9RNTA

Ribonuclease t1 with free recognition and catalytic site: crystal structure analysis at 1.5 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Ribonuclease T1 with free recognition and catalytic site: crystal structure analysis at 1.5 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 9rntA00
1B2ZA 1Q9EA 3A5EA 1BRHA 1GOUA 1B21A 1T2HA 7GSPA 1GMPA 1RGFA 1R4YA 1RNBA 1BUJA 2RNTA 1PY3A 3WR2A 1TRQA 6GSPA 2AADA 1BANA 1DE3A 1BRIA 1RMSA 1I2EA 2F5MA 1RGEA 2ZA4A 1G02A 1I0XA 1I0VA 3Q3FA 1BGSA 1YGWA 1TTOA 1BIRA 1BSEA 1BRSA 4J5GA 1BRNL 9RNTA 3D4AA 2BIRA 1X1WA 1LOVA 1BNGA 1B20A 1JBSA 5HOHA 1BRKA 3RNTA 3D5GA 1HZ1A 2HOHA 2SARA 1FYSA 1I2GA 1CH0A 1B2UA 1BU4A 2KF5A 1GOYA 1UCKA 1I3FA 1RNTA 1SARA 1B2MA 3DGYA 1JBTA 1LOWA 1UCIA 3AGOA 1BSBA 1UCJA 3BU4A 4GHOA 1RHLA 1BSAA 1MGWA 1MGRA 2KF4A 3SYUA 1LOYA 1BNSA 2KF3A 1X1UA 3URPA 5BU4A 1BSDA 1RSNA 1FUTA 4BIRA 3GSPA 1I2FA 4RNTA 3AHSA 1X1YA 1FUSA 2GSPA 1BNRA 4GSPA 7RNTA 1B2SA 1DETA 4HOHA 1I3IA 2F56A 1BRJA 1BNJA 3HOHA 4HAAA 1LRAA 1PYLA 3AHWA 3WHOA 5RNTA 1I70A 3AGNA 4J5KA 2C4BA 1BNIA 1BRGA 1HYFA 1B3SA 2AAEA 1A2PA 1GMRA 1RLSA 1YNVX 3BIRA 4BU4A 1C54A 1RCLA 1BOXA 1X1XA 3D5IA 1I8VA 2RBIA 1RGCA 1UCLA 1AQZA 1RGAA 2F5WA 1GOVA 2KAAA 1IYYA 1AY7A 1BVIA 2KF6A 1FZUA 1FW7A 1RN4A 8RNTA 1ZGXA 1B2XA 1TRPA 3DH2A 1RGGA 1YVSA 1RGHA 2F4YA 1BSCA 1GSPA 3KCHA 1JBRA 1RGLA 1RTUA 5GSPA 1RDSA 1B27A 1BNFA 1GMQA 6RNTA 5BIRA 1BNEA 1RCKA 1BAOA 1LNIA 2BU4A 1RGKA 1RN1A 1T2IA
chains in the Genus database with same CATH superfamily
3CCQ3 3MPHA 1Q9EA 1UW1A 1JKGB 3PZWA 3U97A 5KP4A 1BRHA 2FGTA 2C10A 3LH4A 3K63A 2ZDJA 1DYUA 2B24B 5STDA 2OQEC 2WO0A 5D82A 1QVG2 3FSDA 4JF8A 1IQ8A 1ULJB 3LYGA 1PFPA 3WR2A 1TRQA 6GSPA 2AADA 4WP5A 3HZPA 1GYBA 2OTL3 1NU3A 3CCS3 1EEJA 1RGEA 1W00A 2F5MA 2ZA4A 1I0XA 3EBTA 3EQQB 3EJVA 3SEDA 1LVNA 5JPPA 1BGSA 1YGWA 4HZ9B 5JPUA 3CPW2 1TTOA 1RN7A 3JUOA 3CCR3 1BSEA 3CCE3 1BRSA 1BRNL 3EN8A 3EN1B 1G96A 3LOYA 2CIUA 3FG3A 1K9M4 4LZIA 2R4IA 1BNGA 2Q07A 2XFTA 1AR0A 1TU5A 4O8SA 1JBSA 3I0YA 1E97A 4LMIA 1GY6A 1BRKA 5HOHA 4N6TA 3SOYA 2CW9A 3D5GA 1W6GA 1YJW3 1HZ1A 3ALAA 3JUMA 3WA3A 4XBXA 3CCV3 7STDA 1FYSA 3FZWA 3NV0A 1B2UA 1YJ93 1GOYA 1VQK3 5IERA 1K41A 4FMCA 3DGYA 1JBTA 1LOWA 4I4KA 1BSBA 5EVHA 2HMMB 2SBLA 1TFKA 3CCL3 2Z76A 4HM0B 2W56A 1LOYA 3LT9A 4R1KA 1QAFA 3Q2PA 4HM4B 4R9LA 5EEOA 3I553 3GRDA 1BNSA 1ZO2A 3GAXA 1EUIC 5AEWB 2Y74A 3H51A 3SOAA 1FUTA 5CXOA 4N3VA 3GSPA 1AVLA 2W04A 1NDOB 3EE1A 3ER7A 3GWRA 1Q40A 4RBNA 4N6UA 3MG3A 3ZG0A 2FXTA 4RNYA 2XR8B 3UB1A 3KFQC 2CG1A 4GSPA 2XSOB 1JN5A 4BTYA 2CH9A 2IUKA 1O7HB 1YJN3 1WMPA 3F7SA 3HOHA 1IQXA 1UDII 5FW5A 1PYLA 2GXFA 3NBRA 1EA2A 5IG5A 1Q824 1W6YA 3X3XA 2ZL8A 1Q7Y4 3AGNA 4J5KA 2HMJB 2C4BA 2E2UA 3OWUA 1JJ22 4HM2B 1R4CA 4NREA 1SQWA 1GMRA 1Z1SA 1NWWA 2P05A 3OW22 1Q864 2QA43 3Q1CA 3FLJA 1RCLA 2MF7A 4HM5B 4L8PA 5G1LA 2KCDA 3SLUA 3VSYA 3WODG 4O02B 2Z6BA 3AMOB 1X1XA 1UUVB 3L0RA 4KFDA 3WDGB 2OOVC 1K28A 3D5IA 1YIJ3 1JZOA 3KIIA 1RGCA 1DMMA 5LC6A 3T0UA 1KWIA 1VQ73 1BVIA 3JVCA 3KE7A 4KFEA 1J2BA 2CWTA 1ZGXA 4KVHA 1B2XA 3T8UA 3BNDA 4K90B 2P0MA 1ZX2A 3K0ZA 1UUGB 3DXOA 3V99A 3BNBA 1N9JA 2GBXB 3DMCA 2O9UX 5EQLA 1B27A 1BNFA 2XGNA 5IENA 5IG0A 1UI7A 3NM7A 3VF1A 1KD14 5IF6A 2BNGA 3U1WA 4HYZA 5LC7A 1VQQA 3SXXA 4OVMA 8CHOA 1A2KA 3EF8A 1T3BA 1OF5B 1TFOA 3LTAA 1B21A 1IK3A 1GMPA 3WA2X 1RGFA 3EX9A 2L1SA 5BXQA 1IV7A 5AIIA 5AYRB 2RNTA 2OOVA 1VZZA 2XEPA 3ZFZA 2V1LA 1JRQA 1OCVA 1PY3A 3QRDA 2YFJB 2IA7A 3DGMA 4ILFA 5IW9A 1IT7A 3MG2A 3G713 1FUWA 5AIGA 2R41A 3FH1A 1RMSA 1YVBI 3MHEA 4WFOA 1I0VA 4N6MA 5KP1A 1BIRA 4IT7A 2B1XB 3CC43 5CLKA 3S29A 1CQSA 1GS3A 4J5GA 1OGXA 3K9MC 3UNLA 2BIRA 4R80A 1X1WA 1SIIA 1LOVA 4HM7B 5IG3A 1O7WB 1VQM3 1D6UA 4H3UA 3RNTA 3UL6A 2HOHA 1ROVA 3UJMA 2UGIA 3WOFB 2KXGA 1T5YA 1C7HA 3GZYB 1BU4A 2KF5A 1N5PA 5M18A 1OPYA 1B2MA 4CDLA 1OGZA 3CU3A 3LTCA 2YFLB 1ZS7A 1N8R4 1LQGC 3BU4A 4GHOA 3DZLA 1MGWA 3EHCA 1MWUA 1U5OA 2QIYA 1UUWB 3D3LA 3FG4A 3N9HA 1LXEA 3STDA 3CXC2 2CK3H 5M19A 4IPBA 5G2GA 2IMJA 2KF3A 3X3ZA 5TGNA 3PGBA 1BSDA 1LNHA 5BU4A 1RSNA 5AIHA 4N6NB 1W02A 4X2HA 4IIAA 3NV0B 1JV2B 4RNTA 1IVUA 4STDA 3IMAB 5CF1A 2QGUA 3PCSA 3D9RA 1FUSA 2GSPA 4BL2A 3MYTA 5AEUB 4LGQA 3NXJA 7RNTA 5M1AA 4HOHA 1I3IA 2HMLB 4HAAA 1TIJA 3G6E3 2W56B 2P0XA 4ORLA 5RNTA 3JUPA 5DREA 1US1A 4XDWA 2K3DA 2MC8A 1B3SA 1O7NB 2GU3A 2OQEA 1HU9A 3M8CA 1Q40B 4EV5A 4J9AA 3BIRA 2JQ5A 1C54A 2W2CA 5HGRA 1BOXA 1U8CB 1N8QA 4J8TA 1JN5B 1W2ZA 1FGOA 1JB4A 1WQLB 1QAKA 1TJDA 1I8VA 4CJNA 2GEXA 2ML6A 4O3VA 1RGAA 1OHOA 5I97A 1AY7A 1QMAA 3JUNA 3H3HA 3OWYA 1MWTA 4FR9A 8RNTA 1FW7A 3OWSA 3DH2A 1E3VA 1RGGA 1YVSA 1RGHA 3I563 4JRFA 3HX8A 1VQP3 3KCHA 3B4OA 2RSXA 3OX9A 2BO9B 2WGQA 1JBRA 3KKGA 2PNCA 1DMNA 3GZBA 3LTDA 1ROAA 2WOHA 1WNHA 3CNXA 1FA3A 3EBYA 1GMQA 3BNEA 3DY5A 1A2VA 2Z77A 1BNEA 1RCKA 1MWRA 1RRHA 1WMNA 1Y4KA 1G0TA 2CC3A 5IEOA 2RGQA 3HIGA 1K734 2INXA 1OUNA 1IV9A 4PEJA 3A5EA 1GOUA 1N5HA 1SIHA 2HMKB 7GSPA 3G8ZA 1V74A 1R4YA 2H0IA 4WWUC 1BUJA 4FCZA 1NJI4 2OCTA 2GBWB 3CMA3 3QK9A 1EG9B 1CYVA 4BTXA 1BRIA 3BNCA 2HMOB 1I2EA 1YGEA 4RNZA 3S5CA 3TDGA 4H61A 1K8A4 3B7CA 4L8OA 3FCSB 2E2VA 1YI23 4U13A 3N8BA 3SVAA 1JB5A 1GY7A 2JDIH 3D4AA 3X40A 5G1KA 1RJOA 2O3OA 2WOFA 2J8XB 1QJGA 4EXRA 1IDPA 1OH0A 4XBYA 3CCU3 1KC84 5IG4A 3OV4A 5A0OB 2RFRA 3F8XA 1IT8A 2XH9A 3HIIA 3IPTA 1IQYA 4K61A 1S5AA 3FKAA 1VQ93 4FMDA 2SARA 3PYJA 3IJEB 4QWTA 3LT8A 4XB5A 1GY5A 5AI1A 1UCKA 1O7GB 2C11A 4HJLB 4R4KA 4RZMA 3G0KA 3SX1A 2W0QA 1UCIA 1W5ZA 4HM6B 1RHLA 2CHCA 1MGRA 4FCMA 4L7KA 1JZDA 2KF4A 4MMXB 1FGTA 5ELJA 4HBRA 3RGAA 2D42A 4LYLB 4NPBA 3URPA 3CPOA 3CD63 1GD4A 4LSOA 1M1XB 2CFDA 4BIRA 3KZTA 3F14A 2BHMA 4HKVB 3K5TA 1I2FA 1VQ53 5FGOA 3X3YA 3LTBA 2CFGA 3A76A 4KFFA 4XDVA 1BNRA 4LEHA 4OUQA 5AIFA 2BMOB 1B2SA 1DETA 3PXMA 3CCM3 2CG0A 2XFSA 2CFLA 1AV4A 1BNJA 5AYSC 2HMNB 2W9PA 4FCJA 2ZHXB 3AHWA 2W9QA 3WHOA 2CFKA 2WGOA 1I70A 1UI8A 2QEX3 2PZVA 4FMAA 1BNIA 2UX0A 4G1MB 2IYJA 4AKZA 2IUJA 2AAEA 3F9SA 2OTJ3 1DMQA 1E3RA 4TX4A 3WOEB 2LQVA 1YNVX 1BUQA 3KSED 1M1K4 3DGOA 3DM8A 1W4NA 1UGHI 2CX0A 2D1WA 3KSPA 2I9WA 1VQN3 1TUHA 1UCLA 1AQZA 2P09A 5KP3A 3CME3 1QALA 2F5WA 3NM2A 1GOVA 2KAAA 5JBSA 1QVF2 1V58A 1MOLA 3ZG5A 1D6YA 1IVVA 4WYKB 1V57A 1TRPA 3GZRA 2CWUA 1JKGA 1PU4A 2F4YA 2CX1A 4Q53A 1STDA 3RGRA 3PCRA 3E99A 1RTUA 2K54A 2CFWA 2GEYA 1VQ63 4WYKA 3EC9A 1YHQ3 1WMOA 2KRTA 5IEPA 1CYUA 3JUQA 2BT3A 2UUGC 5BIRA 2W6JH 2OWPA 3CCJ3 1BAOA 1LNIA 1VQL3 1RN1A 3EB8A 6STDA 4MJDA 1WTHA 3DUKA 1B2ZA 4N6LA 4XM4A 1EQKA 3F8HA 2XGLA 1D6ZA 4AEQA 3F40A 1W2B2 1RRLA 3KN4A 5CF2A 3MKIA 1F8NA 1T2HA 1ISKA 3MG1A 1RNBA 1W6CA 2BMQB 4CPKA 3MWZA 3NBJA 2STDA 5D83A 1W01A 1DVCA 1KSIA 2XF3A 3J7Yd 4X2OA 3WMDA 1BANA 1DE3A 2E2TA 4KT3B 1VQ43 2W03A 4K1VA 1LQMB 1G02A 1CEWI 1MNLA 4BL3A 3Q3FA 3NQYA 1IVXA 1Q7HA 2CWVA 4FMBA 1LOXA 5CK6A 2YX9A 4CCVA 2RCDA 2GU1A 9RNTA 1M904 3FF2A 3RDEA 4EC6A 3VGNA 2H0GA 1O7MB 1MWSA 1Q814 3LMLA 3V98A 1S723 1A90A 5D81A 1IU7A 1B20A 3S67A 4N6OB 1RKYA 3T8NA 4BTWA 1A67A 4GL6A 1I2GA 1CH0A 1Q42A 1SJWA 1I3FA 1RNTA 1SARA 3BLZA 3AGOA 3Q90A 4EYCA 1EKMA 1UCJA 1STFI 1BSAA 5DRVA 3PS8A 3SYUA 3O8YA 1HKXA 3NHXA 1N9EA 4EBGA 3S28A 1DVDA 2BMRB 1X1UA 4XBTA 4O2HA 3B8LA 3K7CA 3UL5A 3G4S3 3G16A 3LZAA 1OACA 3B4PA 4GB5A 3HK4A 1NB5I 1KQS2 2P38A 3AHSA 1FGQA 1X1YA 3BB9A 3CC23 3CC73 3AMOA 3DGNA 4MMYB 2F56A 1BRJA 3NBBA 2Z7AA 2FNQA 4HM8B 1LRAA 2F86B 3ROBA 4I5QA 1UGIA 1SPUA 1VQ83 3OXAA 1M9GA 1ULIB 1O7PB 3N54B 1AVKA 4HM3B 1NO3A 2CKFB 1BRGA 1HYFA 4MMZB 4WHAA 2F99A 5BVBA 2YFIB 1A2PA 4ZM8A 3S27A 3V92A 1RLSA 2Y73A 2ML5A 4BU4A 3F7XA 4MEIA 1OHPA 3X41A 1FGMA 4EW5A 3FGYA 2A15A 4NHFA 4EV2A 4R9KA 2RBIA 3HI7A 1L5GB 1ASKA 2LYXA 3FG1A 2L4VA 1IYYA 1JB2A 2KF6A 2K0MA 2XRXB 1FZUA 1W7CA 1VQO3 1YIT3 1RN4A 1GD3A 2XSHB 3LXUX 1FGRA 3MSOA 1OF5A 4HM1B 2H0HA 4N6V0 3DGLA 4HVNA 1BSCA 1GSPA 1JNQA 3FF0A 2M7OA 1RGLA 1NB3I 3NUVA 4AKYA 3NQZA 4OK0A 5GSPA 1RDSA 5ELUA 2F98A 4DKIA 3X42A 4K1UA 6RNTA 3ECFA 3CNMA 2BU4A 4KZ1A 1RGKA 3D79A 1IVWA 1OHSA 3GZXB 1NNVA 1TP6A 4HZBB 3NX0A 1T2IA 2IY2A
chains in the Genus database with same CATH topology
1B2ZA 1Q9EA 3A5EA 1BRHA 1GOUA 1B21A 1T2HA 7GSPA 1GMPA 1RGFA 1R4YA 1RNBA 1BUJA 2RNTA 1PY3A 3WR2A 1TRQA 6GSPA 2AADA 1BANA 1DE3A 1BRIA 1RMSA 1I2EA 2F5MA 1RGEA 2ZA4A 1G02A 1I0XA 1I0VA 3Q3FA 1BGSA 1YGWA 1TTOA 1BIRA 1BSEA 1BRSA 4J5GA 1BRNL 9RNTA 3D4AA 2BIRA 1X1WA 1LOVA 1BNGA 1B20A 1JBSA 5HOHA 1BRKA 3RNTA 3D5GA 1HZ1A 2HOHA 2SARA 1FYSA 1I2GA 1CH0A 1B2UA 1BU4A 2KF5A 1GOYA 1UCKA 1I3FA 1RNTA 1SARA 1B2MA 3DGYA 1JBTA 1LOWA 1UCIA 3AGOA 1BSBA 1UCJA 3BU4A 4GHOA 1RHLA 1BSAA 1MGWA 1MGRA 2KF4A 3SYUA 1LOYA 1BNSA 2KF3A 1X1UA 3URPA 5BU4A 1BSDA 1RSNA 1FUTA 4BIRA 3GSPA 1I2FA 4RNTA 3AHSA 1X1YA 1FUSA 2GSPA 1BNRA 4GSPA 7RNTA 1B2SA 1DETA 4HOHA 1I3IA 2F56A 1BRJA 1BNJA 3HOHA 4HAAA 1LRAA 1PYLA 3AHWA 3WHOA 5RNTA 1I70A 3AGNA 4J5KA 2C4BA 1BNIA 1BRGA 1HYFA 1B3SA 2AAEA 1A2PA 1GMRA 1RLSA 1YNVX 3BIRA 4BU4A 1C54A 1RCLA 1BOXA 1X1XA 3D5IA 1I8VA 2RBIA 1RGCA 1UCLA 1AQZA 1RGAA 2F5WA 1GOVA 2KAAA 1IYYA 1AY7A 1BVIA 2KF6A 1FZUA 1FW7A 1RN4A 8RNTA 1ZGXA 1B2XA 1TRPA 3DH2A 1RGGA 1YVSA 1RGHA 2F4YA 1BSCA 1GSPA 3KCHA 1JBRA 1RGLA 1RTUA 5GSPA 1RDSA 1B27A 1BNFA 1GMQA 6RNTA 5BIRA 1BNEA 1RCKA 1BAOA 1LNIA 2BU4A 1RGKA 1RN1A 1T2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2Z A;  1Q9E A;  3A5E A;  1BRH A;  1GOU A;  1B21 A;  1T2H A;  7GSP A;  1GMP A;  1RGF A;  1R4Y A;  1RNB A;  1BUJ A;  2RNT A;  1PY3 A;  3WR2 A;  1TRQ A;  6GSP A;  2AAD A;  1BAN A;  1DE3 A;  1BRI A;  1RMS A;  1I2E A;  2F5M A;  1RGE A;  2ZA4 A;  1G02 A;  1I0X A;  1I0V A;  3Q3F A;  1BGS A;  1YGW A;  1TTO A;  1BIR A;  1BSE A;  1BRS A;  4J5G A;  1BRN L;  9RNT A;  3D4A A;  2BIR A;  1X1W A;  1LOV A;  1BNG A;  1B20 A;  1JBS A;  5HOH A;  1BRK A;  3RNT A;  3D5G A;  1HZ1 A;  2HOH A;  2SAR A;  1FYS A;  1I2G A;  1CH0 A;  1B2U A;  1BU4 A;  2KF5 A;  1GOY A;  1UCK A;  1I3F A;  1RNT A;  1SAR A;  1B2M A;  3DGY A;  1JBT A;  1LOW A;  1UCI A;  3AGO A;  1BSB A;  1UCJ A;  3BU4 A;  4GHO A;  1RHL A;  1BSA A;  1MGW A;  1MGR A;  2KF4 A;  3SYU A;  1LOY A;  1BNS A;  2KF3 A;  1X1U A;  3URP A;  5BU4 A;  1BSD A;  1RSN A;  1FUT A;  4BIR A;  3GSP A;  1I2F A;  4RNT A;  3AHS A;  1X1Y A;  1FUS A;  2GSP A;  1BNR A;  4GSP A;  7RNT A;  1B2S A;  1DET A;  4HOH A;  1I3I A;  2F56 A;  1BRJ A;  1BNJ A;  3HOH A;  4HAA A;  1LRA A;  1PYL A;  3AHW A;  3WHO A;  5RNT A;  1I70 A;  3AGN A;  4J5K A;  2C4B A;  1BNI A;  1BRG A;  1HYF A;  1B3S A;  2AAE A;  1A2P A;  1GMR A;  1RLS A;  1YNV X;  3BIR A;  4BU4 A;  1C54 A;  1RCL A;  1BOX A;  1X1X A;  3D5I A;  1I8V A;  2RBI A;  1RGC A;  1UCL A;  1AQZ A;  1RGA A;  2F5W A;  1GOV A;  2KAA A;  1IYY A;  1AY7 A;  1BVI A;  2KF6 A;  1FZU A;  1FW7 A;  1RN4 A;  8RNT A;  1ZGX A;  1B2X A;  1TRP A;  3DH2 A;  1RGG A;  1YVS A;  1RGH A;  2F4Y A;  1BSC A;  1GSP A;  3KCH A;  1JBR A;  1RGL A;  1RTU A;  5GSP A;  1RDS A;  1B27 A;  1BNF A;  1GMQ A;  6RNT A;  5BIR A;  1BNE A;  1RCK A;  1BAO A;  1LNI A;  2BU4 A;  1RGK A;  1RN1 A;  1T2I A; 
#chains in the Genus database with same CATH topology
 3CCQ 3;  3MPH A;  1Q9E A;  1UW1 A;  1JKG B;  3PZW A;  3U97 A;  5KP4 A;  1BRH A;  2FGT A;  2C10 A;  3LH4 A;  3K63 A;  2ZDJ A;  1DYU A;  2B24 B;  5STD A;  2OQE C;  2WO0 A;  5D82 A;  1QVG 2;  3FSD A;  4JF8 A;  1IQ8 A;  1ULJ B;  3LYG A;  1PFP A;  3WR2 A;  1TRQ A;  6GSP A;  2AAD A;  4WP5 A;  3HZP A;  1GYB A;  2OTL 3;  1NU3 A;  3CCS 3;  1EEJ A;  1RGE A;  1W00 A;  2F5M A;  2ZA4 A;  1I0X A;  3EBT A;  3EQQ B;  3EJV A;  3SED A;  1LVN A;  5JPP A;  1BGS A;  1YGW A;  4HZ9 B;  5JPU A;  3CPW 2;  1TTO A;  1RN7 A;  3JUO A;  3CCR 3;  1BSE A;  3CCE 3;  1BRS A;  1BRN L;  3EN8 A;  3EN1 B;  1G96 A;  3LOY A;  2CIU A;  3FG3 A;  1K9M 4;  4LZI A;  2R4I A;  1BNG A;  2Q07 A;  2XFT A;  1AR0 A;  1TU5 A;  4O8S A;  1JBS A;  3I0Y A;  1E97 A;  4LMI A;  1GY6 A;  1BRK A;  5HOH A;  4N6T A;  3SOY A;  2CW9 A;  3D5G A;  1W6G A;  1YJW 3;  1HZ1 A;  3ALA A;  3JUM A;  3WA3 A;  4XBX A;  3CCV 3;  7STD A;  1FYS A;  3FZW A;  3NV0 A;  1B2U A;  1YJ9 3;  1GOY A;  1VQK 3;  5IER A;  1K41 A;  4FMC A;  3DGY A;  1JBT A;  1LOW A;  4I4K A;  1BSB A;  5EVH A;  2HMM B;  2SBL A;  1TFK A;  3CCL 3;  2Z76 A;  4HM0 B;  2W56 A;  1LOY A;  3LT9 A;  4R1K A;  1QAF A;  3Q2P A;  4HM4 B;  4R9L A;  5EEO A;  3I55 3;  3GRD A;  1BNS A;  1ZO2 A;  3GAX A;  1EUI C;  5AEW B;  2Y74 A;  3H51 A;  3SOA A;  1FUT A;  5CXO A;  4N3V A;  3GSP A;  1AVL A;  2W04 A;  1NDO B;  3EE1 A;  3ER7 A;  3GWR A;  1Q40 A;  4RBN A;  4N6U A;  3MG3 A;  3ZG0 A;  2FXT A;  4RNY A;  2XR8 B;  3UB1 A;  3KFQ C;  2CG1 A;  4GSP A;  2XSO B;  1JN5 A;  4BTY A;  2CH9 A;  2IUK A;  1O7H B;  1YJN 3;  1WMP A;  3F7S A;  3HOH A;  1IQX A;  1UDI I;  5FW5 A;  1PYL A;  2GXF A;  3NBR A;  1EA2 A;  5IG5 A;  1Q82 4;  1W6Y A;  3X3X A;  2ZL8 A;  1Q7Y 4;  3AGN A;  4J5K A;  2HMJ B;  2C4B A;  2E2U A;  3OWU A;  1JJ2 2;  4HM2 B;  1R4C A;  4NRE A;  1SQW A;  1GMR A;  1Z1S A;  1NWW A;  2P05 A;  3OW2 2;  1Q86 4;  2QA4 3;  3Q1C A;  3FLJ A;  1RCL A;  2MF7 A;  4HM5 B;  4L8P A;  5G1L A;  2KCD A;  3SLU A;  3VSY A;  3WOD G;  4O02 B;  2Z6B A;  3AMO B;  1X1X A;  1UUV B;  3L0R A;  4KFD A;  3WDG B;  2OOV C;  1K28 A;  3D5I A;  1YIJ 3;  1JZO A;  3KII A;  1RGC A;  1DMM A;  5LC6 A;  3T0U A;  1KWI A;  1VQ7 3;  1BVI A;  3JVC A;  3KE7 A;  4KFE A;  1J2B A;  2CWT A;  1ZGX A;  4KVH A;  1B2X A;  3T8U A;  3BND A;  4K90 B;  2P0M A;  1ZX2 A;  3K0Z A;  1UUG B;  3DXO A;  3V99 A;  3BNB A;  1N9J A;  2GBX B;  3DMC A;  2O9U X;  5EQL A;  1B27 A;  1BNF A;  2XGN A;  5IEN A;  5IG0 A;  1UI7 A;  3NM7 A;  3VF1 A;  1KD1 4;  5IF6 A;  2BNG A;  3U1W A;  4HYZ A;  5LC7 A;  1VQQ A;  3SXX A;  4OVM A;  8CHO A;  1A2K A;  3EF8 A;  1T3B A;  1OF5 B;  1TFO A;  3LTA A;  1B21 A;  1IK3 A;  1GMP A;  3WA2 X;  1RGF A;  3EX9 A;  2L1S A;  5BXQ A;  1IV7 A;  5AII A;  5AYR B;  2RNT A;  2OOV A;  1VZZ A;  2XEP A;  3ZFZ A;  2V1L A;  1JRQ A;  1OCV A;  1PY3 A;  3QRD A;  2YFJ B;  2IA7 A;  3DGM A;  4ILF A;  5IW9 A;  1IT7 A;  3MG2 A;  3G71 3;  1FUW A;  5AIG A;  2R41 A;  3FH1 A;  1RMS A;  1YVB I;  3MHE A;  4WFO A;  1I0V A;  4N6M A;  5KP1 A;  1BIR A;  4IT7 A;  2B1X B;  3CC4 3;  5CLK A;  3S29 A;  1CQS A;  1GS3 A;  4J5G A;  1OGX A;  3K9M C;  3UNL A;  2BIR A;  4R80 A;  1X1W A;  1SII A;  1LOV A;  4HM7 B;  5IG3 A;  1O7W B;  1VQM 3;  1D6U A;  4H3U A;  3RNT A;  3UL6 A;  2HOH A;  1ROV A;  3UJM A;  2UGI A;  3WOF B;  2KXG A;  1T5Y A;  1C7H A;  3GZY B;  1BU4 A;  2KF5 A;  1N5P A;  5M18 A;  1OPY A;  1B2M A;  4CDL A;  1OGZ A;  3CU3 A;  3LTC A;  2YFL B;  1ZS7 A;  1N8R 4;  1LQG C;  3BU4 A;  4GHO A;  3DZL A;  1MGW A;  3EHC A;  1MWU A;  1U5O A;  2QIY A;  1UUW B;  3D3L A;  3FG4 A;  3N9H A;  1LXE A;  3STD A;  3CXC 2;  2CK3 H;  5M19 A;  4IPB A;  5G2G A;  2IMJ A;  2KF3 A;  3X3Z A;  5TGN A;  3PGB A;  1BSD A;  1LNH A;  5BU4 A;  1RSN A;  5AIH A;  4N6N B;  1W02 A;  4X2H A;  4IIA A;  3NV0 B;  1JV2 B;  4RNT A;  1IVU A;  4STD A;  3IMA B;  5CF1 A;  2QGU A;  3PCS A;  3D9R A;  1FUS A;  2GSP A;  4BL2 A;  3MYT A;  5AEU B;  4LGQ A;  3NXJ A;  7RNT A;  5M1A A;  4HOH A;  1I3I A;  2HML B;  4HAA A;  1TIJ A;  3G6E 3;  2W56 B;  2P0X A;  4ORL A;  5RNT A;  3JUP A;  5DRE A;  1US1 A;  4XDW A;  2K3D A;  2MC8 A;  1B3S A;  1O7N B;  2GU3 A;  2OQE A;  1HU9 A;  3M8C A;  1Q40 B;  4EV5 A;  4J9A A;  3BIR A;  2JQ5 A;  1C54 A;  2W2C A;  5HGR A;  1BOX A;  1U8C B;  1N8Q A;  4J8T A;  1JN5 B;  1W2Z A;  1FGO A;  1JB4 A;  1WQL B;  1QAK A;  1TJD A;  1I8V A;  4CJN A;  2GEX A;  2ML6 A;  4O3V A;  1RGA A;  1OHO A;  5I97 A;  1AY7 A;  1QMA A;  3JUN A;  3H3H A;  3OWY A;  1MWT A;  4FR9 A;  8RNT A;  1FW7 A;  3OWS A;  3DH2 A;  1E3V A;  1RGG A;  1YVS A;  1RGH A;  3I56 3;  4JRF A;  3HX8 A;  1VQP 3;  3KCH A;  3B4O A;  2RSX A;  3OX9 A;  2BO9 B;  2WGQ A;  1JBR A;  3KKG A;  2PNC A;  1DMN A;  3GZB A;  3LTD A;  1ROA A;  2WOH A;  1WNH A;  3CNX A;  1FA3 A;  3EBY A;  1GMQ A;  3BNE A;  3DY5 A;  1A2V A;  2Z77 A;  1BNE A;  1RCK A;  1MWR A;  1RRH A;  1WMN A;  1Y4K A;  1G0T A;  2CC3 A;  5IEO A;  2RGQ A;  3HIG A;  1K73 4;  2INX A;  1OUN A;  1IV9 A;  4PEJ A;  3A5E A;  1GOU A;  1N5H A;  1SIH A;  2HMK B;  7GSP A;  3G8Z A;  1V74 A;  1R4Y A;  2H0I A;  4WWU C;  1BUJ A;  4FCZ A;  1NJI 4;  2OCT A;  2GBW B;  3CMA 3;  3QK9 A;  1EG9 B;  1CYV A;  4BTX A;  1BRI A;  3BNC A;  2HMO B;  1I2E A;  1YGE A;  4RNZ A;  3S5C A;  3TDG A;  4H61 A;  1K8A 4;  3B7C A;  4L8O A;  3FCS B;  2E2V A;  1YI2 3;  4U13 A;  3N8B A;  3SVA A;  1JB5 A;  1GY7 A;  2JDI H;  3D4A A;  3X40 A;  5G1K A;  1RJO A;  2O3O A;  2WOF A;  2J8X B;  1QJG A;  4EXR A;  1IDP A;  1OH0 A;  4XBY A;  3CCU 3;  1KC8 4;  5IG4 A;  3OV4 A;  5A0O B;  2RFR A;  3F8X A;  1IT8 A;  2XH9 A;  3HII A;  3IPT A;  1IQY A;  4K61 A;  1S5A A;  3FKA A;  1VQ9 3;  4FMD A;  2SAR A;  3PYJ A;  3IJE B;  4QWT A;  3LT8 A;  4XB5 A;  1GY5 A;  5AI1 A;  1UCK A;  1O7G B;  2C11 A;  4HJL B;  4R4K A;  4RZM A;  3G0K A;  3SX1 A;  2W0Q A;  1UCI A;  1W5Z A;  4HM6 B;  1RHL A;  2CHC A;  1MGR A;  4FCM A;  4L7K A;  1JZD A;  2KF4 A;  4MMX B;  1FGT A;  5ELJ A;  4HBR A;  3RGA A;  2D42 A;  4LYL B;  4NPB A;  3URP A;  3CPO A;  3CD6 3;  1GD4 A;  4LSO A;  1M1X B;  2CFD A;  4BIR A;  3KZT A;  3F14 A;  2BHM A;  4HKV B;  3K5T A;  1I2F A;  1VQ5 3;  5FGO A;  3X3Y A;  3LTB A;  2CFG A;  3A76 A;  4KFF A;  4XDV A;  1BNR A;  4LEH A;  4OUQ A;  5AIF A;  2BMO B;  1B2S A;  1DET A;  3PXM A;  3CCM 3;  2CG0 A;  2XFS A;  2CFL A;  1AV4 A;  1BNJ A;  5AYS C;  2HMN B;  2W9P A;  4FCJ A;  2ZHX B;  3AHW A;  2W9Q A;  3WHO A;  2CFK A;  2WGO A;  1I70 A;  1UI8 A;  2QEX 3;  2PZV A;  4FMA A;  1BNI A;  2UX0 A;  4G1M B;  2IYJ A;  4AKZ A;  2IUJ A;  2AAE A;  3F9S A;  2OTJ 3;  1DMQ A;  1E3R A;  4TX4 A;  3WOE B;  2LQV A;  1YNV X;  1BUQ A;  3KSE D;  1M1K 4;  3DGO A;  3DM8 A;  1W4N A;  1UGH I;  2CX0 A;  2D1W A;  3KSP A;  2I9W A;  1VQN 3;  1TUH A;  1UCL A;  1AQZ A;  2P09 A;  5KP3 A;  3CME 3;  1QAL A;  2F5W A;  3NM2 A;  1GOV A;  2KAA A;  5JBS A;  1QVF 2;  1V58 A;  1MOL A;  3ZG5 A;  1D6Y A;  1IVV A;  4WYK B;  1V57 A;  1TRP A;  3GZR A;  2CWU A;  1JKG A;  1PU4 A;  2F4Y A;  2CX1 A;  4Q53 A;  1STD A;  3RGR A;  3PCR A;  3E99 A;  1RTU A;  2K54 A;  2CFW A;  2GEY A;  1VQ6 3;  4WYK A;  3EC9 A;  1YHQ 3;  1WMO A;  2KRT A;  5IEP A;  1CYU A;  3JUQ A;  2BT3 A;  2UUG C;  5BIR A;  2W6J H;  2OWP A;  3CCJ 3;  1BAO A;  1LNI A;  1VQL 3;  1RN1 A;  3EB8 A;  6STD A;  4MJD A;  1WTH A;  3DUK A;  1B2Z A;  4N6L A;  4XM4 A;  1EQK A;  3F8H A;  2XGL A;  1D6Z A;  4AEQ A;  3F40 A;  1W2B 2;  1RRL A;  3KN4 A;  5CF2 A;  3MKI A;  1F8N A;  1T2H A;  1ISK A;  3MG1 A;  1RNB A;  1W6C A;  2BMQ B;  4CPK A;  3MWZ A;  3NBJ A;  2STD A;  5D83 A;  1W01 A;  1DVC A;  1KSI A;  2XF3 A;  3J7Y d;  4X2O A;  3WMD A;  1BAN A;  1DE3 A;  2E2T A;  4KT3 B;  1VQ4 3;  2W03 A;  4K1V A;  1LQM B;  1G02 A;  1CEW I;  1MNL A;  4BL3 A;  3Q3F A;  3NQY A;  1IVX A;  1Q7H A;  2CWV A;  4FMB A;  1LOX A;  5CK6 A;  2YX9 A;  4CCV A;  2RCD A;  2GU1 A;  9RNT A;  1M90 4;  3FF2 A;  3RDE A;  4EC6 A;  3VGN A;  2H0G A;  1O7M B;  1MWS A;  1Q81 4;  3LML A;  3V98 A;  1S72 3;  1A90 A;  5D81 A;  1IU7 A;  1B20 A;  3S67 A;  4N6O B;  1RKY A;  3T8N A;  4BTW A;  1A67 A;  4GL6 A;  1I2G A;  1CH0 A;  1Q42 A;  1SJW A;  1I3F A;  1RNT A;  1SAR A;  3BLZ A;  3AGO A;  3Q90 A;  4EYC A;  1EKM A;  1UCJ A;  1STF I;  1BSA A;  5DRV A;  3PS8 A;  3SYU A;  3O8Y A;  1HKX A;  3NHX A;  1N9E A;  4EBG A;  3S28 A;  1DVD A;  2BMR B;  1X1U A;  4XBT A;  4O2H A;  3B8L A;  3K7C A;  3UL5 A;  3G4S 3;  3G16 A;  3LZA A;  1OAC A;  3B4P A;  4GB5 A;  3HK4 A;  1NB5 I;  1KQS 2;  2P38 A;  3AHS A;  1FGQ A;  1X1Y A;  3BB9 A;  3CC2 3;  3CC7 3;  3AMO A;  3DGN A;  4MMY B;  2F56 A;  1BRJ A;  3NBB A;  2Z7A A;  2FNQ A;  4HM8 B;  1LRA A;  2F86 B;  3ROB A;  4I5Q A;  1UGI A;  1SPU A;  1VQ8 3;  3OXA A;  1M9G A;  1ULI B;  1O7P B;  3N54 B;  1AVK A;  4HM3 B;  1NO3 A;  2CKF B;  1BRG A;  1HYF A;  4MMZ B;  4WHA A;  2F99 A;  5BVB A;  2YFI B;  1A2P A;  4ZM8 A;  3S27 A;  3V92 A;  1RLS A;  2Y73 A;  2ML5 A;  4BU4 A;  3F7X A;  4MEI A;  1OHP A;  3X41 A;  1FGM A;  4EW5 A;  3FGY A;  2A15 A;  4NHF A;  4EV2 A;  4R9K A;  2RBI A;  3HI7 A;  1L5G B;  1ASK A;  2LYX A;  3FG1 A;  2L4V A;  1IYY A;  1JB2 A;  2KF6 A;  2K0M A;  2XRX B;  1FZU A;  1W7C A;  1VQO 3;  1YIT 3;  1RN4 A;  1GD3 A;  2XSH B;  3LXU X;  1FGR A;  3MSO A;  1OF5 A;  4HM1 B;  2H0H A;  4N6V 0;  3DGL A;  4HVN A;  1BSC A;  1GSP A;  1JNQ A;  3FF0 A;  2M7O A;  1RGL A;  1NB3 I;  3NUV A;  4AKY A;  3NQZ A;  4OK0 A;  5GSP A;  1RDS A;  5ELU A;  2F98 A;  4DKI A;  3X42 A;  4K1U A;  6RNT A;  3ECF A;  3CNM A;  2BU4 A;  4KZ1 A;  1RGK A;  3D79 A;  1IVW A;  1OHS A;  3GZX B;  1NNV A;  1TP6 A;  4HZB B;  3NX0 A;  1T2I A;  2IY2 A; 
#chains in the Genus database with same CATH homology
 1B2Z A;  1Q9E A;  3A5E A;  1BRH A;  1GOU A;  1B21 A;  1T2H A;  7GSP A;  1GMP A;  1RGF A;  1R4Y A;  1RNB A;  1BUJ A;  2RNT A;  1PY3 A;  3WR2 A;  1TRQ A;  6GSP A;  2AAD A;  1BAN A;  1DE3 A;  1BRI A;  1RMS A;  1I2E A;  2F5M A;  1RGE A;  2ZA4 A;  1G02 A;  1I0X A;  1I0V A;  3Q3F A;  1BGS A;  1YGW A;  1TTO A;  1BIR A;  1BSE A;  1BRS A;  4J5G A;  1BRN L;  9RNT A;  3D4A A;  2BIR A;  1X1W A;  1LOV A;  1BNG A;  1B20 A;  1JBS A;  5HOH A;  1BRK A;  3RNT A;  3D5G A;  1HZ1 A;  2HOH A;  2SAR A;  1FYS A;  1I2G A;  1CH0 A;  1B2U A;  1BU4 A;  2KF5 A;  1GOY A;  1UCK A;  1I3F A;  1RNT A;  1SAR A;  1B2M A;  3DGY A;  1JBT A;  1LOW A;  1UCI A;  3AGO A;  1BSB A;  1UCJ A;  3BU4 A;  4GHO A;  1RHL A;  1BSA A;  1MGW A;  1MGR A;  2KF4 A;  3SYU A;  1LOY A;  1BNS A;  2KF3 A;  1X1U A;  3URP A;  5BU4 A;  1BSD A;  1RSN A;  1FUT A;  4BIR A;  3GSP A;  1I2F A;  4RNT A;  3AHS A;  1X1Y A;  1FUS A;  2GSP A;  1BNR A;  4GSP A;  7RNT A;  1B2S A;  1DET A;  4HOH A;  1I3I A;  2F56 A;  1BRJ A;  1BNJ A;  3HOH A;  4HAA A;  1LRA A;  1PYL A;  3AHW A;  3WHO A;  5RNT A;  1I70 A;  3AGN A;  4J5K A;  2C4B A;  1BNI A;  1BRG A;  1HYF A;  1B3S A;  2AAE A;  1A2P A;  1GMR A;  1RLS A;  1YNV X;  3BIR A;  4BU4 A;  1C54 A;  1RCL A;  1BOX A;  1X1X A;  3D5I A;  1I8V A;  2RBI A;  1RGC A;  1UCL A;  1AQZ A;  1RGA A;  2F5W A;  1GOV A;  2KAA A;  1IYY A;  1AY7 A;  1BVI A;  2KF6 A;  1FZU A;  1FW7 A;  1RN4 A;  8RNT A;  1ZGX A;  1B2X A;  1TRP A;  3DH2 A;  1RGG A;  1YVS A;  1RGH A;  2F4Y A;  1BSC A;  1GSP A;  3KCH A;  1JBR A;  1RGL A;  1RTU A;  5GSP A;  1RDS A;  1B27 A;  1BNF A;  1GMQ A;  6RNT A;  5BIR A;  1BNE A;  1RCK A;  1BAO A;  1LNI A;  2BU4 A;  1RGK A;  1RN1 A;  1T2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...