4KVHA 4FMBA 3EF8A 1W2B2 1MGWA 1W7CA 2RSXA 2LQVA 3EX9A 3G8ZA 4EBGA 1Q7Y4 3Q3FA 3HK4A 5M1AA 1QALA 5JPUA 3WA2X 2BIRA 1Q9EA 1O7HB 1EQKA 3NM7A 3HI7A 1W02A 1RDSA 1YGWA 1DMQA 3NM2A 1BANA 3JUQA 1VQM3 4H61A 1CYUA 2XGNA 3X42A 2PZVA 3WMDA 4GB5A 1RN7A 4FCZA 3CCM3 3LOYA 1TJDA 1X1UA 3SOAA 4J5KA 1VQ63 3BIRA 3K0ZA 1M1K4 1STDA 2CHCA 4WWUC 1MWSA 5A0OB 3FLJA 1LOVA 4AKZA 3X40A 1I2FA 1E97A 8CHOA 3N54B 1CYVA 1MWRA 2ML5A 1VZZA 5D81A 5IG5A 5JPPA 1RGHA 3EN1B 3NUVA 4HBRA 1VQL3 2GXFA 3LT8A 1I0VA 3VSYA 3KZTA 1JKGA 2KCDA 3BNBA 4BTXA 1RHLA 8RNTA 1O7GB 5HOHA 1Q864 1I0XA 1B21A 3NV0B 5G1LA 3WODG 1YJ93 3FG4A 3FZWA 1BNSA 1RMSA 2CW9A 3KKGA 3CCV3 2XSHB 4BIRA 3UL5A 1BNRA 2Z76A 2YX9A 3GSPA 3CCE3 2CIUA 1IQXA 1K41A 3EHCA 2Y74A 1YIJ3 2BMOB 3OWSA 1Q814 1FGQA 3EJVA 5FW5A 2F99A 1N8QA 3DZLA 2ZHXB 2QGUA 3UNLA 1RCLA 1OHOA 2FNQA 1GY5A 1NB5I 2AADA 1US1A 5BIRA 1KQS2 2V1LA 4HM6B 3MKIA 1BNEA 2INXA 4J8TA 4HVNA 3CCJ3 3VGNA 1E3RA 1T2HA 2ML6A 1OGXA 1BSCA 2B1XB 4JF8A 6STDA 4N6UA 2QIYA 3PS8A 2W56A 3S28A 4HM1B 2C4BA 4LZIA 3X3ZA 5CF2A 3SLUA 4OUQA 2FXTA 2D1WA 1FGRA 2ZDJA 1MOLA 4IT7A 2XSOB 2Z6BA 4RBNA 3RDEA 1JN5A 1N8R4 1RRLA 5BVBA 3FCSB 2A15A 3S67A 3Q1CA 2HOHA 3OW22 1E3VA 3CNMA 3LT9A 1GD4A 1LRAA 3NQZA 4O8SA 1I3IA 2XFSA 1KWIA 3K63A 1IVWA 3NBBA 3A76A 4KT3B 3HIGA 1GMPA 2YFLB 5TGNA 5IG3A 3GZYB 1WTHA 3PXMA 4AKYA 3KCHA 2J8XB 1M9GA 1BNJA 1BRJA 3MPHA 4BTYA 1BUJA 4L8OA 1JKGB 2W2CA 4XBTA 2CX1A 4N6V0 1GYBA 1EKMA 1UUGB 2O3OA 1IK3A 2L1SA 2FGTA 2L4VA 2WGQA 3S27A 1OUNA 1W5ZA 3F7SA 3PYJA 4WYKA 3ZG0A 5IF6A 4MEIA 2IYJA 4QWTA 2OWPA 3FF0A 1YGEA 3CC23 1JJ22 5AYRB 3SVAA 3DMCA 4FCJA 1K8A4 4JRFA 2CK3H 2Z77A 6GSPA 1IV7A 3FH1A 3CXC2 4HZ9B 4R9LA 1RGFA 3D5IA 4U13A 1O7WB 3EE1A 1RJOA 3LYGA 4KFDA 4R9KA 1DMMA 2CFKA 4K90B 2IUJA 1OCVA 2RFRA 2P0MA 1UW1A 2WGOA 4HM0B 1A90A 1BUQA 5LC6A 3FSDA 1GMQA 2BO9B 2CFDA 1JB4A 1OH0A 1CH0A 3CCS3 1KC84 2GBWB 1GS3A 2XH9A 3AGNA 3ECFA 3O8YA 4KFFA 1B2UA 1RGKA 1Y4KA 3F8HA 3FG3A 4N6TA 2W56B 3EQQB 3DGMA 1ROAA 1GOVA 3MG3A 3D5GA 4O3VA 9RNTA 7STDA 1GOUA 1JN5B 3A5EA 3NBJA 3I563 1RNBA 5BXQA 1DETA 4Q53A 3LH4A 3CPW2 5EVHA 3EC9A 3BLZA 1FZUA 3GAXA 3I0YA 1FUSA 4K1VA 1BNFA 2M7OA 4N6OB 3U1WA 4CDLA 4L8PA 1I3FA 2MF7A 4GSPA 3SEDA 1C54A 3CCL3 4CJNA 3CPOA 1I2GA 3ER7A 3WA3A 1EA2A 1OPYA 1TIJA 1JZOA 2I9WA 1BGSA 1IYYA 2F5WA 3JUOA 1YNVX 2F56A 1TUHA 4WYKB 3WOFB 2E2UA 5IG4A 3KIIA 3WDGB 2W9PA 1VQQA 1YHQ3 2SBLA 1K28A 5AYSC 1JZDA 3Q2PA 3B4OA 1MNLA 1N5HA 2BU4A 5I97A 1PYLA 1RTUA 4LMIA 1VQ73 2JDIH 2KF5A 3ZFZA 4NPBA 1DE3A 2Q07A 3T0UA 1GY6A 1STFI 1TTOA 3B8LA 5EQLA 5DREA 1U8CB 4R80A 1X1YA 2XR8B 2ZA4A 1W6YA 3MG1A 3K7CA 3BU4A 1EEJA 1BNIA 2KXGA 1Q7HA 1RN4A 1Q824 2B24B 2F5MA 1QJGA 4WHAA 3RNTA 1DVDA 4HKVB 2O9UX 3CC43 2QEX3 4BU4A 3DH2A 1NB3I 1T2IA 1QVG2 4EXRA 4FCMA 1NWWA 1UGIA 2BMRB 5RNTA 3CCR3 1AQZA 3DGNA 1JB5A 3KN4A 3OXAA 4R4KA 2E2VA 1GD3A 2QA43 1Z1SA 1FYSA 1VQ83 4L7KA 3HOHA 7GSPA 1LQGC 4KZ1A 4XB5A 3T8NA 2F4YA 1BNGA 3D79A 2OOVC 1JBTA 2LYXA 3MWZA 4XDWA 5AEUB 2W6JH 1JV2B 1UUWB 2OQEC 1VQ43 3GWRA 4STDA 1WNHA 4IPBA 2KRTA 3Q90A 1C7HA 1BRNL 1A67A 1SPUA 1B2SA 4HJLB 5CXOA 1UI8A 3GZXB 3IPTA 1JRQA 1BVIA 1CQSA 2W0QA 3OX9A 2HMJB 2H0HA 3NBRA 4EW5A 3PCRA 1G0TA 1LNHA 2XFTA 4FMCA 2JQ5A 1G96A 5EEOA 3RGRA 3PZWA 5CK6A 4AEQA 1TFOA 4PEJA 1RGEA 3GRDA 5M18A 4WFOA 2CFWA 1FUTA 1UCJA 1YVSA 3X41A 2RBIA 4CPKA 1IV9A 3OWYA 3PCSA 1I2EA 3K9MC 1LQMB 1O7NB 2KF6A 1IU7A 2CFGA 1W00A 3DY5A 3DXOA 3DGOA 5G1KA 2BMQB 3DGYA 2CH9A 4HOHA 2HMMB 1B2MA 1MWUA 1LOXA 1RGCA 1W4NA 4LSOA 1UUVB 4FMDA 1FGMA 3F7XA 3F40A 2OCTA 2CFLA 4N6MA 2D42A 2MC8A 3HX8A 5GSPA 3CCQ3 4MMYB 1W6CA 2UGIA 1RLSA 3BNDA 1RN1A 3N8BA 2Z7AA 2P05A 1RGAA 1JBRA 4HM4B 1UCIA 4XM4A 2C11A 1ULJB 4HM5B 1BU4A 2R41A 1U5OA 5FGOA 4K1UA 4HM3B 4BTWA 3DUKA 3WOEB 3N9HA 2CX0A 1X1XA 1BIRA 2CKFB 2XF3A 2C10A 1PFPA 1DMNA 2W03A 1N9JA 1UDII 2CWTA 2HMLB 3G4S3 1VQ93 2CWVA 1ZX2A 4HZBB 3M8CA 1S723 3BB9A 2F98A 1T3BA 3PGBA 1IVUA 4FR9A 1Q40A 5G2GA 4I5QA 4FMAA 4RZMA 1LOWA 3NX0A 2K3DA 5AIFA 3SYUA 3CD63 1D6ZA 4G1MB 1J2BA 3E99A 4MJDA 4X2OA 1AY7A 1FUWA 1UGHI 3MG2A 2P38A 4O2HA 1K9M4 2AAEA 2CWUA 5AIHA 4EV5A 1IDPA 1RGGA 1V57A 2IA7A 2KAAA 2XEPA 3BNCA 1BRSA 1GMRA 3NV0A 4KFEA 2IMJA 1QVF2 2HMKB 3JUMA 4LEHA 3F8XA 2W04A 4R1KA 1YIT3 1D6YA 2UX0A 1VQN3 3OV4A 4OVMA 5KP1A 1BRIA 2IUKA 2GSPA 5IW9A 1ZO2A 3J7Yd 2BHMA 3VF1A 2RCDA 1BRHA 1GSPA 1HZ1A 1GY7A 3RGAA 2F86B 1N9EA 3CME3 3BNEA 1JBSA 5AIIA 1D6UA 3D4AA 4N6NB 5D83A 1IQ8A 3MYTA 3SOYA 2UUGC 2GU1A 4EC6A 1HYFA 4HM8B 5IERA 3G713 1LNIA 3OWUA 2OTL3 3H3HA 1SJWA 1BSAA 1NO3A 4DKIA 4N3VA 1IVXA 5AIGA 1MGRA 1B2ZA 4HAAA 1N5PA 2HMNB 1IT8A 1PY3A 1V74A 3IMAB 5STDA 2IY2A 1K734 1CEWI 1BSBA 1TRQA 3LTBA 1M1XB 4ZM8A 1VQP3 3AHSA 1ASKA 1KSIA 1YI23 2H0GA 5IG0A 1F8NA 3S5CA 2GEYA 2W9QA 1Q40B 3MHEA 5CF1A 4LYLB 4XBYA 3L0RA 3QK9A 4MMXB 3JVCA 1DVCA 4EV2A 1RKYA 3CCU3 3ZG5A 1VQO3 4MMZB 1SARA 1OACA 1UI7A 3D3LA 1TU5A 1WQLB 4ORLA 4EYCA 3ROBA 4TX4A 3TDGA 1BOXA 3UL6A 6RNTA 2CG0A 2YFJB 2ZL8A 3UJMA 3SX1A 1BRKA 2OTJ3 1HKXA 3B7CA 1LXEA 1EG9B 1O7MB 1R4CA 1SQWA 3IJEB 1ISKA 5AEWB 1TRPA 3EBYA 5DRVA 3V98A 1VQK3 5IEOA 1TP6A 3U97A 3V99A 1L5GB 1B3SA 3DGLA 1KD14 3JUPA 1SIIA 3FG1A 1RSNA 1V58A 3H51A 3KSPA 4J5GA 4HYZA 1S5AA 2H0IA 2BNGA 2K54A 3HIIA 1AV4A 1WMNA 3EBTA 3FF2A 5AI1A 1FA3A 1T5YA 4BL3A 4LGQA 4K61A 4NHFA 5M19A 1OHPA 1IT7A 5KP3A 3GZRA 2E2TA 3V92A 3QRDA 5ELUA 1AR0A 1NDOB 1ZS7A 4X2HA 5ELJA 3CU3A 4WP5A 3G0KA 5LC7A 2CG1A 5JBSA 1OF5A 1NJI4 2WOFA 1TFKA 2STDA 5D82A 3AMOA 1AVKA 2R4IA 4O02B 3STDA 1A2VA 3CMA3 3G16A 1Q42A 4RNTA 2OOVA 1NNVA 5HGRA 1R4YA 3T8UA 1X1WA 1PU4A 3LTAA 5BU4A 1IVVA 1QAKA 3CNXA 4GL6A 2OQEA 1UCLA 3HZPA 2XRXB 4I4KA 1NU3A 1AVLA 1I70A 4GHOA 3CC73 1FW7A 4CCVA 1B2XA 2BT3A 1ZGXA 4ILFA 5IENA 3KFQC 3D9RA 1YJN3 3KE7A 3SXXA 1RGLA 4H3UA 1BRGA 3MSOA 3UB1A 2HMOB 2P0XA 3NQYA 2GBXB 3LZAA 1A2KA 1YVBI 1JB2A 2XGLA 1WMOA 1G02A 5IEPA 2WO0A 5CLKA 3X3YA 3LXUX 1OGZA 3NHXA 1DYUA 1RCKA 2P09A 3FKAA 1I8VA 2PNCA 3S29A 2GEXA 1MWTA 2YFIB 3X3XA 4RNZA 3DM8A 3AGOA 1B20A 1RRHA 1SIHA 3EB8A 4N6LA 3FGYA 1JNQA 2CC3A 1LOYA 3GZBA 2WOHA 3F14A 1M904 1GOYA 3NXJA 3LMLA 3K5TA 1EUIC 1HU9A 3AHWA 3EN8A 1YJW3 4BL2A 2GU3A 1ROVA 1OF5B 2Y73A 4HM7B 1BAOA 3AMOB 2SARA 5KP4A 1QAFA 4IIAA 1RNTA 1A2PA 1FGOA 1BSDA 2KF4A 1WMPA 2RNTA 1B27A 1LVNA 3LTCA 1QMAA 1W2ZA 2RGQA 3B4PA 4OK0A 4HM2B 4RNYA 3URPA 3F9SA 4XBXA 1ULIB 4XDVA 3I553 3ALAA 2K0MA 3WHOA 1OHSA 3KSED 4NREA 1W6GA
chains in the Genus database with same CATH topology
1O7PB 1FGTA 3LTDA 1VQ53 1W01A 1IQYA 3G6E3 3JUNA 4J9AA 4KVHA 4FMBA 3EF8A 1W2B2 1W7CA 2RSXA 2LQVA 3EX9A 3G8ZA 4EBGA 1Q7Y4 3HK4A 1QALA 5JPUA 3WA2X 1O7HB 1EQKA 3NM7A 3HI7A 1W02A 1DMQA 3NM2A 3JUQA 1VQM3 4H61A 1CYUA 2XGNA 3X42A 2PZVA 3WMDA 4GB5A 1RN7A 4FCZA 3CCM3 3LOYA 3SOAA 1VQ63 3K0ZA 1M1K4 1STDA 2CHCA 4WWUC 5A0OB 3FLJA 4AKZA 3X40A 1E97A 8CHOA 3N54B 1CYVA 2ML5A 5IG5A 1VZZA 5D81A 5JPPA 3EN1B 3NUVA 4HBRA 1VQL3 2GXFA 3LT8A 3VSYA 3KZTA 1JKGA 2KCDA 3BNBA 4BTXA 1O7GB 1Q864 3NV0B 3WODG 1YJ93 3FG4A 3FZWA 2CW9A 3KKGA 3CCV3 2XSHB 3UL5A 2Z76A 2YX9A 3CCE3 2CIUA 1IQXA 1K41A 3EHCA 2Y74A 1YIJ3 2BMOB 3OWSA 1Q814 1FGQA 3EJVA 5FW5A 2F99A 1N8QA 3DZLA 3UNLA 2QGUA 1OHOA 2FNQA 1GY5A 1NB5I 1US1A 1KQS2 2V1LA 4HM6B 3MKIA 2INXA 4J8TA 4HVNA 3CCJ3 3VGNA 1E3RA 2ML6A 1OGXA 4JF8A 2B1XB 6STDA 4N6UA 2QIYA 3PS8A 2W56A 3S28A 4HM1B 4LZIA 3X3ZA 5CF2A 3SLUA 4OUQA 2FXTA 2D1WA 1FGRA 2ZDJA 1MOLA 4IT7A 2XSOB 2Z6BA 4RBNA 3RDEA 1JN5A 1N8R4 1RRLA 5BVBA 3FCSB 2A15A 3S67A 3Q1CA 3OW22 1E3VA 3CNMA 3LT9A 1GD4A 3NQZA 4O8SA 5AIGA 2XFSA 1KWIA 3K63A 1IVWA 3NBBA 3A76A 5TGNA 3HIGA 2YFLB 5IG3A 3GZYB 1WTHA 3PXMA 4AKYA 1M9GA 3MPHA 4BTYA 4L8OA 1JKGB 2W2CA 4XBTA 4N6V0 1GYBA 1EKMA 2O3OA 1IK3A 2FGTA 2L4VA 2WGQA 3S27A 1OUNA 1W5ZA 3F7SA 3PYJA 4WYKA 5IF6A 4MEIA 4QWTA 2OWPA 3FF0A 1YGEA 3CC23 1JJ22 5AYRB 3SVAA 3DMCA 4FCJA 1K8A4 4JRFA 2CK3H 2Z77A 1IV7A 3FH1A 3CXC2 4HZ9B 4R9LA 4U13A 1O7WB 3EE1A 1RJOA 3LYGA 4KFDA 4R9KA 1DMMA 2CFKA 4K90B 2IUJA 1OCVA 2RFRA 2P0MA 1UW1A 2WGOA 4HM0B 1A90A 1BUQA 5LC6A 3FSDA 2BO9B 2CFDA 1JB4A 1OH0A 3CCS3 1KC84 2GBWB 1GS3A 2XH9A 3ECFA 4KFFA 3O8YA 1Y4KA 3F8HA 3FG3A 4N6TA 2W56B 3EQQB 3DGMA 1ROAA 3MG3A 4O3VA 7STDA 1JN5B 3NBJA 3I563 5BXQA 4Q53A 3LH4A 3CPW2 5EVHA 3EC9A 3BLZA 3GAXA 3I0YA 4K1VA 3U1WA 2M7OA 4N6OB 4CDLA 4L8PA 2MF7A 3SEDA 3CCL3 3CPOA 3ER7A 3WA3A 1EA2A 1OPYA 1TIJA 2I9WA 3JUOA 3WOFB 4WYKB 1TUHA 2E2UA 5IG4A 3KIIA 3WDGB 2W9PA 1YHQ3 2SBLA 1K28A 5AYSC 3Q2PA 3B4OA 1MNLA 1N5HA 5I97A 1VQ73 4LMIA 2JDIH 2Q07A 3T0UA 1GY6A 1STFI 3B8LA 5EQLA 5DREA 1U8CB 4R80A 2XR8B 1W6YA 3MG1A 3K7CA 2KXGA 1Q824 2B24B 1QJGA 4WHAA 1DVDA 4HKVB 2O9UX 3CC43 2QEX3 1NB3I 1QVG2 4EXRA 4FCMA 1NWWA 2BMRB 3CCR3 3DGNA 3KN4A 1JB5A 3OXAA 4R4KA 2E2VA 1GD3A 2QA43 1Z1SA 1VQ83 4L7KA 4KZ1A 3T8NA 4XB5A 2OOVC 2LYXA 3MWZA 4XDWA 5AEUB 2W6JH 1JV2B 1UUWB 2OQEC 1VQ43 3GWRA 4STDA 1WNHA 4IPBA 2KRTA 3Q90A 1C7HA 1A67A 1SPUA 4HJLB 5CXOA 1UI8A 3GZXB 3IPTA 1JRQA 1CQSA 2W0QA 3OX9A 2HMJB 3NBRA 3PCRA 1LNHA 2XFTA 4FMCA 2JQ5A 1G96A 5EEOA 3RGRA 3PZWA 5CK6A 4AEQA 1TFOA 4PEJA 3GRDA 4WFOA 2CFWA 3X41A 1IV9A 3OWYA 3PCSA 3K9MC 1O7NB 1IU7A 2CFGA 1W00A 3DY5A 3DXOA 3DGOA 2BMQB 2CH9A 2HMMB 1LOXA 1W4NA 4LSOA 1UUVB 4FMDA 1FGMA 3F7XA 3F40A 2OCTA 2CFLA 4N6MA 2D42A 2MC8A 3HX8A 3CCQ3 4MMYB 1W6CA 3BNDA 3N8BA 2Z7AA 2P05A 4HM4B 4XM4A 2C11A 1ULJB 4HM5B 1U5OA 5FGOA 4K1UA 4HM3B 4BTWA 3DUKA 3WOEB 3N9HA 2XF3A 2CKFB 2C10A 1PFPA 1DMNA 2W03A 1N9JA 2CWTA 2HMLB 3G4S3 1VQ93 2CWVA 1ZX2A 4HZBB 3M8CA 1S723 3BB9A 2F98A 4FR9A 3PGBA 1IVUA 5G2GA 1Q40A 4FMAA 4RZMA 3NX0A 5AIFA 3CD63 1D6ZA 4G1MB 1J2BA 3E99A 4MJDA 4X2OA 1FUWA 3MG2A 2P38A 4O2HA 1K9M4 2CWUA 5AIHA 4EV5A 1IDPA 2IA7A 2XEPA 3BNCA 3NV0A 4KFEA 2IMJA 1QVF2 2HMKB 3JUMA 4LEHA 3F8XA 2W04A 4R1KA 1YIT3 1D6YA 2UX0A 1VQN3 3OV4A 4OVMA 5KP1A 2IUKA 5IW9A 1ZO2A 3J7Yd 2BHMA 3VF1A 2RCDA 1GY7A 3RGAA 2F86B 1N9EA 3CME3 3BNEA 5AIIA 1D6UA 4N6NB 5D83A 1IQ8A 3MYTA 3SOYA 2GU1A 4EC6A 5IERA 4HM8B 3G713 3OWUA 2OTL3 3H3HA 1SJWA 1NO3A 4N3VA 1IVXA 1N5PA 2HMNB 1IT8A 1V74A 3IMAB 5STDA 1K734 1CEWI 3LTBA 4ZM8A 1M1XB 1VQP3 1ASKA 1KSIA 1YI23 5IG0A 1F8NA 3S5CA 2GEYA 2W9QA 1Q40B 3MHEA 5CF1A 4XBYA 3L0RA 3QK9A 1RKYA 3JVCA 1DVCA 4EV2A 3CCU3 1VQO3 4MMZB 1OACA 1UI7A 3D3LA 1TU5A 1WQLB 4ORLA 4EYCA 3ROBA 4TX4A 3TDGA 3UL6A 2OTJ3 2CG0A 2YFJB 2ZL8A 3UJMA 3SX1A 1HKXA 3B7CA 1LXEA 1EG9B 1O7MB 1R4CA 1SQWA 3IJEB 1ISKA 5AEWB 3EBYA 5DRVA 1VQK3 3V98A 5IEOA 1TP6A 3U97A 3V99A 1L5GB 3DGLA 1KD14 3JUPA 1SIIA 3FG1A 3H51A 3KSPA 4HYZA 1S5AA 2BNGA 2K54A 3HIIA 1AV4A 1WMNA 3EBTA 3FF2A 5AI1A 1FA3A 1T5YA 4LGQA 4K61A 4NHFA 1OHPA 1IT7A 5KP3A 3GZRA 2E2TA 3V92A 3QRDA 5ELUA 1AR0A 1NDOB 4X2HA 5ELJA 3CU3A 4WP5A 3G0KA 5LC7A 2CG1A 5JBSA 1OF5A 1NJI4 2WOFA 1TFKA 2STDA 5D82A 3AMOA 1AVKA 2R4IA 4O02B 3STDA 1A2VA 3CMA3 3G16A 1Q42A 2OOVA 5HGRA 3T8UA 1PU4A 3LTAA 1IVVA 1QAKA 3CNXA 4GL6A 2OQEA 3HZPA 2XRXB 4I4KA 1NU3A 1AVLA 3CC73 4CCVA 2BT3A 5IENA 3KFQC 3D9RA 1YJN3 3KE7A 3SXXA 4H3UA 3MSOA 3UB1A 2HMOB 2P0XA 3NQYA 2GBXB 3LZAA 1A2KA 1YVBI 1JB2A 2XGLA 1WMOA 5IEPA 2WO0A 5CLKA 3X3YA 3LXUX 1OGZA 3NHXA 1DYUA 2P09A 3FKAA 2PNCA 3S29A 2GEXA 2YFIB 3X3XA 4RNZA 3DM8A 1RRHA 1SIHA 3EB8A 4N6LA 3FGYA 1JNQA 2CC3A 3GZBA 2WOHA 3F14A 1M904 3NXJA 3LMLA 3K5TA 1HU9A 3EN8A 1YJW3 2GU3A 1ROVA 1OF5B 2Y73A 4HM7B 3AMOB 5KP4A 1QAFA 4IIAA 4MMXB 1FGOA 1WMPA 1LVNA 3LTCA 3B4PA 1QMAA 1W2ZA 2RGQA 4OK0A 4HM2B 4RNYA 3F9SA 4XBXA 1ULIB 4XDVA 3I553 3ALAA 2K0MA 1OHSA 3KSED 4NREA 1W6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7P B;  1W01 A;  3JUN A;  4J9A A;  4KVH A;  3EF8 A;  3G8Z A;  3EX9 A;  3HK4 A;  5JPU A;  1O7H B;  1W02 A;  1DMQ A;  3NM2 A;  3JUQ A;  2PZV A;  3WMD A;  4GB5 A;  3SOA A;  3K0Z A;  1STD A;  2CHC A;  4WWU C;  3FLJ A;  1E97 A;  8CHO A;  5IG5 A;  1VZZ A;  5D81 A;  5JPP A;  3EN1 B;  3NUV A;  2GXF A;  3VSY A;  3KZT A;  1JKG A;  1O7G B;  3NV0 B;  3FZW A;  3KKG A;  2XSH B;  2Z76 A;  1K41 A;  3EHC A;  2BMO B;  3OWS A;  3EJV A;  5FW5 A;  2F99 A;  3DZL A;  3UNL A;  2QGU A;  1OHO A;  1GY5 A;  4J8T A;  4HM6 B;  3MKI A;  2INX A;  4HVN A;  3VGN A;  1E3R A;  1OGX A;  2B1X B;  6STD A;  2QIY A;  5CF2 A;  4HM1 B;  4OUQ A;  2XSO B;  1JN5 A;  5BVB A;  2A15 A;  1E3V A;  3CNM A;  5AIG A;  3A76 A;  5TGN A;  2YFL B;  5IG3 A;  3GZY B;  4L8O A;  1JKG B;  2W2C A;  4XBT A;  1GYB A;  1OUN A;  3F7S A;  5IF6 A;  4WYK A;  3FF0 A;  2OWP A;  3DMC A;  4FCJ A;  2Z77 A;  3FH1 A;  4HZ9 B;  4R9L A;  4U13 A;  1O7W B;  3LYG A;  4R9K A;  1DMM A;  1OCV A;  2RFR A;  4HM0 B;  1BUQ A;  3FSD A;  1JB4 A;  1OH0 A;  2GBW B;  1GS3 A;  3ECF A;  3F8H A;  3EQQ B;  3MG3 A;  7STD A;  1JN5 B;  5BXQ A;  4Q53 A;  5EVH A;  3EC9 A;  3BLZ A;  3I0Y A;  4K1V A;  4CDL A;  4L8P A;  3SED A;  3CPO A;  3ER7 A;  1EA2 A;  1OPY A;  2I9W A;  3JUO A;  4WYK B;  1TUH A;  5IG4 A;  3B4O A;  4LMI A;  1GY6 A;  3B8L A;  5DRE A;  2XR8 B;  1W6Y A;  3MG1 A;  3K7C A;  2B24 B;  1QJG A;  4HKV B;  4FCM A;  1NWW A;  2BMR B;  1JB5 A;  3OXA A;  1Z1S A;  4L7K A;  3T8N A;  4XB5 A;  4XDW A;  5AEU B;  1UUW B;  3GWR A;  4STD A;  3Q90 A;  1C7H A;  4HJL B;  5CXO A;  3GZX B;  3IPT A;  1CQS A;  3OX9 A;  2HMJ B;  3NBR A;  2JQ5 A;  3RGR A;  5CK6 A;  4PEJ A;  3GRD A;  3OWY A;  1O7N B;  1W00 A;  3DXO A;  2BMQ B;  2HMM B;  1UUV B;  3F7X A;  3F40 A;  3HX8 A;  2Z7A A;  4HM4 B;  4XM4 A;  1ULJ B;  4HM5 B;  1U5O A;  4K1U A;  4HM3 B;  3DUK A;  2CKF B;  1DMN A;  2HML B;  4HZB B;  1ZX2 A;  3M8C A;  3BB9 A;  2F98 A;  5G2G A;  1Q40 A;  4RZM A;  5AIF A;  3E99 A;  4MJD A;  4X2O A;  3MG2 A;  5AIH A;  1IDP A;  2IMJ A;  2HMK B;  3JUM A;  4LEH A;  3F8X A;  4R1K A;  2UX0 A;  3OV4 A;  4OVM A;  5KP1 A;  1ZO2 A;  2RCD A;  1GY7 A;  3RGA A;  2F86 B;  5AII A;  5D83 A;  3SOY A;  3MYT A;  5IER A;  4HM8 B;  3OWU A;  3H3H A;  1SJW A;  4N3V A;  2HMN B;  5STD A;  1ASK A;  5IG0 A;  3S5C A;  2GEY A;  3MHE A;  1Q40 B;  5CF1 A;  4XBY A;  1WQL B;  4ORL A;  3ROB A;  2YFJ B;  3UJM A;  1HKX A;  3B7C A;  1EG9 B;  1O7M B;  1ISK A;  5AEW B;  3EBY A;  5DRV A;  5IEO A;  1TP6 A;  3JUP A;  3H51 A;  3KSP A;  1S5A A;  2BNG A;  2K54 A;  3EBT A;  3FF2 A;  5AI1 A;  4LGQ A;  1OHP A;  5KP3 A;  3GZR A;  1AR0 A;  1NDO B;  4X2H A;  3CU3 A;  4WP5 A;  3G0K A;  1OF5 A;  2STD A;  5D82 A;  2R4I A;  3STD A;  3G16 A;  1Q42 A;  5HGR A;  3T8U A;  3CNX A;  3HZP A;  2XRX B;  4I4K A;  1NU3 A;  5IEN A;  3D9R A;  3KE7 A;  4H3U A;  3MSO A;  2HMO B;  2GBX B;  3LZA A;  1A2K A;  1JB2 A;  5IEP A;  5CLK A;  3NHX A;  1OGZ A;  3FKA A;  2GEX A;  2YFI B;  3DM8 A;  3FGY A;  3GZB A;  3F14 A;  3NXJ A;  3EN8 A;  1OF5 B;  4HM7 B;  5KP4 A;  4IIA A;  1QMA A;  2RGQ A;  3B4P A;  4HM2 B;  3F9S A;  4XBX A;  1ULI B;  4XDV A;  1OHS A;  3NV0 A; 
#chains in the Genus database with same CATH topology
 1O7P B;  1FGT A;  2KF3 A;  3LTD A;  1W01 A;  3WR2 A;  1VQ5 3;  1IQY A;  1BSE A;  1UCK A;  3G6E 3;  3JUN A;  4J9A A;  7RNT A;  4KVH A;  4FMB A;  3EF8 A;  1W2B 2;  1MGW A;  1W7C A;  2RSX A;  2LQV A;  3EX9 A;  3G8Z A;  4EBG A;  1Q7Y 4;  3Q3F A;  3HK4 A;  5M1A A;  1QAL A;  5JPU A;  3WA2 X;  2BIR A;  1Q9E A;  1O7H B;  1EQK A;  3NM7 A;  3HI7 A;  1W02 A;  1RDS A;  1YGW A;  1DMQ A;  3NM2 A;  1BAN A;  3JUQ A;  1VQM 3;  4H61 A;  1CYU A;  2XGN A;  3X42 A;  2PZV A;  3WMD A;  4GB5 A;  1RN7 A;  4FCZ A;  3CCM 3;  3LOY A;  1TJD A;  1X1U A;  3SOA A;  4J5K A;  1VQ6 3;  3BIR A;  3K0Z A;  1M1K 4;  1STD A;  2CHC A;  4WWU C;  1MWS A;  5A0O B;  3FLJ A;  1LOV A;  4AKZ A;  3X40 A;  1I2F A;  1E97 A;  8CHO A;  3N54 B;  1CYV A;  1MWR A;  2ML5 A;  1VZZ A;  5D81 A;  5IG5 A;  5JPP A;  1RGH A;  3EN1 B;  3NUV A;  4HBR A;  1VQL 3;  2GXF A;  3LT8 A;  1I0V A;  3VSY A;  3KZT A;  1JKG A;  2KCD A;  3BNB A;  4BTX A;  1RHL A;  8RNT A;  1O7G B;  5HOH A;  1Q86 4;  1I0X A;  1B21 A;  3NV0 B;  5G1L A;  3WOD G;  1YJ9 3;  3FG4 A;  3FZW A;  1BNS A;  1RMS A;  2CW9 A;  3KKG A;  3CCV 3;  2XSH B;  4BIR A;  3UL5 A;  1BNR A;  2Z76 A;  2YX9 A;  3GSP A;  3CCE 3;  2CIU A;  1IQX A;  1K41 A;  3EHC A;  2Y74 A;  1YIJ 3;  2BMO B;  3OWS A;  1Q81 4;  1FGQ A;  3EJV A;  5FW5 A;  2F99 A;  1N8Q A;  3DZL A;  2ZHX B;  2QGU A;  3UNL A;  1RCL A;  1OHO A;  2FNQ A;  1GY5 A;  1NB5 I;  2AAD A;  1US1 A;  5BIR A;  1KQS 2;  2V1L A;  4HM6 B;  3MKI A;  1BNE A;  2INX A;  4J8T A;  4HVN A;  3CCJ 3;  3VGN A;  1E3R A;  1T2H A;  2ML6 A;  1OGX A;  1BSC A;  2B1X B;  4JF8 A;  6STD A;  4N6U A;  2QIY A;  3PS8 A;  2W56 A;  3S28 A;  4HM1 B;  2C4B A;  4LZI A;  3X3Z A;  5CF2 A;  3SLU A;  4OUQ A;  2FXT A;  2D1W A;  1FGR A;  2ZDJ A;  1MOL A;  4IT7 A;  2XSO B;  2Z6B A;  4RBN A;  3RDE A;  1JN5 A;  1N8R 4;  1RRL A;  5BVB A;  3FCS B;  2A15 A;  3S67 A;  3Q1C A;  2HOH A;  3OW2 2;  1E3V A;  3CNM A;  3LT9 A;  1GD4 A;  1LRA A;  3NQZ A;  4O8S A;  1I3I A;  2XFS A;  1KWI A;  3K63 A;  1IVW A;  3NBB A;  3A76 A;  4KT3 B;  3HIG A;  1GMP A;  2YFL B;  5TGN A;  5IG3 A;  3GZY B;  1WTH A;  3PXM A;  4AKY A;  3KCH A;  2J8X B;  1M9G A;  1BNJ A;  1BRJ A;  3MPH A;  4BTY A;  1BUJ A;  4L8O A;  1JKG B;  2W2C A;  4XBT A;  2CX1 A;  4N6V 0;  1GYB A;  1EKM A;  1UUG B;  2O3O A;  1IK3 A;  2L1S A;  2FGT A;  2L4V A;  2WGQ A;  3S27 A;  1OUN A;  1W5Z A;  3F7S A;  3PYJ A;  4WYK A;  3ZG0 A;  5IF6 A;  4MEI A;  2IYJ A;  4QWT A;  2OWP A;  3FF0 A;  1YGE A;  3CC2 3;  1JJ2 2;  5AYR B;  3SVA A;  3DMC A;  4FCJ A;  1K8A 4;  4JRF A;  2CK3 H;  2Z77 A;  6GSP A;  1IV7 A;  3FH1 A;  3CXC 2;  4HZ9 B;  4R9L A;  1RGF A;  3D5I A;  4U13 A;  1O7W B;  3EE1 A;  1RJO A;  3LYG A;  4KFD A;  4R9K A;  1DMM A;  2CFK A;  4K90 B;  2IUJ A;  1OCV A;  2RFR A;  2P0M A;  1UW1 A;  2WGO A;  4HM0 B;  1A90 A;  1BUQ A;  5LC6 A;  3FSD A;  1GMQ A;  2BO9 B;  2CFD A;  1JB4 A;  1OH0 A;  1CH0 A;  3CCS 3;  1KC8 4;  2GBW B;  1GS3 A;  2XH9 A;  3AGN A;  3ECF A;  3O8Y A;  4KFF A;  1B2U A;  1RGK A;  1Y4K A;  3F8H A;  3FG3 A;  4N6T A;  2W56 B;  3EQQ B;  3DGM A;  1ROA A;  1GOV A;  3MG3 A;  3D5G A;  4O3V A;  9RNT A;  7STD A;  1GOU A;  1JN5 B;  3A5E A;  3NBJ A;  3I56 3;  1RNB A;  5BXQ A;  1DET A;  4Q53 A;  3LH4 A;  3CPW 2;  5EVH A;  3EC9 A;  3BLZ A;  1FZU A;  3GAX A;  3I0Y A;  1FUS A;  4K1V A;  1BNF A;  2M7O A;  4N6O B;  3U1W A;  4CDL A;  4L8P A;  1I3F A;  2MF7 A;  4GSP A;  3SED A;  1C54 A;  3CCL 3;  4CJN A;  3CPO A;  1I2G A;  3ER7 A;  3WA3 A;  1EA2 A;  1OPY A;  1TIJ A;  1JZO A;  2I9W A;  1BGS A;  1IYY A;  2F5W A;  3JUO A;  1YNV X;  2F56 A;  1TUH A;  4WYK B;  3WOF B;  2E2U A;  5IG4 A;  3KII A;  3WDG B;  2W9P A;  1VQQ A;  1YHQ 3;  2SBL A;  1K28 A;  5AYS C;  1JZD A;  3Q2P A;  3B4O A;  1MNL A;  1N5H A;  2BU4 A;  5I97 A;  1PYL A;  1RTU A;  4LMI A;  1VQ7 3;  2JDI H;  2KF5 A;  3ZFZ A;  4NPB A;  1DE3 A;  2Q07 A;  3T0U A;  1GY6 A;  1STF I;  1TTO A;  3B8L A;  5EQL A;  5DRE A;  1U8C B;  4R80 A;  1X1Y A;  2XR8 B;  2ZA4 A;  1W6Y A;  3MG1 A;  3K7C A;  3BU4 A;  1EEJ A;  1BNI A;  2KXG A;  1Q7H A;  1RN4 A;  1Q82 4;  2B24 B;  2F5M A;  1QJG A;  4WHA A;  3RNT A;  1DVD A;  4HKV B;  2O9U X;  3CC4 3;  2QEX 3;  4BU4 A;  3DH2 A;  1NB3 I;  1T2I A;  1QVG 2;  4EXR A;  4FCM A;  1NWW A;  1UGI A;  2BMR B;  5RNT A;  3CCR 3;  1AQZ A;  3DGN A;  1JB5 A;  3KN4 A;  3OXA A;  4R4K A;  2E2V A;  1GD3 A;  2QA4 3;  1Z1S A;  1FYS A;  1VQ8 3;  4L7K A;  3HOH A;  7GSP A;  1LQG C;  4KZ1 A;  4XB5 A;  3T8N A;  2F4Y A;  1BNG A;  3D79 A;  2OOV C;  1JBT A;  2LYX A;  3MWZ A;  4XDW A;  5AEU B;  2W6J H;  1JV2 B;  1UUW B;  2OQE C;  1VQ4 3;  3GWR A;  4STD A;  1WNH A;  4IPB A;  2KRT A;  3Q90 A;  1C7H A;  1BRN L;  1A67 A;  1SPU A;  1B2S A;  4HJL B;  5CXO A;  1UI8 A;  3GZX B;  3IPT A;  1JRQ A;  1BVI A;  1CQS A;  2W0Q A;  3OX9 A;  2HMJ B;  2H0H A;  3NBR A;  4EW5 A;  3PCR A;  1G0T A;  1LNH A;  2XFT A;  4FMC A;  2JQ5 A;  1G96 A;  5EEO A;  3RGR A;  3PZW A;  5CK6 A;  4AEQ A;  1TFO A;  4PEJ A;  1RGE A;  3GRD A;  5M18 A;  4WFO A;  2CFW A;  1FUT A;  1UCJ A;  1YVS A;  3X41 A;  2RBI A;  4CPK A;  1IV9 A;  3OWY A;  3PCS A;  1I2E A;  3K9M C;  1LQM B;  1O7N B;  2KF6 A;  1IU7 A;  2CFG A;  1W00 A;  3DY5 A;  3DXO A;  3DGO A;  5G1K A;  2BMQ B;  3DGY A;  2CH9 A;  4HOH A;  2HMM B;  1B2M A;  1MWU A;  1LOX A;  1RGC A;  1W4N A;  4LSO A;  1UUV B;  4FMD A;  1FGM A;  3F7X A;  3F40 A;  2OCT A;  2CFL A;  4N6M A;  2D42 A;  2MC8 A;  3HX8 A;  5GSP A;  3CCQ 3;  4MMY B;  1W6C A;  2UGI A;  1RLS A;  3BND A;  1RN1 A;  3N8B A;  2Z7A A;  2P05 A;  1RGA A;  1JBR A;  4HM4 B;  1UCI A;  4XM4 A;  2C11 A;  1ULJ B;  4HM5 B;  1BU4 A;  2R41 A;  1U5O A;  5FGO A;  4K1U A;  4HM3 B;  4BTW A;  3DUK A;  3WOE B;  3N9H A;  2CX0 A;  1X1X A;  1BIR A;  2CKF B;  2XF3 A;  2C10 A;  1PFP A;  1DMN A;  2W03 A;  1N9J A;  1UDI I;  2CWT A;  2HML B;  3G4S 3;  1VQ9 3;  2CWV A;  1ZX2 A;  4HZB B;  3M8C A;  1S72 3;  3BB9 A;  2F98 A;  1T3B A;  3PGB A;  1IVU A;  4FR9 A;  1Q40 A;  5G2G A;  4I5Q A;  4FMA A;  4RZM A;  1LOW A;  3NX0 A;  2K3D A;  5AIF A;  3SYU A;  3CD6 3;  1D6Z A;  4G1M B;  1J2B A;  3E99 A;  4MJD A;  4X2O A;  1AY7 A;  1FUW A;  1UGH I;  3MG2 A;  2P38 A;  4O2H A;  1K9M 4;  2AAE A;  2CWU A;  5AIH A;  4EV5 A;  1IDP A;  1RGG A;  1V57 A;  2IA7 A;  2KAA A;  2XEP A;  3BNC A;  1BRS A;  1GMR A;  3NV0 A;  4KFE A;  2IMJ A;  1QVF 2;  2HMK B;  3JUM A;  4LEH A;  3F8X A;  2W04 A;  4R1K A;  1YIT 3;  1D6Y A;  2UX0 A;  1VQN 3;  3OV4 A;  4OVM A;  5KP1 A;  1BRI A;  2IUK A;  2GSP A;  5IW9 A;  1ZO2 A;  3J7Y d;  2BHM A;  3VF1 A;  2RCD A;  1BRH A;  1GSP A;  1HZ1 A;  1GY7 A;  3RGA A;  2F86 B;  1N9E A;  3CME 3;  3BNE A;  1JBS A;  5AII A;  1D6U A;  3D4A A;  4N6N B;  5D83 A;  1IQ8 A;  3MYT A;  3SOY A;  2UUG C;  2GU1 A;  4EC6 A;  1HYF A;  4HM8 B;  5IER A;  3G71 3;  1LNI A;  3OWU A;  2OTL 3;  3H3H A;  1SJW A;  1BSA A;  1NO3 A;  4DKI A;  4N3V A;  1IVX A;  5AIG A;  1MGR A;  1B2Z A;  4HAA A;  1N5P A;  2HMN B;  1IT8 A;  1PY3 A;  1V74 A;  3IMA B;  5STD A;  2IY2 A;  1K73 4;  1CEW I;  1BSB A;  1TRQ A;  3LTB A;  1M1X B;  4ZM8 A;  1VQP 3;  3AHS A;  1ASK A;  1KSI A;  1YI2 3;  2H0G A;  5IG0 A;  1F8N A;  3S5C A;  2GEY A;  2W9Q A;  1Q40 B;  3MHE A;  5CF1 A;  4LYL B;  4XBY A;  3L0R A;  3QK9 A;  4MMX B;  3JVC A;  1DVC A;  4EV2 A;  1RKY A;  3CCU 3;  3ZG5 A;  1VQO 3;  4MMZ B;  1SAR A;  1OAC A;  1UI7 A;  3D3L A;  1TU5 A;  1WQL B;  4ORL A;  4EYC A;  3ROB A;  4TX4 A;  3TDG A;  1BOX A;  3UL6 A;  6RNT A;  2CG0 A;  2YFJ B;  2ZL8 A;  3UJM A;  3SX1 A;  1BRK A;  2OTJ 3;  1HKX A;  3B7C A;  1LXE A;  1EG9 B;  1O7M B;  1R4C A;  1SQW A;  3IJE B;  1ISK A;  5AEW B;  1TRP A;  3EBY A;  5DRV A;  3V98 A;  1VQK 3;  5IEO A;  1TP6 A;  3U97 A;  3V99 A;  1L5G B;  1B3S A;  3DGL A;  1KD1 4;  3JUP A;  1SII A;  3FG1 A;  1RSN A;  1V58 A;  3H51 A;  3KSP A;  4J5G A;  4HYZ A;  1S5A A;  2H0I A;  2BNG A;  2K54 A;  3HII A;  1AV4 A;  1WMN A;  3EBT A;  3FF2 A;  5AI1 A;  1FA3 A;  1T5Y A;  4BL3 A;  4LGQ A;  4K61 A;  4NHF A;  5M19 A;  1OHP A;  1IT7 A;  5KP3 A;  3GZR A;  2E2T A;  3V92 A;  3QRD A;  5ELU A;  1AR0 A;  1NDO B;  1ZS7 A;  4X2H A;  5ELJ A;  3CU3 A;  4WP5 A;  3G0K A;  5LC7 A;  2CG1 A;  5JBS A;  1OF5 A;  1NJI 4;  2WOF A;  1TFK A;  2STD A;  5D82 A;  3AMO A;  1AVK A;  2R4I A;  4O02 B;  3STD A;  1A2V A;  3CMA 3;  3G16 A;  1Q42 A;  4RNT A;  2OOV A;  1NNV A;  5HGR A;  1R4Y A;  3T8U A;  1X1W A;  1PU4 A;  3LTA A;  5BU4 A;  1IVV A;  1QAK A;  3CNX A;  4GL6 A;  2OQE A;  1UCL A;  3HZP A;  2XRX B;  4I4K A;  1NU3 A;  1AVL A;  1I70 A;  4GHO A;  3CC7 3;  1FW7 A;  4CCV A;  1B2X A;  2BT3 A;  1ZGX A;  4ILF A;  5IEN A;  3KFQ C;  3D9R A;  1YJN 3;  3KE7 A;  3SXX A;  1RGL A;  4H3U A;  1BRG A;  3MSO A;  3UB1 A;  2HMO B;  2P0X A;  3NQY A;  2GBX B;  3LZA A;  1A2K A;  1YVB I;  1JB2 A;  2XGL A;  1WMO A;  1G02 A;  5IEP A;  2WO0 A;  5CLK A;  3X3Y A;  3LXU X;  1OGZ A;  3NHX A;  1DYU A;  1RCK A;  2P09 A;  3FKA A;  1I8V A;  2PNC A;  3S29 A;  2GEX A;  1MWT A;  2YFI B;  3X3X A;  4RNZ A;  3DM8 A;  3AGO A;  1B20 A;  1RRH A;  1SIH A;  3EB8 A;  4N6L A;  3FGY A;  1JNQ A;  2CC3 A;  1LOY A;  3GZB A;  2WOH A;  3F14 A;  1M90 4;  1GOY A;  3NXJ A;  3LML A;  3K5T A;  1EUI C;  1HU9 A;  3AHW A;  3EN8 A;  1YJW 3;  4BL2 A;  2GU3 A;  1ROV A;  1OF5 B;  2Y73 A;  4HM7 B;  1BAO A;  3AMO B;  2SAR A;  5KP4 A;  1QAF A;  4IIA A;  1RNT A;  1A2P A;  1FGO A;  1BSD A;  2KF4 A;  1WMP A;  2RNT A;  1B27 A;  1LVN A;  3LTC A;  1QMA A;  1W2Z A;  2RGQ A;  3B4P A;  4OK0 A;  4HM2 B;  4RNY A;  3URP A;  3F9S A;  4XBX A;  1ULI B;  4XDV A;  3I55 3;  3ALA A;  2K0M A;  3WHO A;  1OHS A;  3KSE D;  4NRE A;  1W6G A; 
#chains in the Genus database with same CATH homology
 1O7P B;  1FGT A;  3LTD A;  1VQ5 3;  1W01 A;  1IQY A;  3G6E 3;  3JUN A;  4J9A A;  4KVH A;  4FMB A;  3EF8 A;  1W2B 2;  1W7C A;  2RSX A;  2LQV A;  3EX9 A;  3G8Z A;  4EBG A;  1Q7Y 4;  3HK4 A;  1QAL A;  5JPU A;  3WA2 X;  1O7H B;  1EQK A;  3NM7 A;  3HI7 A;  1W02 A;  1DMQ A;  3NM2 A;  3JUQ A;  1VQM 3;  4H61 A;  1CYU A;  2XGN A;  3X42 A;  2PZV A;  3WMD A;  4GB5 A;  1RN7 A;  4FCZ A;  3CCM 3;  3LOY A;  3SOA A;  1VQ6 3;  3K0Z A;  1M1K 4;  1STD A;  2CHC A;  4WWU C;  5A0O B;  3FLJ A;  4AKZ A;  3X40 A;  1E97 A;  8CHO A;  3N54 B;  1CYV A;  2ML5 A;  5IG5 A;  1VZZ A;  5D81 A;  5JPP A;  3EN1 B;  3NUV A;  4HBR A;  1VQL 3;  2GXF A;  3LT8 A;  3VSY A;  3KZT A;  1JKG A;  2KCD A;  3BNB A;  4BTX A;  1O7G B;  1Q86 4;  3NV0 B;  3WOD G;  1YJ9 3;  3FG4 A;  3FZW A;  2CW9 A;  3KKG A;  3CCV 3;  2XSH B;  3UL5 A;  2Z76 A;  2YX9 A;  3CCE 3;  2CIU A;  1IQX A;  1K41 A;  3EHC A;  2Y74 A;  1YIJ 3;  2BMO B;  3OWS A;  1Q81 4;  1FGQ A;  3EJV A;  5FW5 A;  2F99 A;  1N8Q A;  3DZL A;  3UNL A;  2QGU A;  1OHO A;  2FNQ A;  1GY5 A;  1NB5 I;  1US1 A;  1KQS 2;  2V1L A;  4HM6 B;  3MKI A;  2INX A;  4J8T A;  4HVN A;  3CCJ 3;  3VGN A;  1E3R A;  2ML6 A;  1OGX A;  4JF8 A;  2B1X B;  6STD A;  4N6U A;  2QIY A;  3PS8 A;  2W56 A;  3S28 A;  4HM1 B;  4LZI A;  3X3Z A;  5CF2 A;  3SLU A;  4OUQ A;  2FXT A;  2D1W A;  1FGR A;  2ZDJ A;  1MOL A;  4IT7 A;  2XSO B;  2Z6B A;  4RBN A;  3RDE A;  1JN5 A;  1N8R 4;  1RRL A;  5BVB A;  3FCS B;  2A15 A;  3S67 A;  3Q1C A;  3OW2 2;  1E3V A;  3CNM A;  3LT9 A;  1GD4 A;  3NQZ A;  4O8S A;  5AIG A;  2XFS A;  1KWI A;  3K63 A;  1IVW A;  3NBB A;  3A76 A;  5TGN A;  3HIG A;  2YFL B;  5IG3 A;  3GZY B;  1WTH A;  3PXM A;  4AKY A;  1M9G A;  3MPH A;  4BTY A;  4L8O A;  1JKG B;  2W2C A;  4XBT A;  4N6V 0;  1GYB A;  1EKM A;  2O3O A;  1IK3 A;  2FGT A;  2L4V A;  2WGQ A;  3S27 A;  1OUN A;  1W5Z A;  3F7S A;  3PYJ A;  4WYK A;  5IF6 A;  4MEI A;  4QWT A;  2OWP A;  3FF0 A;  1YGE A;  3CC2 3;  1JJ2 2;  5AYR B;  3SVA A;  3DMC A;  4FCJ A;  1K8A 4;  4JRF A;  2CK3 H;  2Z77 A;  1IV7 A;  3FH1 A;  3CXC 2;  4HZ9 B;  4R9L A;  4U13 A;  1O7W B;  3EE1 A;  1RJO A;  3LYG A;  4KFD A;  4R9K A;  1DMM A;  2CFK A;  4K90 B;  2IUJ A;  1OCV A;  2RFR A;  2P0M A;  1UW1 A;  2WGO A;  4HM0 B;  1A90 A;  1BUQ A;  5LC6 A;  3FSD A;  2BO9 B;  2CFD A;  1JB4 A;  1OH0 A;  3CCS 3;  1KC8 4;  2GBW B;  1GS3 A;  2XH9 A;  3ECF A;  4KFF A;  3O8Y A;  1Y4K A;  3F8H A;  3FG3 A;  4N6T A;  2W56 B;  3EQQ B;  3DGM A;  1ROA A;  3MG3 A;  4O3V A;  7STD A;  1JN5 B;  3NBJ A;  3I56 3;  5BXQ A;  4Q53 A;  3LH4 A;  3CPW 2;  5EVH A;  3EC9 A;  3BLZ A;  3GAX A;  3I0Y A;  4K1V A;  3U1W A;  2M7O A;  4N6O B;  4CDL A;  4L8P A;  2MF7 A;  3SED A;  3CCL 3;  3CPO A;  3ER7 A;  3WA3 A;  1EA2 A;  1OPY A;  1TIJ A;  2I9W A;  3JUO A;  3WOF B;  4WYK B;  1TUH A;  2E2U A;  5IG4 A;  3KII A;  3WDG B;  2W9P A;  1YHQ 3;  2SBL A;  1K28 A;  5AYS C;  3Q2P A;  3B4O A;  1MNL A;  1N5H A;  5I97 A;  1VQ7 3;  4LMI A;  2JDI H;  2Q07 A;  3T0U A;  1GY6 A;  1STF I;  3B8L A;  5EQL A;  5DRE A;  1U8C B;  4R80 A;  2XR8 B;  1W6Y A;  3MG1 A;  3K7C A;  2KXG A;  1Q82 4;  2B24 B;  1QJG A;  4WHA A;  1DVD A;  4HKV B;  2O9U X;  3CC4 3;  2QEX 3;  1NB3 I;  1QVG 2;  4EXR A;  4FCM A;  1NWW A;  2BMR B;  3CCR 3;  3DGN A;  3KN4 A;  1JB5 A;  3OXA A;  4R4K A;  2E2V A;  1GD3 A;  2QA4 3;  1Z1S A;  1VQ8 3;  4L7K A;  4KZ1 A;  3T8N A;  4XB5 A;  2OOV C;  2LYX A;  3MWZ A;  4XDW A;  5AEU B;  2W6J H;  1JV2 B;  1UUW B;  2OQE C;  1VQ4 3;  3GWR A;  4STD A;  1WNH A;  4IPB A;  2KRT A;  3Q90 A;  1C7H A;  1A67 A;  1SPU A;  4HJL B;  5CXO A;  1UI8 A;  3GZX B;  3IPT A;  1JRQ A;  1CQS A;  2W0Q A;  3OX9 A;  2HMJ B;  3NBR A;  3PCR A;  1LNH A;  2XFT A;  4FMC A;  2JQ5 A;  1G96 A;  5EEO A;  3RGR A;  3PZW A;  5CK6 A;  4AEQ A;  1TFO A;  4PEJ A;  3GRD A;  4WFO A;  2CFW A;  3X41 A;  1IV9 A;  3OWY A;  3PCS A;  3K9M C;  1O7N B;  1IU7 A;  2CFG A;  1W00 A;  3DY5 A;  3DXO A;  3DGO A;  2BMQ B;  2CH9 A;  2HMM B;  1LOX A;  1W4N A;  4LSO A;  1UUV B;  4FMD A;  1FGM A;  3F7X A;  3F40 A;  2OCT A;  2CFL A;  4N6M A;  2D42 A;  2MC8 A;  3HX8 A;  3CCQ 3;  4MMY B;  1W6C A;  3BND A;  3N8B A;  2Z7A A;  2P05 A;  4HM4 B;  4XM4 A;  2C11 A;  1ULJ B;  4HM5 B;  1U5O A;  5FGO A;  4K1U A;  4HM3 B;  4BTW A;  3DUK A;  3WOE B;  3N9H A;  2XF3 A;  2CKF B;  2C10 A;  1PFP A;  1DMN A;  2W03 A;  1N9J A;  2CWT A;  2HML B;  3G4S 3;  1VQ9 3;  2CWV A;  1ZX2 A;  4HZB B;  3M8C A;  1S72 3;  3BB9 A;  2F98 A;  4FR9 A;  3PGB A;  1IVU A;  5G2G A;  1Q40 A;  4FMA A;  4RZM A;  3NX0 A;  5AIF A;  3CD6 3;  1D6Z A;  4G1M B;  1J2B A;  3E99 A;  4MJD A;  4X2O A;  1FUW A;  3MG2 A;  2P38 A;  4O2H A;  1K9M 4;  2CWU A;  5AIH A;  4EV5 A;  1IDP A;  2IA7 A;  2XEP A;  3BNC A;  3NV0 A;  4KFE A;  2IMJ A;  1QVF 2;  2HMK B;  3JUM A;  4LEH A;  3F8X A;  2W04 A;  4R1K A;  1YIT 3;  1D6Y A;  2UX0 A;  1VQN 3;  3OV4 A;  4OVM A;  5KP1 A;  2IUK A;  5IW9 A;  1ZO2 A;  3J7Y d;  2BHM A;  3VF1 A;  2RCD A;  1GY7 A;  3RGA A;  2F86 B;  1N9E A;  3CME 3;  3BNE A;  5AII A;  1D6U A;  4N6N B;  5D83 A;  1IQ8 A;  3MYT A;  3SOY A;  2GU1 A;  4EC6 A;  5IER A;  4HM8 B;  3G71 3;  3OWU A;  2OTL 3;  3H3H A;  1SJW A;  1NO3 A;  4N3V A;  1IVX A;  1N5P A;  2HMN B;  1IT8 A;  1V74 A;  3IMA B;  5STD A;  1K73 4;  1CEW I;  3LTB A;  4ZM8 A;  1M1X B;  1VQP 3;  1ASK A;  1KSI A;  1YI2 3;  5IG0 A;  1F8N A;  3S5C A;  2GEY A;  2W9Q A;  1Q40 B;  3MHE A;  5CF1 A;  4XBY A;  3L0R A;  3QK9 A;  1RKY A;  3JVC A;  1DVC A;  4EV2 A;  3CCU 3;  1VQO 3;  4MMZ B;  1OAC A;  1UI7 A;  3D3L A;  1TU5 A;  1WQL B;  4ORL A;  4EYC A;  3ROB A;  4TX4 A;  3TDG A;  3UL6 A;  2OTJ 3;  2CG0 A;  2YFJ B;  2ZL8 A;  3UJM A;  3SX1 A;  1HKX A;  3B7C A;  1LXE A;  1EG9 B;  1O7M B;  1R4C A;  1SQW A;  3IJE B;  1ISK A;  5AEW B;  3EBY A;  5DRV A;  1VQK 3;  3V98 A;  5IEO A;  1TP6 A;  3U97 A;  3V99 A;  1L5G B;  3DGL A;  1KD1 4;  3JUP A;  1SII A;  3FG1 A;  3H51 A;  3KSP A;  4HYZ A;  1S5A A;  2BNG A;  2K54 A;  3HII A;  1AV4 A;  1WMN A;  3EBT A;  3FF2 A;  5AI1 A;  1FA3 A;  1T5Y A;  4LGQ A;  4K61 A;  4NHF A;  1OHP A;  1IT7 A;  5KP3 A;  3GZR A;  2E2T A;  3V92 A;  3QRD A;  5ELU A;  1AR0 A;  1NDO B;  4X2H A;  5ELJ A;  3CU3 A;  4WP5 A;  3G0K A;  5LC7 A;  2CG1 A;  5JBS A;  1OF5 A;  1NJI 4;  2WOF A;  1TFK A;  2STD A;  5D82 A;  3AMO A;  1AVK A;  2R4I A;  4O02 B;  3STD A;  1A2V A;  3CMA 3;  3G16 A;  1Q42 A;  2OOV A;  5HGR A;  3T8U A;  1PU4 A;  3LTA A;  1IVV A;  1QAK A;  3CNX A;  4GL6 A;  2OQE A;  3HZP A;  2XRX B;  4I4K A;  1NU3 A;  1AVL A;  3CC7 3;  4CCV A;  2BT3 A;  5IEN A;  3KFQ C;  3D9R A;  1YJN 3;  3KE7 A;  3SXX A;  4H3U A;  3MSO A;  3UB1 A;  2HMO B;  2P0X A;  3NQY A;  2GBX B;  3LZA A;  1A2K A;  1YVB I;  1JB2 A;  2XGL A;  1WMO A;  5IEP A;  2WO0 A;  5CLK A;  3X3Y A;  3LXU X;  1OGZ A;  3NHX A;  1DYU A;  2P09 A;  3FKA A;  2PNC A;  3S29 A;  2GEX A;  2YFI B;  3X3X A;  4RNZ A;  3DM8 A;  1RRH A;  1SIH A;  3EB8 A;  4N6L A;  3FGY A;  1JNQ A;  2CC3 A;  3GZB A;  2WOH A;  3F14 A;  1M90 4;  3NXJ A;  3LML A;  3K5T A;  1HU9 A;  3EN8 A;  1YJW 3;  2GU3 A;  1ROV A;  1OF5 B;  2Y73 A;  4HM7 B;  3AMO B;  5KP4 A;  1QAF A;  4IIA A;  4MMX B;  1FGO A;  1WMP A;  1LVN A;  3LTC A;  3B4P A;  1QMA A;  1W2Z A;  2RGQ A;  4OK0 A;  4HM2 B;  4RNY A;  3F9S A;  4XBX A;  1ULI B;  4XDV A;  3I55 3;  3ALA A;  2K0M A;  1OHS A;  3KSE D;  4NRE A;  1W6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...