9RNTA

Ribonuclease t1 with free recognition and catalytic site: crystal structure analysis at 1.5 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Ribonuclease T1 with free recognition and catalytic site: crystal structure analysis at 1.5 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 9rntA00
2RBIA 1TRQA 1GOVA 1BSAA 1I0XA 1A2PA 1I8VA 1BRNL 1X1YA 7RNTA 1UCIA 1BNEA 1AY7A 2KF4A 1I0VA 1BANA 1BGSA 1GMQA 2F56A 1B2XA 1RMSA 1DETA 3Q3FA 1I3FA 1BNGA 3WHOA 1RCLA 3DGYA 1BRGA 2KF6A 1G02A 4HAAA 2KAAA 1DE3A 3WR2A 1MGRA 1ZGXA 2SARA 1BSBA 1LOYA 1BRIA 4GHOA 1B20A 1BSDA 2F5WA 4J5KA 1B2UA 1BVIA 1RLSA 1IYYA 1PY3A 1RSNA 1BSCA 2GSPA 2BU4A 1RN1A 1BRKA 1Q9EA 1RGHA 1JBTA 1YVSA 1FZUA 1RNTA 3DH2A 4BIRA 1BNFA 3AHWA 1BRHA 1B2ZA 1HZ1A 5BU4A 1JBSA 3D5IA 2RNTA 2KF3A 1FUSA 1GMPA 1GMRA 1I2GA 1C54A 1X1XA 4RNTA 4J5GA 1SARA 1BOXA 2HOHA 7GSPA 1RHLA 1UCKA 2BIRA 1FUTA 2C4BA 1BIRA 2KF5A 1GSPA 5GSPA 8RNTA 1FW7A 5HOHA 3KCHA 1LOVA 5BIRA 1B2MA 3BIRA 1RGEA 3D5GA 1T2IA 6GSPA 1RGAA 1RGGA 1CH0A 3AGOA 1BU4A 3AGNA 3A5EA 1B2SA 1GOYA 1BRJA 2AADA 3HOHA 1B21A 3URPA 1BRSA 1BUJA 1AQZA 1B3SA 3D4AA 1T2HA 1I2EA 4GSPA 1LOWA 9RNTA 1RGLA 3AHSA 1BAOA 1BNSA 1B27A 1LRAA 1RCKA 1RGCA 1BNIA 2ZA4A 1RNBA 4HOHA 1RDSA 1BSEA 1UCJA 1RN4A 1YGWA 1RTUA 2AAEA 1MGWA 1BNJA 1I3IA 2F4YA 1R4YA 1X1WA 6RNTA 3GSPA 1PYLA 1LNIA 1I2FA 1FYSA 2F5MA 1YNVX 1UCLA 1X1UA 3BU4A 1BNRA 1HYFA 1RGKA 1TTOA 1JBRA 1TRPA 1RGFA 3SYUA 3RNTA 1I70A 4BU4A 1GOUA 5RNTA
chains in the Genus database with same CATH superfamily
2C10A 2CFKA 2UGIA 3G8ZA 1BSAA 1I0XA 4FCJA 3LT9A 4OK0A 1BRNL 3I0YA 4LYLB 1A90A 2P38A 2GEYA 2H0HA 4R80A 1UCIA 3FH1A 1DMMA 1TFKA 1IQ8A 4LMIA 1I0VA 3NV0B 3MWZA 1DETA 3LTCA 3N8BA 3SX1A 3NBBA 3Q3FA 1WMOA 2BMQB 1IV7A 3DGYA 5D83A 1VQ43 3RGAA 2KF6A 3CC23 2KAAA 3CPOA 1YGEA 4LZIA 1VQP3 1QVG2 1N8R4 3ZFZA 1OF5A 2IYJA 4CJNA 1BUQA 5KP4A 3OV4A 4JRFA 1RSNA 1BSCA 2CWTA 3LH4A 3X41A 5AIHA 1RN1A 4K1UA 1Q814 3S29A 2YFJB 1C7HA 3L0RA 1GY7A 3DH2A 3V92A 1V57A 3ROBA 3EBYA 3GZRA 3NX0A 1LOXA 3AMOA 4HM7B 3K63A 2YX9A 3PXMA 5JPPA 3TDGA 3SXXA 4EBGA 4IIAA 1NB3I 3GZYB 2JQ5A 2IUKA 2B24B 4KVHA 1SIIA 2CFGA 4N6UA 4Q53A 4MMXB 3PGBA 1RRLA 1FUTA 3MYTA 3UB1A 3RGRA 1N9JA 2CH9A 3V99A 3ZG0A 2D42A 3UJMA 1FGTA 1WMPA 1K9M4 3M8CA 1B2MA 3T8NA 4KFEA 4XBXA 1WTHA 3OXAA 1RGGA 3IMAB 3AGNA 3NUVA 3RDEA 2WOHA 2W0QA 4FMDA 1JKGB 3EHCA 1BRSA 2FXTA 4IPBA 1AQZA 1AV4A 3F8HA 5IEPA 4U13A 3T8UA 1IQXA 3GAXA 3E99A 3MSOA 4FR9A 1GY5A 1LOWA 2RSXA 3DM8A 4HM3B 1RKYA 3Q1CA 1IU7A 1QJGA 1RCKA 2PZVA 3MG2A 3MG3A 1U5OA 1RNBA 3NV0A 4RBNA 1W5ZA 4O8SA 1RRHA 3EF8A 3SOAA 3EE1A 3NXJA 5BVBA 2AAEA 1ZS7A 1IQYA 1MWUA 4WWUC 2F4YA 2M7OA 1LQMB 1ULJB 2Z6BA 2W9PA 1PFPA 3CMA3 3CD63 3VSYA 1E3VA 1JB2A 4OUQA 4TX4A 2CWUA 4N6OB 1PYLA 4HZBB 1LVNA 5HGRA 2STDA 3GZXB 1HKXA 2D1WA 3BB9A 2WO0A 1K8A4 3FZWA 4R1KA 1GS3A 1Q864 1NJI4 3ALAA 3WMDA 3FG3A 2CG1A 1L5GB 1MOLA 3UL6A 1LQGC 3SYUA 5I97A 2P0XA 4G1MB 5CF2A 4GL6A 1I70A 3MHEA 4I4KA 4NHFA 5LC6A 4EV2A 4BU4A 1GOUA 1LXEA 4XDWA 4R9LA 3MKIA 2JDIH 4NPBA 2QIYA 3LTBA 3CNMA 5AIIA 3LMLA 3T0UA 3S27A 3S28A 1O7PB 2HMKB 4XDVA 5D81A 1TRQA 1CYVA 1TFOA 2Z7AA 2IY2A 1MNLA 1UW1A 2XRXB 1FGMA 4KZ1A 4NREA 7RNTA 3WODG 2ZL8A 1O7MB 3F7SA 4BTWA 3CCJ3 4R9KA 3OWUA 3BNEA 1E3RA 1UI8A 1RN7A 1K41A 3WHOA 1Q42A 1BRGA 3A76A 1G02A 2IA7A 5G1LA 4XBTA 1IK3A 3CCQ3 1DE3A 1UDII 3FF0A 5EEOA 3WR2A 4RNYA 4K1VA 4RNZA 1LOYA 5FW5A 1BRIA 4GHOA 1B20A 4DKIA 3NQZA 1RLSA 4EYCA 2CG0A 3CC43 1JKGA 3FSDA 1UI7A 2Z77A 2XH9A 4XM4A 1RNTA 4XB5A 2K3DA 3U1WA 4H3UA 1AVKA 4HZ9B 2CX1A 1JBSA 1BUJA 2CKFB 4PEJA 2K0MA 1FUSA 1I2GA 5STDA 5CK6A 3S5CA 1YIT3 1C54A 2WGQA 3D3LA 3SLUA 3Q2PA 2O3OA 4J5GA 2W9QA 3X3ZA 2HOHA 3WA2X 2Z76A 5KP3A 5IG4A 5IG0A 1DVCA 1M1XB 4XBYA 2K54A 7STDA 4KFDA 3QRDA 4BTXA 1GSPA 4I5QA 2J8XB 3GRDA 4ILFA 3KCHA 4R4KA 1V74A 3PCSA 3LTAA 2F98A 3F40A 3BIRA 3D5GA 4BL3A 5ELUA 5IERA 6GSPA 3FCSB 4X2HA 1CH0A 5AEUB 3GWRA 4GB5A 1OHSA 1W6YA 1A67A 3LZAA 3A5EA 1B2SA 2P09A 3D9RA 2IUJA 2HMOB 4J9AA 3URPA 2WOFA 1FA3A 3EQQB 3GZBA 1CYUA 3CCV3 1RJOA 2MF7A 3B4PA 1KD14 1IVVA 9RNTA 2W56A 1KQS2 1LNHA 1ZO2A 1S5AA 3FGYA 2ZA4A 3DZLA 4HM2B 2R4IA 1IVXA 3K7CA 1UCJA 2P05A 4MMYB 1RN4A 1ROVA 1RTUA 3J7Yd 3KSED 1I3IA 3KKGA 2BHMA 5M1AA 1Q7HA 1DMQA 4RZMA 6RNTA 4L7KA 3FG1A 5JBSA 1D6UA 2OTJ3 3UL5A 4LEHA 1I2FA 2O9UX 1Q7Y4 2PNCA 3PS8A 4HM1B 1W4NA 3U97A 1N8QA 3B4OA 2L1SA 2OOVA 1GYBA 2BNGA 2SBLA 1W01A 4N6TA 1Q824 5AI1A 1TUHA 1HU9A 4FMBA 1Q40A 2YFIB 1EKMA 4CCVA 3IJEB 2GU3A 1K734 1WNHA 3DGMA 3OX9A 3CCS3 2QA43 4X2OA 1GD4A 1GOVA 1ASKA 1EG9B 3KE7A 4MMZB 3X3YA 1VQ83 2GU1A 2L4VA 1VQL3 1X1YA 5FGOA 1NDOB 4STDA 1VQ63 3NBRA 2OQEC 1EEJA 1AY7A 2KF4A 3K9MC 1VQ53 1BANA 3KSPA 1BGSA 1GMQA 3QK9A 1RMSA 3UNLA 2CWVA 2H0GA 4EXRA 1FGQA 2F99A 1I3FA 2E2VA 3B7CA 1J2BA 1OHPA 1W02A 3SOYA 1M9GA 1IDPA 3H3HA 2XFSA 3NM2A 4HYZA 2XGLA 2SARA 2XEPA 1N5PA 1FUWA 1VQ73 3BNBA 1QMAA 3OWSA 4WYKA 5TGNA 4BL2A 3CXC2 3X3XA 3CCE3 3CCM3 1IYYA 1PY3A 4EV5A 4N6MA 1BRKA 3FKAA 3G4S3 3IPTA 1FGRA 3HK4A 1UUGB 1W6GA 3F7XA 5M19A 1SJWA 4HKVB 4BIRA 2XGNA 3OWYA 2W56B 4ZM8A 2XF3A 1BNFA 3AHWA 1OPYA 1YI23 1QAFA 1YVBI 3X40A 5BU4A 5IG5A 3D5IA 3HIIA 1GMPA 1GMRA 5DREA 3WDGB 3LT8A 2RCDA 3LYGA 4IT7A 1YHQ3 2P0MA 4HM0B 1VQN3 1IV9A 4KFFA 3JUPA 4RNTA 1SARA 2BMRB 4KT3B 5AYSC 3HIGA 7GSPA 1RHLA 5EQLA 1Z1SA 1TIJA 4FMAA 2C4BA 1ZX2A 4HM4B 2W04A 5IENA 1UGHI 3MPHA 4OVMA 5GSPA 3WOEB 8RNTA 5HOHA 1W6CA 2HMNB 3FLJA 3OW22 4MJDA 1LOVA 2IMJA 4AKYA 3K5TA 1KWIA 1RGEA 1KSIA 1WQLB 2ZHXB 3NM7A 1OGZA 2UUGC 1Q40B 1W2B2 1JN5A 3DY5A 1G96A 4WFOA 3JUMA 2HMMB 1NO3A 1O7HB 1STDA 1TP6A 1WMNA 1BRJA 3HOHA 1VQ93 4FCZA 3CC73 1SQWA 1Y4KA 4O02B 1N5HA 3VGNA 1DMNA 3D4AA 6STDA 1OCVA 1R4CA 2CC3A 2HMLB 3LTDA 1I2EA 3PCRA 4HJLB 4L8OA 4GSPA 4BTYA 1JZDA 1RGLA 4QWTA 1BNSA 5LC7A 2CHCA 2CW9A 2FNQA 1RGCA 2CFWA 1BNIA 3JUNA 2Y73A 1D6ZA 3CCU3 4N6NB 5CLKA 1CQSA 2I9WA 1BSEA 1NU3A 3EN8A 3JVCA 1UUVB 4CDLA 1IT7A 1YJW3 1MWSA 1QAKA 3STDA 3I553 2C11A 1O7WB 2OOVC 3H51A 1OACA 3K0ZA 1SPUA 3EX9A 3GSPA 4WYKB 5ELJA 2ZDJA 3G16A 1LNIA 2V1LA 3MG1A 1EUIC 1T3BA 2UX0A 1UCLA 1X1UA 3BU4A 1HYFA 1RGKA 2F86B 1M1K4 1JBRA 1RGFA 1VQM3 3RNTA 3G0KA 5RNTA 1F8NA 5G1KA 5JPUA 3KFQC 2H0IA 2LYXA 2RGQA 1UGIA 4EW5A 2RBIA 3NHXA 1A2PA 1I8VA 3O8YA 2XFTA 3CCL3 5AIGA 1BNEA 3EB8A 1OUNA 3BNCA 5IEOA 3WOFB 1DYUA 4FCMA 5CXOA 2F56A 4HM6B 1B2XA 2INXA 4WHAA 1M904 1GY6A 1BNGA 5IF6A 1RCLA 2QEX3 2OWPA 2CK3H 3ER7A 1E97A 3G6E3 5AIFA 3PYJA 4HAAA 1YJ93 4MEIA 1MGRA 1ZGXA 1O7NB 3F9SA 1JN5B 1O7GB 1BSBA 1OGXA 2BMOB 3FG4A 3SEDA 2BT3A 4WP5A 3KN4A 3PZWA 1BSDA 3KZTA 2F5WA 5BXQA 4J5KA 1B2UA 1BVIA 4AEQA 4O3VA 5KP1A 1IVWA 2A15A 2GSPA 4N3VA 2BU4A 2CX0A 3NQYA 1Q9EA 1RGHA 1US1A 1U8CB 2KCDA 2E2UA 3F14A 1MWRA 3JUQA 1JBTA 1YVSA 2XR8B 1FZUA 3BLZA 2ML6A 3CME3 3B8LA 1BRHA 1ROAA 1B2ZA 1TU5A 1HZ1A 1IT8A 3DXOA 1W00A 2RNTA 1AR0A 1N9EA 2KF3A 3DGOA 3JUOA 3G713 1YIJ3 4K61A 3ZG5A 1JV2B 4N6LA 1X1XA 3V98A 2GEXA 4K90B 1BOXA 3VF1A 1JNQA 5A0OB 2KRTA 2BO9B 3CU3A 5AEWB 2GXFA 4AKZA 1IVUA 1UCKA 3EBTA 2QGUA 2CIUA 2BIRA 4HVNA 1NWWA 1BIRA 1W2ZA 1MWTA 1YJN3 2FGTA 2YFLB 2KF5A 2ML5A 1EQKA 2GBWB 1OH0A 2B1XB 2W03A 3HI7A 3LOYA 2HMJB 1FW7A 2MC8A 1STFI 1T5YA 5BIRA 1CEWI 1VQQA 4LGQA 3CCR3 3EC9A 5AYRB 1NB5I 1DVDA 1T2IA 2OCTA 1OF5B 2XSOB 3CPW2 2CFLA 3CNXA 1G0TA 1RGAA 3AGOA 3WA3A 5M18A 1BU4A 3DGLA 4HM5B 5G2GA 1KC84 1QALA 2R41A 1GOYA 3HX8A 2AADA 3N9HA 1B21A 4ORLA 1A2VA 1D6YA 3DUKA 3X42A 1EA2A 1B3SA 3KIIA 2XSHB 8CHOA 5IW9A 1VQK3 3Q90A 5DRVA 1T2HA 3AMOB 1FGOA 2W2CA 2OTL3 1OHOA 4J8TA 2GBXB 2Y74A 1BAOA 3AHSA 4H61A 3HZPA 1QVF2 1B27A 1K28A 1LRAA 3DMCA 3EJVA 1PU4A 1W7CA 4O2HA 3I563 5CF1A 1JRQA 1TJDA 2E2TA 1RDSA 3BNDA 4HBRA 4HOHA 1ULIB 1YGWA 1NNVA 2Q07A 3F8XA 1JJ22 1MGWA 1BNJA 1JB5A 3SVAA 4JF8A 4LSOA 1R4YA 5D82A 4EC6A 1X1WA 1A2KA 1VZZA 4L8PA 2CFDA 1SIHA 1GD3A 1UUWB 3N54B 3NBJA 1ISKA 2WGOA 1AVLA 1FYSA 1JB4A 1V58A 2F5MA 1YNVX 4FMCA 5EVHA 2LQVA 1VQO3 1BNRA 3DGNA 3ECFA 3EN1B 1TTOA 2KXGA 1TRPA 2OQEA 4N6V0 1S723 1JZOA 3D79A 4HM8B 3S67A 3LXUX 5IG3A 2W6JH 3FF2A 2RFRA 4CPKA
chains in the Genus database with same CATH topology
2RBIA 1TRQA 1GOVA 1BSAA 1I0XA 1A2PA 1I8VA 1BRNL 1X1YA 7RNTA 1UCIA 1BNEA 1AY7A 2KF4A 1I0VA 1BANA 1BGSA 1GMQA 2F56A 1B2XA 1RMSA 1DETA 3Q3FA 1I3FA 1BNGA 3WHOA 1RCLA 3DGYA 1BRGA 2KF6A 1G02A 4HAAA 2KAAA 1DE3A 3WR2A 1MGRA 1ZGXA 2SARA 1BSBA 1LOYA 1BRIA 4GHOA 1B20A 1BSDA 2F5WA 4J5KA 1B2UA 1BVIA 1RLSA 1IYYA 1PY3A 1RSNA 1BSCA 2GSPA 2BU4A 1RN1A 1BRKA 1Q9EA 1RGHA 1JBTA 1YVSA 1FZUA 1RNTA 3DH2A 4BIRA 1BNFA 3AHWA 1BRHA 1B2ZA 1HZ1A 5BU4A 1JBSA 3D5IA 2RNTA 2KF3A 1FUSA 1GMPA 1GMRA 1I2GA 1C54A 1X1XA 4RNTA 4J5GA 1SARA 1BOXA 2HOHA 7GSPA 1RHLA 1UCKA 2BIRA 1FUTA 2C4BA 1BIRA 2KF5A 1GSPA 5GSPA 8RNTA 1FW7A 5HOHA 3KCHA 1LOVA 5BIRA 1B2MA 3BIRA 1RGEA 3D5GA 1T2IA 6GSPA 1RGAA 1RGGA 1CH0A 3AGOA 1BU4A 3AGNA 3A5EA 1B2SA 1GOYA 1BRJA 2AADA 3HOHA 1B21A 3URPA 1BRSA 1BUJA 1AQZA 1B3SA 3D4AA 1T2HA 1I2EA 4GSPA 1LOWA 9RNTA 1RGLA 3AHSA 1BAOA 1BNSA 1B27A 1LRAA 1RCKA 1RGCA 1BNIA 2ZA4A 1RNBA 4HOHA 1RDSA 1BSEA 1UCJA 1RN4A 1YGWA 1RTUA 2AAEA 1MGWA 1BNJA 1I3IA 2F4YA 1R4YA 1X1WA 6RNTA 3GSPA 1PYLA 1LNIA 1I2FA 1FYSA 2F5MA 1YNVX 1UCLA 1X1UA 3BU4A 1BNRA 1HYFA 1RGKA 1TTOA 1JBRA 1TRPA 1RGFA 3SYUA 3RNTA 1I70A 4BU4A 1GOUA 5RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RBI A;  1TRQ A;  1GOV A;  1BSA A;  1I0X A;  1A2P A;  1I8V A;  1BRN L;  1X1Y A;  7RNT A;  1UCI A;  1BNE A;  1AY7 A;  2KF4 A;  1I0V A;  1BAN A;  1BGS A;  1GMQ A;  2F56 A;  1B2X A;  1RMS A;  1DET A;  3Q3F A;  1I3F A;  1BNG A;  3WHO A;  1RCL A;  3DGY A;  1BRG A;  2KF6 A;  1G02 A;  4HAA A;  2KAA A;  1DE3 A;  3WR2 A;  1MGR A;  1ZGX A;  2SAR A;  1BSB A;  1LOY A;  1BRI A;  4GHO A;  1B20 A;  1BSD A;  2F5W A;  4J5K A;  1B2U A;  1BVI A;  1RLS A;  1IYY A;  1PY3 A;  1RSN A;  1BSC A;  2GSP A;  2BU4 A;  1RN1 A;  1BRK A;  1Q9E A;  1RGH A;  1JBT A;  1YVS A;  1FZU A;  1RNT A;  3DH2 A;  4BIR A;  1BNF A;  3AHW A;  1BRH A;  1B2Z A;  1HZ1 A;  5BU4 A;  1JBS A;  3D5I A;  2RNT A;  2KF3 A;  1FUS A;  1GMP A;  1GMR A;  1I2G A;  1C54 A;  1X1X A;  4RNT A;  4J5G A;  1SAR A;  1BOX A;  2HOH A;  7GSP A;  1RHL A;  1UCK A;  2BIR A;  1FUT A;  2C4B A;  1BIR A;  2KF5 A;  1GSP A;  5GSP A;  8RNT A;  1FW7 A;  5HOH A;  3KCH A;  1LOV A;  5BIR A;  1B2M A;  3BIR A;  1RGE A;  3D5G A;  1T2I A;  6GSP A;  1RGA A;  1RGG A;  1CH0 A;  3AGO A;  1BU4 A;  3AGN A;  3A5E A;  1B2S A;  1GOY A;  1BRJ A;  2AAD A;  3HOH A;  1B21 A;  3URP A;  1BRS A;  1BUJ A;  1AQZ A;  1B3S A;  3D4A A;  1T2H A;  1I2E A;  4GSP A;  1LOW A;  9RNT A;  1RGL A;  3AHS A;  1BAO A;  1BNS A;  1B27 A;  1LRA A;  1RCK A;  1RGC A;  1BNI A;  2ZA4 A;  1RNB A;  4HOH A;  1RDS A;  1BSE A;  1UCJ A;  1RN4 A;  1YGW A;  1RTU A;  2AAE A;  1MGW A;  1BNJ A;  1I3I A;  2F4Y A;  1R4Y A;  1X1W A;  6RNT A;  3GSP A;  1PYL A;  1LNI A;  1I2F A;  1FYS A;  2F5M A;  1YNV X;  1UCL A;  1X1U A;  3BU4 A;  1BNR A;  1HYF A;  1RGK A;  1TTO A;  1JBR A;  1TRP A;  1RGF A;  3SYU A;  3RNT A;  1I70 A;  4BU4 A;  1GOU A;  5RNT A; 
#chains in the Genus database with same CATH topology
 2C10 A;  2CFK A;  2UGI A;  3G8Z A;  1BSA A;  1I0X A;  4FCJ A;  3LT9 A;  4OK0 A;  1BRN L;  3I0Y A;  4LYL B;  1A90 A;  2P38 A;  2GEY A;  2H0H A;  4R80 A;  1UCI A;  3FH1 A;  1DMM A;  1TFK A;  1IQ8 A;  4LMI A;  1I0V A;  3NV0 B;  3MWZ A;  1DET A;  3LTC A;  3N8B A;  3SX1 A;  3NBB A;  3Q3F A;  1WMO A;  2BMQ B;  1IV7 A;  3DGY A;  5D83 A;  1VQ4 3;  3RGA A;  2KF6 A;  3CC2 3;  2KAA A;  3CPO A;  1YGE A;  4LZI A;  1VQP 3;  1QVG 2;  1N8R 4;  3ZFZ A;  1OF5 A;  2IYJ A;  4CJN A;  1BUQ A;  5KP4 A;  3OV4 A;  4JRF A;  1RSN A;  1BSC A;  2CWT A;  3LH4 A;  3X41 A;  5AIH A;  1RN1 A;  4K1U A;  1Q81 4;  3S29 A;  2YFJ B;  1C7H A;  3L0R A;  1GY7 A;  3DH2 A;  3V92 A;  1V57 A;  3ROB A;  3EBY A;  3GZR A;  3NX0 A;  1LOX A;  3AMO A;  4HM7 B;  3K63 A;  2YX9 A;  3PXM A;  5JPP A;  3TDG A;  3SXX A;  4EBG A;  4IIA A;  1NB3 I;  3GZY B;  2JQ5 A;  2IUK A;  2B24 B;  4KVH A;  1SII A;  2CFG A;  4N6U A;  4Q53 A;  4MMX B;  3PGB A;  1RRL A;  1FUT A;  3MYT A;  3UB1 A;  3RGR A;  1N9J A;  2CH9 A;  3V99 A;  3ZG0 A;  2D42 A;  3UJM A;  1FGT A;  1WMP A;  1K9M 4;  3M8C A;  1B2M A;  3T8N A;  4KFE A;  4XBX A;  1WTH A;  3OXA A;  1RGG A;  3IMA B;  3AGN A;  3NUV A;  3RDE A;  2WOH A;  2W0Q A;  4FMD A;  1JKG B;  3EHC A;  1BRS A;  2FXT A;  4IPB A;  1AQZ A;  1AV4 A;  3F8H A;  5IEP A;  4U13 A;  3T8U A;  1IQX A;  3GAX A;  3E99 A;  3MSO A;  4FR9 A;  1GY5 A;  1LOW A;  2RSX A;  3DM8 A;  4HM3 B;  1RKY A;  3Q1C A;  1IU7 A;  1QJG A;  1RCK A;  2PZV A;  3MG2 A;  3MG3 A;  1U5O A;  1RNB A;  3NV0 A;  4RBN A;  1W5Z A;  4O8S A;  1RRH A;  3EF8 A;  3SOA A;  3EE1 A;  3NXJ A;  5BVB A;  2AAE A;  1ZS7 A;  1IQY A;  1MWU A;  4WWU C;  2F4Y A;  2M7O A;  1LQM B;  1ULJ B;  2Z6B A;  2W9P A;  1PFP A;  3CMA 3;  3CD6 3;  3VSY A;  1E3V A;  1JB2 A;  4OUQ A;  4TX4 A;  2CWU A;  4N6O B;  1PYL A;  4HZB B;  1LVN A;  5HGR A;  2STD A;  3GZX B;  1HKX A;  2D1W A;  3BB9 A;  2WO0 A;  1K8A 4;  3FZW A;  4R1K A;  1GS3 A;  1Q86 4;  1NJI 4;  3ALA A;  3WMD A;  3FG3 A;  2CG1 A;  1L5G B;  1MOL A;  3UL6 A;  1LQG C;  3SYU A;  5I97 A;  2P0X A;  4G1M B;  5CF2 A;  4GL6 A;  1I70 A;  3MHE A;  4I4K A;  4NHF A;  5LC6 A;  4EV2 A;  4BU4 A;  1GOU A;  1LXE A;  4XDW A;  4R9L A;  3MKI A;  2JDI H;  4NPB A;  2QIY A;  3LTB A;  3CNM A;  5AII A;  3LML A;  3T0U A;  3S27 A;  3S28 A;  1O7P B;  2HMK B;  4XDV A;  5D81 A;  1TRQ A;  1CYV A;  1TFO A;  2Z7A A;  2IY2 A;  1MNL A;  1UW1 A;  2XRX B;  1FGM A;  4KZ1 A;  4NRE A;  7RNT A;  3WOD G;  2ZL8 A;  1O7M B;  3F7S A;  4BTW A;  3CCJ 3;  4R9K A;  3OWU A;  3BNE A;  1E3R A;  1UI8 A;  1RN7 A;  1K41 A;  3WHO A;  1Q42 A;  1BRG A;  3A76 A;  1G02 A;  2IA7 A;  5G1L A;  4XBT A;  1IK3 A;  3CCQ 3;  1DE3 A;  1UDI I;  3FF0 A;  5EEO A;  3WR2 A;  4RNY A;  4K1V A;  4RNZ A;  1LOY A;  5FW5 A;  1BRI A;  4GHO A;  1B20 A;  4DKI A;  3NQZ A;  1RLS A;  4EYC A;  2CG0 A;  3CC4 3;  1JKG A;  3FSD A;  1UI7 A;  2Z77 A;  2XH9 A;  4XM4 A;  1RNT A;  4XB5 A;  2K3D A;  3U1W A;  4H3U A;  1AVK A;  4HZ9 B;  2CX1 A;  1JBS A;  1BUJ A;  2CKF B;  4PEJ A;  2K0M A;  1FUS A;  1I2G A;  5STD A;  5CK6 A;  3S5C A;  1YIT 3;  1C54 A;  2WGQ A;  3D3L A;  3SLU A;  3Q2P A;  2O3O A;  4J5G A;  2W9Q A;  3X3Z A;  2HOH A;  3WA2 X;  2Z76 A;  5KP3 A;  5IG4 A;  5IG0 A;  1DVC A;  1M1X B;  4XBY A;  2K54 A;  7STD A;  4KFD A;  3QRD A;  4BTX A;  1GSP A;  4I5Q A;  2J8X B;  3GRD A;  4ILF A;  3KCH A;  4R4K A;  1V74 A;  3PCS A;  3LTA A;  2F98 A;  3F40 A;  3BIR A;  3D5G A;  4BL3 A;  5ELU A;  5IER A;  6GSP A;  3FCS B;  4X2H A;  1CH0 A;  5AEU B;  3GWR A;  4GB5 A;  1OHS A;  1W6Y A;  1A67 A;  3LZA A;  3A5E A;  1B2S A;  2P09 A;  3D9R A;  2IUJ A;  2HMO B;  4J9A A;  3URP A;  2WOF A;  1FA3 A;  3EQQ B;  3GZB A;  1CYU A;  3CCV 3;  1RJO A;  2MF7 A;  3B4P A;  1KD1 4;  1IVV A;  9RNT A;  2W56 A;  1KQS 2;  1LNH A;  1ZO2 A;  1S5A A;  3FGY A;  2ZA4 A;  3DZL A;  4HM2 B;  2R4I A;  1IVX A;  3K7C A;  1UCJ A;  2P05 A;  4MMY B;  1RN4 A;  1ROV A;  1RTU A;  3J7Y d;  3KSE D;  1I3I A;  3KKG A;  2BHM A;  5M1A A;  1Q7H A;  1DMQ A;  4RZM A;  6RNT A;  4L7K A;  3FG1 A;  5JBS A;  1D6U A;  2OTJ 3;  3UL5 A;  4LEH A;  1I2F A;  2O9U X;  1Q7Y 4;  2PNC A;  3PS8 A;  4HM1 B;  1W4N A;  3U97 A;  1N8Q A;  3B4O A;  2L1S A;  2OOV A;  1GYB A;  2BNG A;  2SBL A;  1W01 A;  4N6T A;  1Q82 4;  5AI1 A;  1TUH A;  1HU9 A;  4FMB A;  1Q40 A;  2YFI B;  1EKM A;  4CCV A;  3IJE B;  2GU3 A;  1K73 4;  1WNH A;  3DGM A;  3OX9 A;  3CCS 3;  2QA4 3;  4X2O A;  1GD4 A;  1GOV A;  1ASK A;  1EG9 B;  3KE7 A;  4MMZ B;  3X3Y A;  1VQ8 3;  2GU1 A;  2L4V A;  1VQL 3;  1X1Y A;  5FGO A;  1NDO B;  4STD A;  1VQ6 3;  3NBR A;  2OQE C;  1EEJ A;  1AY7 A;  2KF4 A;  3K9M C;  1VQ5 3;  1BAN A;  3KSP A;  1BGS A;  1GMQ A;  3QK9 A;  1RMS A;  3UNL A;  2CWV A;  2H0G A;  4EXR A;  1FGQ A;  2F99 A;  1I3F A;  2E2V A;  3B7C A;  1J2B A;  1OHP A;  1W02 A;  3SOY A;  1M9G A;  1IDP A;  3H3H A;  2XFS A;  3NM2 A;  4HYZ A;  2XGL A;  2SAR A;  2XEP A;  1N5P A;  1FUW A;  1VQ7 3;  3BNB A;  1QMA A;  3OWS A;  4WYK A;  5TGN A;  4BL2 A;  3CXC 2;  3X3X A;  3CCE 3;  3CCM 3;  1IYY A;  1PY3 A;  4EV5 A;  4N6M A;  1BRK A;  3FKA A;  3G4S 3;  3IPT A;  1FGR A;  3HK4 A;  1UUG B;  1W6G A;  3F7X A;  5M19 A;  1SJW A;  4HKV B;  4BIR A;  2XGN A;  3OWY A;  2W56 B;  4ZM8 A;  2XF3 A;  1BNF A;  3AHW A;  1OPY A;  1YI2 3;  1QAF A;  1YVB I;  3X40 A;  5BU4 A;  5IG5 A;  3D5I A;  3HII A;  1GMP A;  1GMR A;  5DRE A;  3WDG B;  3LT8 A;  2RCD A;  3LYG A;  4IT7 A;  1YHQ 3;  2P0M A;  4HM0 B;  1VQN 3;  1IV9 A;  4KFF A;  3JUP A;  4RNT A;  1SAR A;  2BMR B;  4KT3 B;  5AYS C;  3HIG A;  7GSP A;  1RHL A;  5EQL A;  1Z1S A;  1TIJ A;  4FMA A;  2C4B A;  1ZX2 A;  4HM4 B;  2W04 A;  5IEN A;  1UGH I;  3MPH A;  4OVM A;  5GSP A;  3WOE B;  8RNT A;  5HOH A;  1W6C A;  2HMN B;  3FLJ A;  3OW2 2;  4MJD A;  1LOV A;  2IMJ A;  4AKY A;  3K5T A;  1KWI A;  1RGE A;  1KSI A;  1WQL B;  2ZHX B;  3NM7 A;  1OGZ A;  2UUG C;  1Q40 B;  1W2B 2;  1JN5 A;  3DY5 A;  1G96 A;  4WFO A;  3JUM A;  2HMM B;  1NO3 A;  1O7H B;  1STD A;  1TP6 A;  1WMN A;  1BRJ A;  3HOH A;  1VQ9 3;  4FCZ A;  3CC7 3;  1SQW A;  1Y4K A;  4O02 B;  1N5H A;  3VGN A;  1DMN A;  3D4A A;  6STD A;  1OCV A;  1R4C A;  2CC3 A;  2HML B;  3LTD A;  1I2E A;  3PCR A;  4HJL B;  4L8O A;  4GSP A;  4BTY A;  1JZD A;  1RGL A;  4QWT A;  1BNS A;  5LC7 A;  2CHC A;  2CW9 A;  2FNQ A;  1RGC A;  2CFW A;  1BNI A;  3JUN A;  2Y73 A;  1D6Z A;  3CCU 3;  4N6N B;  5CLK A;  1CQS A;  2I9W A;  1BSE A;  1NU3 A;  3EN8 A;  3JVC A;  1UUV B;  4CDL A;  1IT7 A;  1YJW 3;  1MWS A;  1QAK A;  3STD A;  3I55 3;  2C11 A;  1O7W B;  2OOV C;  3H51 A;  1OAC A;  3K0Z A;  1SPU A;  3EX9 A;  3GSP A;  4WYK B;  5ELJ A;  2ZDJ A;  3G16 A;  1LNI A;  2V1L A;  3MG1 A;  1EUI C;  1T3B A;  2UX0 A;  1UCL A;  1X1U A;  3BU4 A;  1HYF A;  1RGK A;  2F86 B;  1M1K 4;  1JBR A;  1RGF A;  1VQM 3;  3RNT A;  3G0K A;  5RNT A;  1F8N A;  5G1K A;  5JPU A;  3KFQ C;  2H0I A;  2LYX A;  2RGQ A;  1UGI A;  4EW5 A;  2RBI A;  3NHX A;  1A2P A;  1I8V A;  3O8Y A;  2XFT A;  3CCL 3;  5AIG A;  1BNE A;  3EB8 A;  1OUN A;  3BNC A;  5IEO A;  3WOF B;  1DYU A;  4FCM A;  5CXO A;  2F56 A;  4HM6 B;  1B2X A;  2INX A;  4WHA A;  1M90 4;  1GY6 A;  1BNG A;  5IF6 A;  1RCL A;  2QEX 3;  2OWP A;  2CK3 H;  3ER7 A;  1E97 A;  3G6E 3;  5AIF A;  3PYJ A;  4HAA A;  1YJ9 3;  4MEI A;  1MGR A;  1ZGX A;  1O7N B;  3F9S A;  1JN5 B;  1O7G B;  1BSB A;  1OGX A;  2BMO B;  3FG4 A;  3SED A;  2BT3 A;  4WP5 A;  3KN4 A;  3PZW A;  1BSD A;  3KZT A;  2F5W A;  5BXQ A;  4J5K A;  1B2U A;  1BVI A;  4AEQ A;  4O3V A;  5KP1 A;  1IVW A;  2A15 A;  2GSP A;  4N3V A;  2BU4 A;  2CX0 A;  3NQY A;  1Q9E A;  1RGH A;  1US1 A;  1U8C B;  2KCD A;  2E2U A;  3F14 A;  1MWR A;  3JUQ A;  1JBT A;  1YVS A;  2XR8 B;  1FZU A;  3BLZ A;  2ML6 A;  3CME 3;  3B8L A;  1BRH A;  1ROA A;  1B2Z A;  1TU5 A;  1HZ1 A;  1IT8 A;  3DXO A;  1W00 A;  2RNT A;  1AR0 A;  1N9E A;  2KF3 A;  3DGO A;  3JUO A;  3G71 3;  1YIJ 3;  4K61 A;  3ZG5 A;  1JV2 B;  4N6L A;  1X1X A;  3V98 A;  2GEX A;  4K90 B;  1BOX A;  3VF1 A;  1JNQ A;  5A0O B;  2KRT A;  2BO9 B;  3CU3 A;  5AEW B;  2GXF A;  4AKZ A;  1IVU A;  1UCK A;  3EBT A;  2QGU A;  2CIU A;  2BIR A;  4HVN A;  1NWW A;  1BIR A;  1W2Z A;  1MWT A;  1YJN 3;  2FGT A;  2YFL B;  2KF5 A;  2ML5 A;  1EQK A;  2GBW B;  1OH0 A;  2B1X B;  2W03 A;  3HI7 A;  3LOY A;  2HMJ B;  1FW7 A;  2MC8 A;  1STF I;  1T5Y A;  5BIR A;  1CEW I;  1VQQ A;  4LGQ A;  3CCR 3;  3EC9 A;  5AYR B;  1NB5 I;  1DVD A;  1T2I A;  2OCT A;  1OF5 B;  2XSO B;  3CPW 2;  2CFL A;  3CNX A;  1G0T A;  1RGA A;  3AGO A;  3WA3 A;  5M18 A;  1BU4 A;  3DGL A;  4HM5 B;  5G2G A;  1KC8 4;  1QAL A;  2R41 A;  1GOY A;  3HX8 A;  2AAD A;  3N9H A;  1B21 A;  4ORL A;  1A2V A;  1D6Y A;  3DUK A;  3X42 A;  1EA2 A;  1B3S A;  3KII A;  2XSH B;  8CHO A;  5IW9 A;  1VQK 3;  3Q90 A;  5DRV A;  1T2H A;  3AMO B;  1FGO A;  2W2C A;  2OTL 3;  1OHO A;  4J8T A;  2GBX B;  2Y74 A;  1BAO A;  3AHS A;  4H61 A;  3HZP A;  1QVF 2;  1B27 A;  1K28 A;  1LRA A;  3DMC A;  3EJV A;  1PU4 A;  1W7C A;  4O2H A;  3I56 3;  5CF1 A;  1JRQ A;  1TJD A;  2E2T A;  1RDS A;  3BND A;  4HBR A;  4HOH A;  1ULI B;  1YGW A;  1NNV A;  2Q07 A;  3F8X A;  1JJ2 2;  1MGW A;  1BNJ A;  1JB5 A;  3SVA A;  4JF8 A;  4LSO A;  1R4Y A;  5D82 A;  4EC6 A;  1X1W A;  1A2K A;  1VZZ A;  4L8P A;  2CFD A;  1SIH A;  1GD3 A;  1UUW B;  3N54 B;  3NBJ A;  1ISK A;  2WGO A;  1AVL A;  1FYS A;  1JB4 A;  1V58 A;  2F5M A;  1YNV X;  4FMC A;  5EVH A;  2LQV A;  1VQO 3;  1BNR A;  3DGN A;  3ECF A;  3EN1 B;  1TTO A;  2KXG A;  1TRP A;  2OQE A;  4N6V 0;  1S72 3;  1JZO A;  3D79 A;  4HM8 B;  3S67 A;  3LXU X;  5IG3 A;  2W6J H;  3FF2 A;  2RFR A;  4CPK A; 
#chains in the Genus database with same CATH homology
 2RBI A;  1TRQ A;  1GOV A;  1BSA A;  1I0X A;  1A2P A;  1I8V A;  1BRN L;  1X1Y A;  7RNT A;  1UCI A;  1BNE A;  1AY7 A;  2KF4 A;  1I0V A;  1BAN A;  1BGS A;  1GMQ A;  2F56 A;  1B2X A;  1RMS A;  1DET A;  3Q3F A;  1I3F A;  1BNG A;  3WHO A;  1RCL A;  3DGY A;  1BRG A;  2KF6 A;  1G02 A;  4HAA A;  2KAA A;  1DE3 A;  3WR2 A;  1MGR A;  1ZGX A;  2SAR A;  1BSB A;  1LOY A;  1BRI A;  4GHO A;  1B20 A;  1BSD A;  2F5W A;  4J5K A;  1B2U A;  1BVI A;  1RLS A;  1IYY A;  1PY3 A;  1RSN A;  1BSC A;  2GSP A;  2BU4 A;  1RN1 A;  1BRK A;  1Q9E A;  1RGH A;  1JBT A;  1YVS A;  1FZU A;  1RNT A;  3DH2 A;  4BIR A;  1BNF A;  3AHW A;  1BRH A;  1B2Z A;  1HZ1 A;  5BU4 A;  1JBS A;  3D5I A;  2RNT A;  2KF3 A;  1FUS A;  1GMP A;  1GMR A;  1I2G A;  1C54 A;  1X1X A;  4RNT A;  4J5G A;  1SAR A;  1BOX A;  2HOH A;  7GSP A;  1RHL A;  1UCK A;  2BIR A;  1FUT A;  2C4B A;  1BIR A;  2KF5 A;  1GSP A;  5GSP A;  8RNT A;  1FW7 A;  5HOH A;  3KCH A;  1LOV A;  5BIR A;  1B2M A;  3BIR A;  1RGE A;  3D5G A;  1T2I A;  6GSP A;  1RGA A;  1RGG A;  1CH0 A;  3AGO A;  1BU4 A;  3AGN A;  3A5E A;  1B2S A;  1GOY A;  1BRJ A;  2AAD A;  3HOH A;  1B21 A;  3URP A;  1BRS A;  1BUJ A;  1AQZ A;  1B3S A;  3D4A A;  1T2H A;  1I2E A;  4GSP A;  1LOW A;  9RNT A;  1RGL A;  3AHS A;  1BAO A;  1BNS A;  1B27 A;  1LRA A;  1RCK A;  1RGC A;  1BNI A;  2ZA4 A;  1RNB A;  4HOH A;  1RDS A;  1BSE A;  1UCJ A;  1RN4 A;  1YGW A;  1RTU A;  2AAE A;  1MGW A;  1BNJ A;  1I3I A;  2F4Y A;  1R4Y A;  1X1W A;  6RNT A;  3GSP A;  1PYL A;  1LNI A;  1I2F A;  1FYS A;  2F5M A;  1YNV X;  1UCL A;  1X1U A;  3BU4 A;  1BNR A;  1HYF A;  1RGK A;  1TTO A;  1JBR A;  1TRP A;  1RGF A;  3SYU A;  3RNT A;  1I70 A;  4BU4 A;  1GOU A;  5RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...