9RNTA

Ribonuclease t1 with free recognition and catalytic site: crystal structure analysis at 1.5 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribonuclease T1 with free recognition and catalytic site: crystal structure analysis at 1.5 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 9rntA00
2F5WA 1BAOA 1UCIA 1BNJA 1FYSA 1MGRA 1RGHA 1DETA 2SARA 1GOUA 1GSPA 2C4BA 1YGWA 1LNIA 1BRSA 3KCHA 1RNTA 1RDSA 1RGEA 2F56A 1RGCA 2AAEA 6RNTA 1BNGA 1HYFA 2KF3A 1I2EA 1RNBA 3D4AA 1LOYA 4HAAA 4BIRA 1LOWA 1X1XA 1BRIA 4GHOA 1B20A 1BRJA 1B21A 1BVIA 1PYLA 2KF5A 1BRGA 5HOHA 3AGOA 1BOXA 1BNSA 1T2IA 4HOHA 1X1YA 1B27A 5RNTA 1GMRA 1I70A 1RSNA 8RNTA 1HZ1A 1I0VA 4RNTA 1B2SA 1RGAA 6GSPA 1LRAA 1BRHA 4J5KA 1FZUA 5BU4A 1I3IA 1GOYA 1BSBA 3WR2A 1TRQA 1RGGA 1RTUA 1RHLA 3DGYA 1BANA 1BNEA 1I2FA 2HOHA 1BSAA 1AQZA 1I8VA 2AADA 1G02A 1GOVA 3AGNA 1JBTA 1CH0A 9RNTA 3D5GA 4J5GA 1YNVX 5GSPA 2RBIA 1BRKA 2BIRA 3GSPA 1MGWA 1C54A 4GSPA 1RN4A 1BSDA 2KF6A 1RGFA 3SYUA 1RN1A 1I2GA 1UCJA 2F5MA 1PY3A 1BIRA 5BIRA 1GMPA 1B2MA 7RNTA 1LOVA 1X1UA 2KAAA 1B2UA 3AHSA 3URPA 1BRNL 1X1WA 1RCLA 1Q9EA 1BSEA 1FUTA 4BU4A 1GMQA 2BU4A 2KF4A 1RCKA 1BU4A 2ZA4A 1SARA 1UCLA 2GSPA 3A5EA 3D5IA 1JBRA 1RMSA 3Q3FA 1YVSA 1TTOA 1BNIA 1B2ZA 1BNRA 1RGKA 3AHWA 3DH2A 1BUJA 1I0XA 1B3SA 1FUSA 1BSCA 1UCKA 1B2XA 3HOHA 1DE3A 1A2PA 3BU4A 1TRPA 2RNTA 7GSPA 1JBSA 1ZGXA 1R4YA 1IYYA 3BIRA 1AY7A 2F4YA 3WHOA 1FW7A 1I3FA 1BGSA 3RNTA 1RGLA 1T2HA 1BNFA 1RLSA
chains in the Genus database with same CATH superfamily
3EN1B 1ZS7A 1MWTA 1UUVB 4I5QA 1TP6A 3G16A 4IPBA 1O7GB 4O8SA 3PZWA 2HMNB 4HM5B 1FYSA 5IEOA 4BTXA 1GOUA 3MYTA 1YIJ3 2CX1A 1OH0A 2H0HA 1YGWA 3MHEA 4K1UA 3KFQC 1AVLA 3F8XA 2F98A 3K63A 4FCMA 1TU5A 1K28A 4XBXA 1GYBA 1RGEA 1GY7A 1RGCA 2AAEA 5LC7A 5CF2A 2KF3A 3OW22 2IMJA 3D4AA 3G6E3 1YJW3 3CC43 1W7CA 4BIRA 1VQK3 2ML5A 3S5CA 4WHAA 2JQ5A 1DMNA 3DGLA 4N6NB 2OCTA 4RZMA 5D81A 1OF5B 1UDII 2Y73A 3X40A 1O7NB 1BRGA 5HOHA 2GEXA 1BOXA 1D6YA 1STFI 1X1YA 5RNTA 2GXFA 1HZ1A 1T3BA 2GEYA 3LXUX 3G0KA 3UNLA 3PCRA 4N6MA 3RGAA 4GL6A 3K9MC 3BNBA 1F8NA 4FMAA 4XDVA 5DRVA 2CG1A 3B4OA 4FCZA 4HM8B 4STDA 1BRHA 4U13A 1FZUA 3SVAA 3T0UA 1I3IA 1WMPA 3X41A 4HBRA 1GOYA 1MWSA 1TRQA 1UUGB 8CHOA 3NHXA 1ZO2A 2FXTA 3M8CA 1BANA 4J8TA 5KP3A 1W6CA 1M1XB 3K0ZA 5JPPA 3FCSB 2HOHA 2CFWA 5D83A 5FW5A 1EQKA 2MF7A 1AQZA 2C11A 3S29A 3K7CA 2CIUA 1DYUA 3I0YA 4IT7A 1BUQA 2GU3A 3EN8A 2HMKB 2OQEC 2QIYA 3D5GA 4JRFA 4WWUC 1JKGB 5GSPA 2E2TA 4NHFA 1BRKA 1RJOA 1SIHA 1LOXA 3CC23 2P09A 2ZHXB 1C54A 2O9UX 3WODG 1OCVA 3N9HA 1M1K4 3DY5A 5IEPA 2BT3A 1CQSA 3MKIA 2JDIH 1RN1A 1I2GA 1UCJA 2F5MA 1MOLA 2K0MA 3DZLA 3NBJA 1VQM3 1GMPA 1B2MA 5I97A 7RNTA 1LOVA 1LVNA 3GZRA 3V98A 1GS3A 3F7SA 1RCLA 1Q9EA 1S5AA 1D6UA 4QWTA 3UJMA 1U8CB 6STDA 1Q864 4KT3B 4KFDA 3V99A 1W5ZA 2BU4A 2V1LA 1BU4A 3MWZA 2QGUA 3CCL3 1HKXA 4H3UA 3S28A 2BO9B 4N6LA 2OTJ3 1JBRA 1S723 1NDOB 5A0OB 1GY5A 1NNVA 4ILFA 3U97A 5G1LA 3AMOA 3CPOA 5BXQA 4AKZA 1UW1A 3EJVA 1N8QA 3RGRA 5M18A 1BSCA 1DE3A 3X3XA 2XH9A 1V57A 5IW9A 1A2PA 2IYJA 2RNTA 1R4CA 1JBSA 1TFOA 1JNQA 3HZPA 1R4YA 1IV7A 3Q90A 3GZYB 4FR9A 3F9SA 2HMJB 1I3FA 3PGBA 1FW7A 1NO3A 1BGSA 3RNTA 3SEDA 4HM0B 4PEJA 1BNFA 1GD3A 1JB2A 2LQVA 3FGYA 3IPTA 4HM3B 5EEOA 3D79A 2IUJA 1W00A 2F5WA 3EHCA 3ALAA 4EW5A 2OTL3 4X2OA 3FG1A 5CLKA 2W04A 1WQLB 1GSPA 1W2ZA 2MC8A 2XEPA 1SJWA 3ZG0A 4EBGA 5BVBA 1VQL3 3S67A 1C7HA 1Q40A 1O7WB 1UI7A 1LNIA 4HJLB 1JZOA 3LZAA 1BRSA 1MWRA 3KCHA 4KZ1A 1EA2A 2UUGC 4R9LA 3WA3A 1DMQA 3F14A 1TUHA 1BNGA 1HYFA 1RNBA 1I2EA 2Z6BA 1LOYA 3WOEB 2CFDA 4MMZB 1LOWA 2XRXB 1BRIA 3DGMA 5ELJA 1AV4A 4GHOA 1B20A 1PYLA 2KF5A 2W2CA 1M9GA 1BNSA 1IVXA 1JN5B 1ZX2A 1QMAA 2E2VA 1Y4KA 2PNCA 4HOHA 1VQN3 1IVVA 1GMRA 3Q1CA 4WFOA 4BTWA 3B8LA 2P38A 1ULJB 2A15A 2YX9A 4KVHA 1HU9A 3HK4A 1B2SA 1M904 1WMOA 2L4VA 4AEQA 1IVUA 3T8NA 4DKIA 4CJNA 2BMRB 1VQ43 4N6OB 4MEIA 1FUWA 2CX0A 1DVCA 1ROAA 1OGXA 3CNXA 3DGYA 3EE1A 1VZZA 1BNEA 3KKGA 3GRDA 4RNYA 5M19A 3CCJ3 3NV0B 2RCDA 3OXAA 1N5PA 1V74A 2HMLB 3EBTA 3GZBA 1JB4A 1Q824 5IENA 4CDLA 4EV5A 2AADA 2SBLA 3TDGA 1GOVA 2W03A 4LYLB 1CH0A 3N8BA 2CH9A 2XFTA 1VQO3 3QK9A 2BIRA 3GSPA 3CC73 2O3OA 1UGIA 3GWRA 1U5OA 3LMLA 1IQ8A 2HMMB 1RN4A 1BSDA 3FSDA 3CCU3 1QVF2 3DMCA 1UGHI 3E99A 1TJDA 1E3VA 4NPBA 2OOVC 5IG3A 3HX8A 2CHCA 1VQ73 2E2UA 4LMIA 4ORLA 2KAAA 1MNLA 1FGOA 2LYXA 3FLJA 3KE7A 4FMBA 1RRLA 1BRNL 3MPHA 3DM8A 2IY2A 5EQLA 1FUTA 4L7KA 3VGNA 1IQYA 1UI8A 1T5YA 4MMXB 2CKFB 3X3YA 4WP5A 1WTHA 4XBTA 5AIIA 2GSPA 1LXEA 1YHQ3 1RMSA 2OQEA 3Q3FA 4TX4A 3CCE3 1J2BA 1BNRA 1YVBI 3JUPA 5LC6A 1KQS2 5IG0A 2PZVA 5TGNA 1I0XA 3JUMA 1NB5I 4KFFA 5HGRA 1SPUA 1W4NA 2IA7A 1B2XA 1W01A 3F8HA 2L1SA 2OWPA 4N6V0 2B24B 2CG0A 1ASKA 5M1AA 2C10A 3K5TA 1YI23 2WGQA 3OWUA 2Z77A 3WA2X 2H0IA 3OX9A 2CW9A 3WMDA 1IDPA 4HZ9B 7STDA 3ZG5A 1RN7A 3V92A 1W02A 2KXGA 3VF1A 4BTYA 1VQ93 1T2HA 1FGMA 1A2VA 5IG4A 4LGQA 2XF3A 3KZTA 1QAKA 3NBBA 3A76A 2I9WA 2RFRA 1MGRA 2SARA 3BLZA 3PCSA 3SLUA 2C4BA 3F7XA 3KIIA 3PXMA 3S27A 1ISKA 3NV0A 3JUNA 4AKYA 1IV9A 5CF1A 1RKYA 1LQGC 2D42A 1E3RA 3FKAA 2F56A 1NB3I 2P0XA 3SOAA 3MG1A 6RNTA 1W6GA 1VQP3 2YFJB 1N8R4 3BNCA 3FF0A 5CXOA 3VSYA 1JZDA 3CCM3 3FG4A 2F86B 3MG2A 4L8PA 3CXC2 4N6UA 1B21A 1BVIA 2BNGA 2K3DA 4R4KA 4XBYA 3U1WA 4K61A 3AGOA 4HVNA 1T2IA 1FGRA 2XR8B 1B27A 2XFSA 3KSED 1IT8A 2M7OA 3NM2A 3I553 4OK0A 1I0VA 2XGNA 1OGZA 2BMQB 5JPUA 1Q42A 1QJGA 2HMOB 5ELUA 3GZXB 1N9JA 3JVCA 2WGOA 4HYZA 5AIGA 1YIT3 1WMNA 4XDWA 6GSPA 1JJ22 4J5KA 1WNHA 3X42A 1CEWI 3OV4A 3CU3A 1US1A 3G713 4HM4B 1RGGA 1RTUA 2UGIA 3CCQ3 4HZBB 5FGOA 3HIGA 1KC84 3WOFB 5AIFA 2R41A 5G1KA 1I2FA 1EKMA 1JV2B 2GBWB 1BSAA 5KP1A 3H51A 1DMMA 1LNHA 4LZIA 1IT7A 1I8VA 1KWIA 3F40A 4LSOA 4WYKB 1FGQA 4O2HA 1OHSA 2W6JH 9RNTA 1OHPA 3NX0A 4KFEA 1YNVX 3LH4A 3FH1A 2RBIA 1UUWB 1CYUA 3EF8A 2D1WA 2KF6A 1RGFA 3SYUA 1Q7HA 2STDA 1PY3A 5AI1A 5AEUB 1BIRA 1OACA 5BIRA 3H3HA 1K734 4HM6B 2XGLA 2P05A 3MSOA 3NUVA 2INXA 1B2UA 4CCVA 1DVDA 3EB8A 4L8OA 1K8A4 1JKGA 3EX9A 3URPA 1X1WA 4X2HA 5AEWB 4J9AA 1EUIC 1BSEA 3OWYA 4HM7B 1GMQA 1W6YA 4O02B 2W9PA 4H61A 5EVHA 4FMCA 5IF6A 1SIIA 4HKVB 3J7Yd 2ZA4A 4NREA 1SARA 5JBSA 1UCLA 1OPYA 3UL5A 3D5IA 2W56B 4WYKA 4XM4A 2WO0A 1YVSA 4BL2A 3FG3A 1MWUA 1B2ZA 4R80A 3IMAB 2RSXA 1RGKA 3AHWA 1AR0A 3DH2A 1L5GB 1SQWA 3QRDA 1KSIA 2GBXB 1YJ93 1QVG2 1CYVA 2R4IA 1EG9B 1E97A 1OF5A 1ROVA 1UCKA 1Q40B 3DXOA 2J8XB 2ML6A 3KN4A 1FA3A 2CFKA 3D9RA 2BMOB 1TRPA 7GSPA 1VQ63 2H0GA 1O7MB 4OUQA 3CCR3 3WHOA 1VQ83 2XSHB 1QALA 3BNEA 4MJDA 2CWUA 1TFKA 4N6TA 4N3VA 3T8UA 1OUNA 2CFGA 4GSPA 5DREA 1ULIB 4CPKA 2IUKA 1BAOA 1QAFA 1UCIA 1PU4A 3CPW2 1BNJA 1RGHA 4R1KA 1DETA 2K54A 2KRTA 5AIHA 1G96A 3Q2PA 3G8ZA 2RGQA 3EQQB 1O7HB 1Q814 4GB5A 3LTBA 5CK6A 3SOYA 1RNTA 4HM1B 1FGTA 1RDSA 3JUQA 2Z7AA 2CK3H 3CNMA 2WOFA 4XB5A 4OVMA 4HAAA 1OHOA 2CFLA 3SX1A 3NQZA 4EYCA 3I563 1X1XA 2QA43 2YFIB 3LTAA 1BRJA 3MG3A 3BNDA 2Q07A 3NQYA 3D3LA 3CCV3 3NBRA 3LT8A 4G1MB 4RNZA 3B7CA 4I4KA 1I70A 1RSNA 2CWTA 5G2GA 2W0QA 4RNTA 3GAXA 8RNTA 1AVKA 3O8YA 1K9M4 1A67A 3LTDA 1NWWA 4RBNA 5KP4A 1RGAA 1LRAA 1N9EA 2UX0A 5STDA 5BU4A 2KCDA 3IJEB 5AYSC 3X3ZA 1BSBA 3WR2A 3CD63 3CME3 1RHLA 4LEHA 3ZFZA 1JN5A 1GD4A 3LT9A 1JRQA 3LYGA 1RRHA 3HIIA 3UL6A 1N5HA 3JUOA 5IG5A 1JB5A 2FNQA 1G02A 3HI7A 2CWVA 2XSOB 3AGNA 1JBTA 1VQ53 2F99A 2FGTA 1PFPA 1EEJA 2ZDJA 3L0RA 1YJN3 4ZM8A 4J5GA 4K90B 4EXRA 1MGWA 2W9QA 1LQMB 1IVWA 2Z76A 3DUKA 2CC3A 1NU3A 1VQQA 2QEX3 2OOVA 3UB1A 1STDA 3SXXA 3AMOB 3DGNA 3PYJA 5IERA 1V58A 4O3VA 3G4S3 1YGEA 4EV2A 1W2B2 4K1VA 3WDGB 4BL3A 3LOYA 1X1UA 3OWSA 1K41A 3FF2A 3AHSA 3RDEA 3NXJA 5D82A 4FCJA 3CMA3 4BU4A 3B4PA 1Z1SA 4HM2B 1NJI4 1O7PB 3LTCA 4MMYB 2KF4A 1RCKA 4R9KA 1IK3A 3ROBA 5AYRB 3A5EA 1GY6A 1A2KA 4Q53A 3ER7A 2WOHA 1TTOA 3STDA 1BNIA 1A90A 2B1XB 1BUJA 1IQXA 1TIJA 4EC6A 4FMDA 2YFLB 3BB9A 2GU1A 1G0TA 1B3SA 1FUSA 1Q7Y4 3HOHA 3NM7A 1KD14 3EBYA 3BU4A 1D6ZA 1ZGXA 3EC9A 1IU7A 1IYYA 3N54B 3CCS3 3BIRA 1AY7A 2F4YA 2P0MA 2W56A 2BHMA 3PS8A 4JF8A 2Y74A 3FZWA 3KSPA 1RGLA 4IIAA 3ECFA 3DGOA 2ZL8A 1RLSA
chains in the Genus database with same CATH topology
2F5WA 1BAOA 1UCIA 1BNJA 1FYSA 1MGRA 1RGHA 1DETA 2SARA 1GOUA 1GSPA 2C4BA 1YGWA 1LNIA 1BRSA 3KCHA 1RNTA 1RDSA 1RGEA 2F56A 1RGCA 2AAEA 6RNTA 1BNGA 1HYFA 2KF3A 1I2EA 1RNBA 3D4AA 1LOYA 4HAAA 4BIRA 1LOWA 1X1XA 1BRIA 4GHOA 1B20A 1BRJA 1B21A 1BVIA 1PYLA 2KF5A 1BRGA 5HOHA 3AGOA 1BOXA 1BNSA 1T2IA 4HOHA 1X1YA 1B27A 5RNTA 1GMRA 1I70A 1RSNA 8RNTA 1HZ1A 1I0VA 4RNTA 1B2SA 1RGAA 6GSPA 1LRAA 1BRHA 4J5KA 1FZUA 5BU4A 1I3IA 1GOYA 1BSBA 3WR2A 1TRQA 1RGGA 1RTUA 1RHLA 3DGYA 1BANA 1BNEA 1I2FA 2HOHA 1BSAA 1AQZA 1I8VA 2AADA 1G02A 1GOVA 3AGNA 1JBTA 1CH0A 9RNTA 3D5GA 4J5GA 1YNVX 5GSPA 2RBIA 1BRKA 2BIRA 3GSPA 1MGWA 1C54A 4GSPA 1RN4A 1BSDA 2KF6A 1RGFA 3SYUA 1RN1A 1I2GA 1UCJA 2F5MA 1PY3A 1BIRA 5BIRA 1GMPA 1B2MA 7RNTA 1LOVA 1X1UA 2KAAA 1B2UA 3AHSA 3URPA 1BRNL 1X1WA 1RCLA 1Q9EA 1BSEA 1FUTA 4BU4A 1GMQA 2BU4A 2KF4A 1RCKA 1BU4A 2ZA4A 1SARA 1UCLA 2GSPA 3A5EA 3D5IA 1JBRA 1RMSA 3Q3FA 1YVSA 1TTOA 1BNIA 1B2ZA 1BNRA 1RGKA 3AHWA 3DH2A 1BUJA 1I0XA 1B3SA 1FUSA 1BSCA 1UCKA 1B2XA 3HOHA 1DE3A 1A2PA 3BU4A 1TRPA 2RNTA 7GSPA 1JBSA 1ZGXA 1R4YA 1IYYA 3BIRA 1AY7A 2F4YA 3WHOA 1FW7A 1I3FA 1BGSA 3RNTA 1RGLA 1T2HA 1BNFA 1RLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5W A;  1BAO A;  1UCI A;  1BNJ A;  1FYS A;  1MGR A;  1RGH A;  1DET A;  2SAR A;  1GOU A;  1GSP A;  2C4B A;  1YGW A;  1LNI A;  1BRS A;  3KCH A;  1RNT A;  1RDS A;  1RGE A;  2F56 A;  1RGC A;  2AAE A;  6RNT A;  1BNG A;  1HYF A;  2KF3 A;  1I2E A;  1RNB A;  3D4A A;  1LOY A;  4HAA A;  4BIR A;  1LOW A;  1X1X A;  1BRI A;  4GHO A;  1B20 A;  1BRJ A;  1B21 A;  1BVI A;  1PYL A;  2KF5 A;  1BRG A;  5HOH A;  3AGO A;  1BOX A;  1BNS A;  1T2I A;  4HOH A;  1X1Y A;  1B27 A;  5RNT A;  1GMR A;  1I70 A;  1RSN A;  8RNT A;  1HZ1 A;  1I0V A;  4RNT A;  1B2S A;  1RGA A;  6GSP A;  1LRA A;  1BRH A;  4J5K A;  1FZU A;  5BU4 A;  1I3I A;  1GOY A;  1BSB A;  3WR2 A;  1TRQ A;  1RGG A;  1RTU A;  1RHL A;  3DGY A;  1BAN A;  1BNE A;  1I2F A;  2HOH A;  1BSA A;  1AQZ A;  1I8V A;  2AAD A;  1G02 A;  1GOV A;  3AGN A;  1JBT A;  1CH0 A;  9RNT A;  3D5G A;  4J5G A;  1YNV X;  5GSP A;  2RBI A;  1BRK A;  2BIR A;  3GSP A;  1MGW A;  1C54 A;  4GSP A;  1RN4 A;  1BSD A;  2KF6 A;  1RGF A;  3SYU A;  1RN1 A;  1I2G A;  1UCJ A;  2F5M A;  1PY3 A;  1BIR A;  5BIR A;  1GMP A;  1B2M A;  7RNT A;  1LOV A;  1X1U A;  2KAA A;  1B2U A;  3AHS A;  3URP A;  1BRN L;  1X1W A;  1RCL A;  1Q9E A;  1BSE A;  1FUT A;  4BU4 A;  1GMQ A;  2BU4 A;  2KF4 A;  1RCK A;  1BU4 A;  2ZA4 A;  1SAR A;  1UCL A;  2GSP A;  3A5E A;  3D5I A;  1JBR A;  1RMS A;  3Q3F A;  1YVS A;  1TTO A;  1BNI A;  1B2Z A;  1BNR A;  1RGK A;  3AHW A;  3DH2 A;  1BUJ A;  1I0X A;  1B3S A;  1FUS A;  1BSC A;  1UCK A;  1B2X A;  3HOH A;  1DE3 A;  1A2P A;  3BU4 A;  1TRP A;  2RNT A;  7GSP A;  1JBS A;  1ZGX A;  1R4Y A;  1IYY A;  3BIR A;  1AY7 A;  2F4Y A;  3WHO A;  1FW7 A;  1I3F A;  1BGS A;  3RNT A;  1RGL A;  1T2H A;  1BNF A;  1RLS A; 
#chains in the Genus database with same CATH topology
 3EN1 B;  1ZS7 A;  1MWT A;  1UUV B;  4I5Q A;  1TP6 A;  3G16 A;  4IPB A;  1O7G B;  4O8S A;  3PZW A;  2HMN B;  4HM5 B;  1FYS A;  5IEO A;  4BTX A;  1GOU A;  3MYT A;  1YIJ 3;  2CX1 A;  1OH0 A;  2H0H A;  1YGW A;  3MHE A;  4K1U A;  3KFQ C;  1AVL A;  3F8X A;  2F98 A;  3K63 A;  4FCM A;  1TU5 A;  1K28 A;  4XBX A;  1GYB A;  1RGE A;  1GY7 A;  1RGC A;  2AAE A;  5LC7 A;  5CF2 A;  2KF3 A;  3OW2 2;  2IMJ A;  3D4A A;  3G6E 3;  1YJW 3;  3CC4 3;  1W7C A;  4BIR A;  1VQK 3;  2ML5 A;  3S5C A;  4WHA A;  2JQ5 A;  1DMN A;  3DGL A;  4N6N B;  2OCT A;  4RZM A;  5D81 A;  1OF5 B;  1UDI I;  2Y73 A;  3X40 A;  1O7N B;  1BRG A;  5HOH A;  2GEX A;  1BOX A;  1D6Y A;  1STF I;  1X1Y A;  5RNT A;  2GXF A;  1HZ1 A;  1T3B A;  2GEY A;  3LXU X;  3G0K A;  3UNL A;  3PCR A;  4N6M A;  3RGA A;  4GL6 A;  3K9M C;  3BNB A;  1F8N A;  4FMA A;  4XDV A;  5DRV A;  2CG1 A;  3B4O A;  4FCZ A;  4HM8 B;  4STD A;  1BRH A;  4U13 A;  1FZU A;  3SVA A;  3T0U A;  1I3I A;  1WMP A;  3X41 A;  4HBR A;  1GOY A;  1MWS A;  1TRQ A;  1UUG B;  8CHO A;  3NHX A;  1ZO2 A;  2FXT A;  3M8C A;  1BAN A;  4J8T A;  5KP3 A;  1W6C A;  1M1X B;  3K0Z A;  5JPP A;  3FCS B;  2HOH A;  2CFW A;  5D83 A;  5FW5 A;  1EQK A;  2MF7 A;  1AQZ A;  2C11 A;  3S29 A;  3K7C A;  2CIU A;  1DYU A;  3I0Y A;  4IT7 A;  1BUQ A;  2GU3 A;  3EN8 A;  2HMK B;  2OQE C;  2QIY A;  3D5G A;  4JRF A;  4WWU C;  1JKG B;  5GSP A;  2E2T A;  4NHF A;  1BRK A;  1RJO A;  1SIH A;  1LOX A;  3CC2 3;  2P09 A;  2ZHX B;  1C54 A;  2O9U X;  3WOD G;  1OCV A;  3N9H A;  1M1K 4;  3DY5 A;  5IEP A;  2BT3 A;  1CQS A;  3MKI A;  2JDI H;  1RN1 A;  1I2G A;  1UCJ A;  2F5M A;  1MOL A;  2K0M A;  3DZL A;  3NBJ A;  1VQM 3;  1GMP A;  1B2M A;  5I97 A;  7RNT A;  1LOV A;  1LVN A;  3GZR A;  3V98 A;  1GS3 A;  3F7S A;  1RCL A;  1Q9E A;  1S5A A;  1D6U A;  4QWT A;  3UJM A;  1U8C B;  6STD A;  1Q86 4;  4KT3 B;  4KFD A;  3V99 A;  1W5Z A;  2BU4 A;  2V1L A;  1BU4 A;  3MWZ A;  2QGU A;  3CCL 3;  1HKX A;  4H3U A;  3S28 A;  2BO9 B;  4N6L A;  2OTJ 3;  1JBR A;  1S72 3;  1NDO B;  5A0O B;  1GY5 A;  1NNV A;  4ILF A;  3U97 A;  5G1L A;  3AMO A;  3CPO A;  5BXQ A;  4AKZ A;  1UW1 A;  3EJV A;  1N8Q A;  3RGR A;  5M18 A;  1BSC A;  1DE3 A;  3X3X A;  2XH9 A;  1V57 A;  5IW9 A;  1A2P A;  2IYJ A;  2RNT A;  1R4C A;  1JBS A;  1TFO A;  1JNQ A;  3HZP A;  1R4Y A;  1IV7 A;  3Q90 A;  3GZY B;  4FR9 A;  3F9S A;  2HMJ B;  1I3F A;  3PGB A;  1FW7 A;  1NO3 A;  1BGS A;  3RNT A;  3SED A;  4HM0 B;  4PEJ A;  1BNF A;  1GD3 A;  1JB2 A;  2LQV A;  3FGY A;  3IPT A;  4HM3 B;  5EEO A;  3D79 A;  2IUJ A;  1W00 A;  2F5W A;  3EHC A;  3ALA A;  4EW5 A;  2OTL 3;  4X2O A;  3FG1 A;  5CLK A;  2W04 A;  1WQL B;  1GSP A;  1W2Z A;  2MC8 A;  2XEP A;  1SJW A;  3ZG0 A;  4EBG A;  5BVB A;  1VQL 3;  3S67 A;  1C7H A;  1Q40 A;  1O7W B;  1UI7 A;  1LNI A;  4HJL B;  1JZO A;  3LZA A;  1BRS A;  1MWR A;  3KCH A;  4KZ1 A;  1EA2 A;  2UUG C;  4R9L A;  3WA3 A;  1DMQ A;  3F14 A;  1TUH A;  1BNG A;  1HYF A;  1RNB A;  1I2E A;  2Z6B A;  1LOY A;  3WOE B;  2CFD A;  4MMZ B;  1LOW A;  2XRX B;  1BRI A;  3DGM A;  5ELJ A;  1AV4 A;  4GHO A;  1B20 A;  1PYL A;  2KF5 A;  2W2C A;  1M9G A;  1BNS A;  1IVX A;  1JN5 B;  1ZX2 A;  1QMA A;  2E2V A;  1Y4K A;  2PNC A;  4HOH A;  1VQN 3;  1IVV A;  1GMR A;  3Q1C A;  4WFO A;  4BTW A;  3B8L A;  2P38 A;  1ULJ B;  2A15 A;  2YX9 A;  4KVH A;  1HU9 A;  3HK4 A;  1B2S A;  1M90 4;  1WMO A;  2L4V A;  4AEQ A;  1IVU A;  3T8N A;  4DKI A;  4CJN A;  2BMR B;  1VQ4 3;  4N6O B;  4MEI A;  1FUW A;  2CX0 A;  1DVC A;  1ROA A;  1OGX A;  3CNX A;  3DGY A;  3EE1 A;  1VZZ A;  1BNE A;  3KKG A;  3GRD A;  4RNY A;  5M19 A;  3CCJ 3;  3NV0 B;  2RCD A;  3OXA A;  1N5P A;  1V74 A;  2HML B;  3EBT A;  3GZB A;  1JB4 A;  1Q82 4;  5IEN A;  4CDL A;  4EV5 A;  2AAD A;  2SBL A;  3TDG A;  1GOV A;  2W03 A;  4LYL B;  1CH0 A;  3N8B A;  2CH9 A;  2XFT A;  1VQO 3;  3QK9 A;  2BIR A;  3GSP A;  3CC7 3;  2O3O A;  1UGI A;  3GWR A;  1U5O A;  3LML A;  1IQ8 A;  2HMM B;  1RN4 A;  1BSD A;  3FSD A;  3CCU 3;  1QVF 2;  3DMC A;  1UGH I;  3E99 A;  1TJD A;  1E3V A;  4NPB A;  2OOV C;  5IG3 A;  3HX8 A;  2CHC A;  1VQ7 3;  2E2U A;  4LMI A;  4ORL A;  2KAA A;  1MNL A;  1FGO A;  2LYX A;  3FLJ A;  3KE7 A;  4FMB A;  1RRL A;  1BRN L;  3MPH A;  3DM8 A;  2IY2 A;  5EQL A;  1FUT A;  4L7K A;  3VGN A;  1IQY A;  1UI8 A;  1T5Y A;  4MMX B;  2CKF B;  3X3Y A;  4WP5 A;  1WTH A;  4XBT A;  5AII A;  2GSP A;  1LXE A;  1YHQ 3;  1RMS A;  2OQE A;  3Q3F A;  4TX4 A;  3CCE 3;  1J2B A;  1BNR A;  1YVB I;  3JUP A;  5LC6 A;  1KQS 2;  5IG0 A;  2PZV A;  5TGN A;  1I0X A;  3JUM A;  1NB5 I;  4KFF A;  5HGR A;  1SPU A;  1W4N A;  2IA7 A;  1B2X A;  1W01 A;  3F8H A;  2L1S A;  2OWP A;  4N6V 0;  2B24 B;  2CG0 A;  1ASK A;  5M1A A;  2C10 A;  3K5T A;  1YI2 3;  2WGQ A;  3OWU A;  2Z77 A;  3WA2 X;  2H0I A;  3OX9 A;  2CW9 A;  3WMD A;  1IDP A;  4HZ9 B;  7STD A;  3ZG5 A;  1RN7 A;  3V92 A;  1W02 A;  2KXG A;  3VF1 A;  4BTY A;  1VQ9 3;  1T2H A;  1FGM A;  1A2V A;  5IG4 A;  4LGQ A;  2XF3 A;  3KZT A;  1QAK A;  3NBB A;  3A76 A;  2I9W A;  2RFR A;  1MGR A;  2SAR A;  3BLZ A;  3PCS A;  3SLU A;  2C4B A;  3F7X A;  3KII A;  3PXM A;  3S27 A;  1ISK A;  3NV0 A;  3JUN A;  4AKY A;  1IV9 A;  5CF1 A;  1RKY A;  1LQG C;  2D42 A;  1E3R A;  3FKA A;  2F56 A;  1NB3 I;  2P0X A;  3SOA A;  3MG1 A;  6RNT A;  1W6G A;  1VQP 3;  2YFJ B;  1N8R 4;  3BNC A;  3FF0 A;  5CXO A;  3VSY A;  1JZD A;  3CCM 3;  3FG4 A;  2F86 B;  3MG2 A;  4L8P A;  3CXC 2;  4N6U A;  1B21 A;  1BVI A;  2BNG A;  2K3D A;  4R4K A;  4XBY A;  3U1W A;  4K61 A;  3AGO A;  4HVN A;  1T2I A;  1FGR A;  2XR8 B;  1B27 A;  2XFS A;  3KSE D;  1IT8 A;  2M7O A;  3NM2 A;  3I55 3;  4OK0 A;  1I0V A;  2XGN A;  1OGZ A;  2BMQ B;  5JPU A;  1Q42 A;  1QJG A;  2HMO B;  5ELU A;  3GZX B;  1N9J A;  3JVC A;  2WGO A;  4HYZ A;  5AIG A;  1YIT 3;  1WMN A;  4XDW A;  6GSP A;  1JJ2 2;  4J5K A;  1WNH A;  3X42 A;  1CEW I;  3OV4 A;  3CU3 A;  1US1 A;  3G71 3;  4HM4 B;  1RGG A;  1RTU A;  2UGI A;  3CCQ 3;  4HZB B;  5FGO A;  3HIG A;  1KC8 4;  3WOF B;  5AIF A;  2R41 A;  5G1K A;  1I2F A;  1EKM A;  1JV2 B;  2GBW B;  1BSA A;  5KP1 A;  3H51 A;  1DMM A;  1LNH A;  4LZI A;  1IT7 A;  1I8V A;  1KWI A;  3F40 A;  4LSO A;  4WYK B;  1FGQ A;  4O2H A;  1OHS A;  2W6J H;  9RNT A;  1OHP A;  3NX0 A;  4KFE A;  1YNV X;  3LH4 A;  3FH1 A;  2RBI A;  1UUW B;  1CYU A;  3EF8 A;  2D1W A;  2KF6 A;  1RGF A;  3SYU A;  1Q7H A;  2STD A;  1PY3 A;  5AI1 A;  5AEU B;  1BIR A;  1OAC A;  5BIR A;  3H3H A;  1K73 4;  4HM6 B;  2XGL A;  2P05 A;  3MSO A;  3NUV A;  2INX A;  1B2U A;  4CCV A;  1DVD A;  3EB8 A;  4L8O A;  1K8A 4;  1JKG A;  3EX9 A;  3URP A;  1X1W A;  4X2H A;  5AEW B;  4J9A A;  1EUI C;  1BSE A;  3OWY A;  4HM7 B;  1GMQ A;  1W6Y A;  4O02 B;  2W9P A;  4H61 A;  5EVH A;  4FMC A;  5IF6 A;  1SII A;  4HKV B;  3J7Y d;  2ZA4 A;  4NRE A;  1SAR A;  5JBS A;  1UCL A;  1OPY A;  3UL5 A;  3D5I A;  2W56 B;  4WYK A;  4XM4 A;  2WO0 A;  1YVS A;  4BL2 A;  3FG3 A;  1MWU A;  1B2Z A;  4R80 A;  3IMA B;  2RSX A;  1RGK A;  3AHW A;  1AR0 A;  3DH2 A;  1L5G B;  1SQW A;  3QRD A;  1KSI A;  2GBX B;  1YJ9 3;  1QVG 2;  1CYV A;  2R4I A;  1EG9 B;  1E97 A;  1OF5 A;  1ROV A;  1UCK A;  1Q40 B;  3DXO A;  2J8X B;  2ML6 A;  3KN4 A;  1FA3 A;  2CFK A;  3D9R A;  2BMO B;  1TRP A;  7GSP A;  1VQ6 3;  2H0G A;  1O7M B;  4OUQ A;  3CCR 3;  3WHO A;  1VQ8 3;  2XSH B;  1QAL A;  3BNE A;  4MJD A;  2CWU A;  1TFK A;  4N6T A;  4N3V A;  3T8U A;  1OUN A;  2CFG A;  4GSP A;  5DRE A;  1ULI B;  4CPK A;  2IUK A;  1BAO A;  1QAF A;  1UCI A;  1PU4 A;  3CPW 2;  1BNJ A;  1RGH A;  4R1K A;  1DET A;  2K54 A;  2KRT A;  5AIH A;  1G96 A;  3Q2P A;  3G8Z A;  2RGQ A;  3EQQ B;  1O7H B;  1Q81 4;  4GB5 A;  3LTB A;  5CK6 A;  3SOY A;  1RNT A;  4HM1 B;  1FGT A;  1RDS A;  3JUQ A;  2Z7A A;  2CK3 H;  3CNM A;  2WOF A;  4XB5 A;  4OVM A;  4HAA A;  1OHO A;  2CFL A;  3SX1 A;  3NQZ A;  4EYC A;  3I56 3;  1X1X A;  2QA4 3;  2YFI B;  3LTA A;  1BRJ A;  3MG3 A;  3BND A;  2Q07 A;  3NQY A;  3D3L A;  3CCV 3;  3NBR A;  3LT8 A;  4G1M B;  4RNZ A;  3B7C A;  4I4K A;  1I70 A;  1RSN A;  2CWT A;  5G2G A;  2W0Q A;  4RNT A;  3GAX A;  8RNT A;  1AVK A;  3O8Y A;  1K9M 4;  1A67 A;  3LTD A;  1NWW A;  4RBN A;  5KP4 A;  1RGA A;  1LRA A;  1N9E A;  2UX0 A;  5STD A;  5BU4 A;  2KCD A;  3IJE B;  5AYS C;  3X3Z A;  1BSB A;  3WR2 A;  3CD6 3;  3CME 3;  1RHL A;  4LEH A;  3ZFZ A;  1JN5 A;  1GD4 A;  3LT9 A;  1JRQ A;  3LYG A;  1RRH A;  3HII A;  3UL6 A;  1N5H A;  3JUO A;  5IG5 A;  1JB5 A;  2FNQ A;  1G02 A;  3HI7 A;  2CWV A;  2XSO B;  3AGN A;  1JBT A;  1VQ5 3;  2F99 A;  2FGT A;  1PFP A;  1EEJ A;  2ZDJ A;  3L0R A;  1YJN 3;  4ZM8 A;  4J5G A;  4K90 B;  4EXR A;  1MGW A;  2W9Q A;  1LQM B;  1IVW A;  2Z76 A;  3DUK A;  2CC3 A;  1NU3 A;  1VQQ A;  2QEX 3;  2OOV A;  3UB1 A;  1STD A;  3SXX A;  3AMO B;  3DGN A;  3PYJ A;  5IER A;  1V58 A;  4O3V A;  3G4S 3;  1YGE A;  4EV2 A;  1W2B 2;  4K1V A;  3WDG B;  4BL3 A;  3LOY A;  1X1U A;  3OWS A;  1K41 A;  3FF2 A;  3AHS A;  3RDE A;  3NXJ A;  5D82 A;  4FCJ A;  3CMA 3;  4BU4 A;  3B4P A;  1Z1S A;  4HM2 B;  1NJI 4;  1O7P B;  3LTC A;  4MMY B;  2KF4 A;  1RCK A;  4R9K A;  1IK3 A;  3ROB A;  5AYR B;  3A5E A;  1GY6 A;  1A2K A;  4Q53 A;  3ER7 A;  2WOH A;  1TTO A;  3STD A;  1BNI A;  1A90 A;  2B1X B;  1BUJ A;  1IQX A;  1TIJ A;  4EC6 A;  4FMD A;  2YFL B;  3BB9 A;  2GU1 A;  1G0T A;  1B3S A;  1FUS A;  1Q7Y 4;  3HOH A;  3NM7 A;  1KD1 4;  3EBY A;  3BU4 A;  1D6Z A;  1ZGX A;  3EC9 A;  1IU7 A;  1IYY A;  3N54 B;  3CCS 3;  3BIR A;  1AY7 A;  2F4Y A;  2P0M A;  2W56 A;  2BHM A;  3PS8 A;  4JF8 A;  2Y74 A;  3FZW A;  3KSP A;  1RGL A;  4IIA A;  3ECF A;  3DGO A;  2ZL8 A;  1RLS A; 
#chains in the Genus database with same CATH homology
 2F5W A;  1BAO A;  1UCI A;  1BNJ A;  1FYS A;  1MGR A;  1RGH A;  1DET A;  2SAR A;  1GOU A;  1GSP A;  2C4B A;  1YGW A;  1LNI A;  1BRS A;  3KCH A;  1RNT A;  1RDS A;  1RGE A;  2F56 A;  1RGC A;  2AAE A;  6RNT A;  1BNG A;  1HYF A;  2KF3 A;  1I2E A;  1RNB A;  3D4A A;  1LOY A;  4HAA A;  4BIR A;  1LOW A;  1X1X A;  1BRI A;  4GHO A;  1B20 A;  1BRJ A;  1B21 A;  1BVI A;  1PYL A;  2KF5 A;  1BRG A;  5HOH A;  3AGO A;  1BOX A;  1BNS A;  1T2I A;  4HOH A;  1X1Y A;  1B27 A;  5RNT A;  1GMR A;  1I70 A;  1RSN A;  8RNT A;  1HZ1 A;  1I0V A;  4RNT A;  1B2S A;  1RGA A;  6GSP A;  1LRA A;  1BRH A;  4J5K A;  1FZU A;  5BU4 A;  1I3I A;  1GOY A;  1BSB A;  3WR2 A;  1TRQ A;  1RGG A;  1RTU A;  1RHL A;  3DGY A;  1BAN A;  1BNE A;  1I2F A;  2HOH A;  1BSA A;  1AQZ A;  1I8V A;  2AAD A;  1G02 A;  1GOV A;  3AGN A;  1JBT A;  1CH0 A;  9RNT A;  3D5G A;  4J5G A;  1YNV X;  5GSP A;  2RBI A;  1BRK A;  2BIR A;  3GSP A;  1MGW A;  1C54 A;  4GSP A;  1RN4 A;  1BSD A;  2KF6 A;  1RGF A;  3SYU A;  1RN1 A;  1I2G A;  1UCJ A;  2F5M A;  1PY3 A;  1BIR A;  5BIR A;  1GMP A;  1B2M A;  7RNT A;  1LOV A;  1X1U A;  2KAA A;  1B2U A;  3AHS A;  3URP A;  1BRN L;  1X1W A;  1RCL A;  1Q9E A;  1BSE A;  1FUT A;  4BU4 A;  1GMQ A;  2BU4 A;  2KF4 A;  1RCK A;  1BU4 A;  2ZA4 A;  1SAR A;  1UCL A;  2GSP A;  3A5E A;  3D5I A;  1JBR A;  1RMS A;  3Q3F A;  1YVS A;  1TTO A;  1BNI A;  1B2Z A;  1BNR A;  1RGK A;  3AHW A;  3DH2 A;  1BUJ A;  1I0X A;  1B3S A;  1FUS A;  1BSC A;  1UCK A;  1B2X A;  3HOH A;  1DE3 A;  1A2P A;  3BU4 A;  1TRP A;  2RNT A;  7GSP A;  1JBS A;  1ZGX A;  1R4Y A;  1IYY A;  3BIR A;  1AY7 A;  2F4Y A;  3WHO A;  1FW7 A;  1I3F A;  1BGS A;  3RNT A;  1RGL A;  1T2H A;  1BNF A;  1RLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...