9RNTA

Ribonuclease t1 with free recognition and catalytic site: crystal structure analysis at 1.5 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Ribonuclease T1 with free recognition and catalytic site: crystal structure analysis at 1.5 A resolution.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 9rntA00
1LOYA 1TRPA 3HOHA 1RGAA 9RNTA 1RGEA 3AGNA 3RNTA 1BRKA 3Q3FA 1DE3A 3AGOA 3SYUA 1RCLA 1BVIA 1GMQA 1PY3A 1I3IA 4GSPA 1BRNL 1B2XA 1RN4A 4RNTA 3AHSA 3A5EA 3WR2A 1RNTA 1BNJA 1UCLA 1GMPA 1LNIA 2AADA 1BRGA 3KCHA 3WHOA 1GOUA 1RHLA 1X1YA 7RNTA 1RDSA 2AAEA 1I70A 2KF5A 1CH0A 1I0VA 8RNTA 2BU4A 1A2PA 1B27A 3BIRA 3URPA 1SARA 2BIRA 1BRSA 1BNGA 5GSPA 1I3FA 1FW7A 1FUTA 2F5MA 2GSPA 1ZGXA 1MGRA 1LRAA 1B3SA 1GMRA 1I2GA 1YNVX 1I2EA 1RCKA 1RTUA 2KF6A 1RGCA 1G02A 1RGHA 1BAOA 1RSNA 1RMSA 2C4BA 1BNIA 1X1UA 1BNEA 1GSPA 1UCJA 4GHOA 1RGGA 4HAAA 4J5KA 4BIRA 1X1WA 1RGLA 5RNTA 1B2MA 1BSDA 1FUSA 1T2HA 1BNRA 1FZUA 1RLSA 1R4YA 1BIRA 5BU4A 1BOXA 1I2FA 1FYSA 1BNSA 1HYFA 3D5IA 1BRHA 3D4AA 1BNFA 1B2UA 1YVSA 1HZ1A 3BU4A 1AQZA 1I0XA 1BANA 2HOHA 4J5GA 1GOVA 1BSEA 1JBTA 2KF3A 1C54A 1X1XA 1LOVA 4HOHA 1PYLA 1TRQA 1TTOA 1UCKA 3AHWA 1B21A 1BU4A 1YGWA 1JBSA 2ZA4A 5BIRA 7GSPA 1DETA 2F5WA 6RNTA 1AY7A 1BSBA 1IYYA 1B20A 1B2SA 1BRIA 1GOYA 3GSPA 1B2ZA 1BSCA 1I8VA 3DGYA 3DH2A 1BGSA 1BSAA 1RGKA 2F4YA 2SARA 1MGWA 1LOWA 1BUJA 1RGFA 2F56A 1JBRA 2KF4A 1RNBA 2RNTA 2RBIA 1UCIA 6GSPA 4BU4A 1T2IA 1RN1A 1Q9EA 2KAAA 5HOHA 3D5GA 1BRJA
chains in the Genus database with same CATH superfamily
1LOYA 1KC84 3BNDA 5STDA 2H0IA 1M1XB 3CCE3 3KE7A 1GY6A 1RGEA 3AGNA 5D82A 1O7WB 1BRKA 3L0RA 9RNTA 2BT3A 1YI23 1IQYA 3Q3FA 5JPPA 3AGOA 4CDLA 2KRTA 1VQ93 1DE3A 5KP1A 1A67A 1GMQA 1PY3A 5IG0A 2IUKA 4EV2A 2CKFB 2XGLA 1J2BA 1RN4A 1Q42A 3N54B 1VQO3 1W6YA 3GZYB 2AADA 4L7KA 3KCHA 3F7SA 4L8OA 1YIJ3 1ROVA 7RNTA 1X1YA 1GD4A 2SBLA 3BNBA 1DMNA 1W6CA 2A15A 3LTDA 3WODG 2D42A 2JQ5A 8RNTA 3FG1A 3CC23 1B27A 3WOFB 3VSYA 2BIRA 3FSDA 1BRSA 1FGRA 1FUTA 2CWTA 2F86B 2GXFA 3KFQC 1K28A 2GSPA 4WYKA 3HIGA 1MGRA 1LRAA 2IYJA 3CCU3 1SQWA 1ZS7A 2Y74A 5AYRB 3RGRA 3CC43 3PCSA 4RZMA 4AKYA 2KF6A 2MC8A 1G02A 3IJEB 1JV2B 4GL6A 1RMSA 3J7Yd 1M1K4 1MNLA 1IVWA 1BNIA 1EUIC 3BNEA 3S27A 4DKIA 1X1UA 2Z76A 5FGOA 1IVVA 4OVMA 4RBNA 2HMLB 3D3LA 3V98A 1W00A 1W4NA 2CFLA 1DMMA 2L4VA 1UI8A 1LNHA 2QGUA 2ZDJA 3MKIA 2XF3A 2ML5A 3FZWA 2E2UA 3KZTA 3UL6A 5IW9A 2QA43 3LMLA 5IF6A 4H61A 3S29A 1EKMA 2XSHB 3MG2A 3VF1A 1VQK3 1OHSA 3B7CA 1BIRA 1GYBA 5BU4A 1BOXA 2CW9A 2WOHA 4FCJA 3CMA3 1YVBI 2OWPA 4FCZA 2CG1A 1CEWI 1JB2A 1HZ1A 1Q40B 2O3OA 3M8CA 2P05A 1W01A 1AQZA 2W9QA 1V74A 3N9HA 1NWWA 4PEJA 1PU4A 4G1MB 4J5GA 3K63A 2P0XA 1GOVA 4J9AA 4N6NB 3CCV3 2KF3A 1KQS2 1X1XA 1OF5B 2UGIA 1DVCA 1WMOA 2BMRB 3WDGB 3DGLA 1MWUA 4OK0A 1WTHA 3X3XA 2YFIB 3G713 5CK6A 2YFJB 3BLZA 3T0UA 1GY5A 4FR9A 3UJMA 5BIRA 2F98A 1N9EA 3B4OA 1SJWA 4HVNA 7GSPA 3G6E3 3CC73 4FMCA 1VQ63 3NQYA 1JN5B 2XFTA 1VZZA 1AY7A 2OCTA 1IYYA 1JKGA 2MF7A 5IERA 2WOFA 5AIFA 1B2ZA 4K1VA 4ILFA 2P38A 2GEYA 1LVNA 4MMXB 1IVUA 1GS3A 2F4YA 1JB5A 2INXA 1NDOB 1RGFA 1JBRA 3CXC2 3V92A 2GBWB 4EW5A 1MWTA 3EE1A 3NBJA 7STDA 5IEPA 5D81A 1HKXA 3CCM3 2V1LA 3PXMA 3ROBA 3T8UA 5HOHA 3D5GA 1BRJA 5EEOA 3B8LA 3I553 3G4S3 3NM2A 3JUQA 1ZO2A 1YJ93 2CFWA 4X2OA 4FMAA 1OPYA 1QALA 3IPTA 3ZG5A 2L1SA 4HKVB 3HI7A 4LSOA 4CCVA 1SIIA 4HM7B 4RNTA 3SX1A 1BUQA 4J8TA 3WR2A 1UGIA 3MG3A 4K1UA 1DYUA 2K0MA 2XRXB 2W04A 3FKAA 2BMOB 1R4CA 3JUOA 1EQKA 1F8NA 1JNQA 1RHLA 3DZLA 1ULJB 1KWIA 4R1KA 2AAEA 3LYGA 4MMYB 3PZWA 2KF5A 2CX1A 1VQN3 2JDIH 2OTJ3 1UUGB 1LQMB 1T5YA 3I0YA 1UW1A 5D83A 4EXRA 3GZXB 1BNGA 3EJVA 1I3FA 2BHMA 4LGQA 4EC6A 2CHCA 1S723 3CCS3 1FW7A 4R80A 4AKZA 3OX9A 2HMJB 5IEOA 1VQL3 1K734 3SOAA 3CME3 1GMRA 1VQ83 3WA2X 1KD14 1I2EA 4N6UA 3SEDA 1RGCA 3EN8A 3X40A 3FF0A 4WP5A 2YFLB 1RGHA 2B1XB 3PCRA 5IENA 4ZM8A 1OHPA 5ELUA 3CCJ3 1VQP3 4KFEA 1OGXA 2W56B 2OTL3 3EB8A 4HZ9B 3JUNA 2I9WA 3EBTA 5M1AA 3ZFZA 1OUNA 1N5PA 1UI7A 4IT7A 4BIRA 4HM0B 1NB5I 5RNTA 1OF5A 2P0MA 2XFSA 3DMCA 5IG4A 3CCL3 1B2MA 1BSDA 1FUSA 3D9RA 4N6OB 2Z7AA 1LXEA 4CJNA 4KFDA 4I4KA 3F7XA 1BNRA 3LT9A 2OOVA 5IG5A 4LZIA 5AIIA 1IV7A 3H3HA 3F9SA 3G16A 3ER7A 5TGNA 3X41A 1JZDA 3S28A 3D5IA 1JN5A 1Y4KA 5IG3A 1I0XA 2CC3A 5FW5A 4AEQA 1IT8A 2HOHA 3EBYA 1JBTA 1QMAA 1TJDA 2H0GA 1TRQA 2RSXA 3EX9A 1W5ZA 5CF2A 1B21A 2E2VA 3DXOA 1MOLA 4N6LA 1QAKA 2ZL8A 3STDA 4HM8B 3CNMA 3OWSA 1VQ43 1RN7A 1STFI 1JZOA 1PFPA 1B20A 3NM7A 5BXQA 4HM6B 1BSCA 5AEUB 1FGMA 1UDII 3K7CA 4Q53A 4HM5B 1A2VA 1BGSA 4XM4A 1VQQA 1RRLA 4EV5A 1BUJA 1YHQ3 3DY5A 3GAXA 4HZBB 3LTAA 3EN1B 1TP6A 1YJN3 1WNHA 2KF4A 4OUQA 1RNBA 2J8XB 2UUGC 2CK3H 3CPW2 4BTWA 1FUWA 4BU4A 1T2IA 2WGOA 4HM2B 1RN1A 4MEIA 1QAFA 2W0QA 3JUPA 3O8YA 1VQ73 3NBBA 8CHOA 3HK4A 3V99A 3HOHA 3FCSB 1RGAA 1FGQA 4N6V0 1K9M4 1O7MB 4EYCA 1TU5A 1MWSA 1O7PB 4O3VA 1IDPA 1D6YA 3A76A 4CPKA 2IMJA 1RCLA 1T3BA 4JRFA 4O02B 4GSPA 4LMIA 1B2XA 1FGTA 2OQEC 3AHSA 2W9PA 1YGEA 3A5EA 1RNTA 2RCDA 1UCLA 1HU9A 1GMPA 1LNIA 1W2ZA 1BRGA 1G0TA 3CCR3 3NV0B 3WHOA 1GOUA 3GWRA 1NNVA 3ZG0A 1I70A 1JRQA 2XR8B 1STDA 5EVHA 4EBGA 4WYKB 1VQ53 3FF2A 1UGHI 4HM1B 3NBRA 3G8ZA 3KSED 1WQLB 1CH0A 2BO9B 1RKYA 3BIRA 3Q90A 2W56A 1QJGA 1ASKA 2F99A 2RFRA 2KXGA 4KVHA 5DREA 5GSPA 2C11A 1S5AA 2F5MA 3K0ZA 1ZGXA 2LQVA 1Q7Y4 3E99A 1CYUA 2LYXA 2Z6BA 3F14A 1UUVB 4RNZA 5G1KA 1RSNA 1WMPA 1ZX2A 3F40A 1ULIB 2C4BA 3DUKA 3IMAB 5CLKA 4MJDA 4BTXA 3MG1A 3UL5A 3DM8A 1E3VA 2ML6A 1RGGA 3AMOB 3MHEA 4HAAA 3KSPA 4J5KA 4NREA 3KKGA 3CCQ3 4X2HA 1RGLA 2IA7A 1IQ8A 4N3VA 1TIJA 4XDWA 2WO0A 1T2HA 2W03A 5KP4A 1L5GB 4HM3B 2CWUA 3NQZA 1FZUA 2HMMB 1RLSA 3WOEB 3PGBA 4HM4B 1IU7A 2R41A 3B4PA 5AIHA 2GEXA 5JBSA 1E97A 4XBYA 1HYFA 1BRHA 2Q07A 4N6TA 3BU4A 3HZPA 3S67A 1NJI4 5AIGA 1BSEA 1OHOA 1NO3A 3MWZA 3K9MC 4HOHA 2PZVA 3SVAA 3CNXA 1CYVA 1FA3A 2GU3A 4N6MA 1TTOA 1JKGB 1TFKA 1UCKA 3HIIA 3OWUA 3HX8A 4I5QA 1Q40A 5KP3A 1BU4A 1YGWA 1ISKA 4FMBA 1JBSA 3T8NA 4LEHA 4O2HA 3U1WA 1DETA 1FGOA 2F5WA 1GD3A 6RNTA 5AEWB 4TX4A 1OGZA 4BL3A 1BSBA 4L8PA 3S5CA 1EG9B 1GOYA 1BRIA 2WGQA 3LZAA 2OOVC 3GSPA 5ELJA 1I8VA 3FG4A 2C10A 2CH9A 2YX9A 3BNCA 3GZRA 1M904 1BSAA 1RGKA 2SARA 3PS8A 3OW22 1A90A 1YJW3 1LOWA 4XBTA 2F56A 1Q7HA 1NU3A 4BTYA 1JJ22 5LC7A 1AR0A 1LOXA 2RNTA 1TFOA 1IV9A 3LH4A 2GBXB 1IT7A 3KIIA 3UB1A 1Q9EA 1SIHA 4IPBA 2KAAA 3UNLA 1MWRA 3N8BA 1TRPA 3NV0A 4KFFA 2CFDA 3SLUA 1C7HA 3RNTA 2E2TA 1K8A4 4NPBA 1W2B2 1OACA 3SYUA 4ORLA 1OH0A 3I563 1BVIA 5EQLA 3BB9A 3LTCA 1QVG2 1I3IA 4FCMA 1U5OA 1JB4A 4KZ1A 4JF8A 1BRNL 4GB5A 4WFOA 1UUWB 3FG3A 3LXUX 3Q2PA 1BNJA 4NHFA 3X3ZA 4WHAA 1Q824 1ROAA 4XB5A 1W6GA 2CX0A 2KCDA 1TUHA 5CF1A 2HMNB 1NB3I 2BNGA 2STDA 1RDSA 1GY7A 1A2KA 4KT3B 4BL2A 1AVKA 1W7CA 1I0VA 2O9UX 3NHXA 1IVXA 3NXJA 4R9KA 2BU4A 3MPHA 1A2PA 1K41A 2CG0A 3URPA 4HJLB 1SARA 1V58A 3CD63 1O7NB 3OWYA 1OCVA 1O7HB 3AMOA 3ALAA 3OV4A 4WWUC 1VQM3 2GU1A 3X3YA 2Y73A 5I97A 5JPUA 3FGYA 1V57A 2PNCA 3G0KA 3X42A 1QVF2 1B3SA 1I2GA 1YNVX 3CPOA 4STDA 1RCKA 1RTUA 6STDA 1AV4A 3CU3A 3FH1A 2K54A 1BAOA 5G2GA 4QWTA 1IQXA 3WMDA 1LQGC 1O7GB 2FGTA 3GRDA 1W02A 1WMNA 5G1LA 1BNEA 1GSPA 2W6JH 5LC6A 3QK9A 1US1A 1N8QA 1UCJA 3LOYA 4GHOA 3RGAA 3JVCA 2D1WA 3U97A 2P09A 1DVDA 5A0OB 2QEX3 5AYSC 1X1WA 4MMZB 3VGNA 3Q1CA 4RNYA 5BVBA 1SPUA 2XEPA 1RRHA 1Q864 3EC9A 4R9LA 2BMQB 1R4YA 2H0HA 2FNQA 1I2FA 2OQEA 1FYSA 1D6ZA 3DGOA 1BNSA 3DGNA 1N9JA 1AVLA 2W2CA 1BNFA 1N5HA 1YVSA 2M7OA 3D4AA 3GZBA 1EA2A 3KN4A 3MSOA 3LTBA 2XGNA 5DRVA 1BANA 2UX0A 3F8HA 3NUVA 5HGRA 1C54A 2K3DA 2CWVA 1LOVA 4H3UA 3QRDA 1PYLA 4U13A 3SOYA 4FMDA 3OXAA 3AHWA 1KSIA 3SXXA 2ZA4A 3NX0A 4K90B 2IY2A 3H51A 1Q814 2FXTA 2XSOB 2Z77A 3PYJA 3EQQB 1IK3A 3K5TA 4HBRA 4IIAA 4XBXA 2CFGA 3LT8A 1G96A 3JUMA 2QIYA 1B2SA 1DMQA 1RJOA 2R4IA 2B24B 3MYTA 4LYLB 3DGYA 1M9GA 3DH2A 3ECFA 5CXOA 2IUJA 5M18A 2ZHXB 5AI1A 1Z1SA 3D79A 1D6UA 1YIT3 1U8CB 1E3RA 1MGWA 2HMKB 4R4KA 4XDVA 2CFKA 2CIUA 3RDEA 2RBIA 3EHCA 3FLJA 1UCIA 5M19A 3F8XA 3TDGA 4K61A 6GSPA 3DGMA 3EF8A 1CQSA 2RGQA 4HYZA 1N8R4 2HMOB 2XH9A 1EEJA 4O8SA 3WA3A 1B2UA
chains in the Genus database with same CATH topology
1LOYA 1TRPA 3HOHA 1RGAA 9RNTA 1RGEA 3AGNA 3RNTA 1BRKA 3Q3FA 1DE3A 3AGOA 3SYUA 1RCLA 1BVIA 1GMQA 1PY3A 1I3IA 4GSPA 1BRNL 1B2XA 1RN4A 4RNTA 3AHSA 3A5EA 3WR2A 1RNTA 1BNJA 1UCLA 1GMPA 1LNIA 2AADA 1BRGA 3KCHA 3WHOA 1GOUA 1RHLA 1X1YA 7RNTA 1RDSA 2AAEA 1I70A 2KF5A 1CH0A 1I0VA 8RNTA 2BU4A 1A2PA 1B27A 3BIRA 3URPA 1SARA 2BIRA 1BRSA 1BNGA 5GSPA 1I3FA 1FW7A 1FUTA 2F5MA 2GSPA 1ZGXA 1MGRA 1LRAA 1B3SA 1GMRA 1I2GA 1YNVX 1I2EA 1RCKA 1RTUA 2KF6A 1RGCA 1G02A 1RGHA 1BAOA 1RSNA 1RMSA 2C4BA 1BNIA 1X1UA 1BNEA 1GSPA 1UCJA 4GHOA 1RGGA 4HAAA 4J5KA 4BIRA 1X1WA 1RGLA 5RNTA 1B2MA 1BSDA 1FUSA 1T2HA 1BNRA 1FZUA 1RLSA 1R4YA 1BIRA 5BU4A 1BOXA 1I2FA 1FYSA 1BNSA 1HYFA 3D5IA 1BRHA 3D4AA 1BNFA 1B2UA 1YVSA 1HZ1A 3BU4A 1AQZA 1I0XA 1BANA 2HOHA 4J5GA 1GOVA 1BSEA 1JBTA 2KF3A 1C54A 1X1XA 1LOVA 4HOHA 1PYLA 1TRQA 1TTOA 1UCKA 3AHWA 1B21A 1BU4A 1YGWA 1JBSA 2ZA4A 5BIRA 7GSPA 1DETA 2F5WA 6RNTA 1AY7A 1BSBA 1IYYA 1B20A 1B2SA 1BRIA 1GOYA 3GSPA 1B2ZA 1BSCA 1I8VA 3DGYA 3DH2A 1BGSA 1BSAA 1RGKA 2F4YA 2SARA 1MGWA 1LOWA 1BUJA 1RGFA 2F56A 1JBRA 2KF4A 1RNBA 2RNTA 2RBIA 1UCIA 6GSPA 4BU4A 1T2IA 1RN1A 1Q9EA 2KAAA 5HOHA 3D5GA 1BRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOY A;  1TRP A;  3HOH A;  1RGA A;  9RNT A;  1RGE A;  3AGN A;  3RNT A;  1BRK A;  3Q3F A;  1DE3 A;  3AGO A;  3SYU A;  1RCL A;  1BVI A;  1GMQ A;  1PY3 A;  1I3I A;  4GSP A;  1BRN L;  1B2X A;  1RN4 A;  4RNT A;  3AHS A;  3A5E A;  3WR2 A;  1RNT A;  1BNJ A;  1UCL A;  1GMP A;  1LNI A;  2AAD A;  1BRG A;  3KCH A;  3WHO A;  1GOU A;  1RHL A;  1X1Y A;  7RNT A;  1RDS A;  2AAE A;  1I70 A;  2KF5 A;  1CH0 A;  1I0V A;  8RNT A;  2BU4 A;  1A2P A;  1B27 A;  3BIR A;  3URP A;  1SAR A;  2BIR A;  1BRS A;  1BNG A;  5GSP A;  1I3F A;  1FW7 A;  1FUT A;  2F5M A;  2GSP A;  1ZGX A;  1MGR A;  1LRA A;  1B3S A;  1GMR A;  1I2G A;  1YNV X;  1I2E A;  1RCK A;  1RTU A;  2KF6 A;  1RGC A;  1G02 A;  1RGH A;  1BAO A;  1RSN A;  1RMS A;  2C4B A;  1BNI A;  1X1U A;  1BNE A;  1GSP A;  1UCJ A;  4GHO A;  1RGG A;  4HAA A;  4J5K A;  4BIR A;  1X1W A;  1RGL A;  5RNT A;  1B2M A;  1BSD A;  1FUS A;  1T2H A;  1BNR A;  1FZU A;  1RLS A;  1R4Y A;  1BIR A;  5BU4 A;  1BOX A;  1I2F A;  1FYS A;  1BNS A;  1HYF A;  3D5I A;  1BRH A;  3D4A A;  1BNF A;  1B2U A;  1YVS A;  1HZ1 A;  3BU4 A;  1AQZ A;  1I0X A;  1BAN A;  2HOH A;  4J5G A;  1GOV A;  1BSE A;  1JBT A;  2KF3 A;  1C54 A;  1X1X A;  1LOV A;  4HOH A;  1PYL A;  1TRQ A;  1TTO A;  1UCK A;  3AHW A;  1B21 A;  1BU4 A;  1YGW A;  1JBS A;  2ZA4 A;  5BIR A;  7GSP A;  1DET A;  2F5W A;  6RNT A;  1AY7 A;  1BSB A;  1IYY A;  1B20 A;  1B2S A;  1BRI A;  1GOY A;  3GSP A;  1B2Z A;  1BSC A;  1I8V A;  3DGY A;  3DH2 A;  1BGS A;  1BSA A;  1RGK A;  2F4Y A;  2SAR A;  1MGW A;  1LOW A;  1BUJ A;  1RGF A;  2F56 A;  1JBR A;  2KF4 A;  1RNB A;  2RNT A;  2RBI A;  1UCI A;  6GSP A;  4BU4 A;  1T2I A;  1RN1 A;  1Q9E A;  2KAA A;  5HOH A;  3D5G A;  1BRJ A; 
#chains in the Genus database with same CATH topology
 1LOY A;  1KC8 4;  3BND A;  5STD A;  2H0I A;  1M1X B;  3CCE 3;  3KE7 A;  1GY6 A;  1RGE A;  3AGN A;  5D82 A;  1O7W B;  1BRK A;  3L0R A;  9RNT A;  2BT3 A;  1YI2 3;  1IQY A;  3Q3F A;  5JPP A;  3AGO A;  4CDL A;  2KRT A;  1VQ9 3;  1DE3 A;  5KP1 A;  1A67 A;  1GMQ A;  1PY3 A;  5IG0 A;  2IUK A;  4EV2 A;  2CKF B;  2XGL A;  1J2B A;  1RN4 A;  1Q42 A;  3N54 B;  1VQO 3;  1W6Y A;  3GZY B;  2AAD A;  4L7K A;  3KCH A;  3F7S A;  4L8O A;  1YIJ 3;  1ROV A;  7RNT A;  1X1Y A;  1GD4 A;  2SBL A;  3BNB A;  1DMN A;  1W6C A;  2A15 A;  3LTD A;  3WOD G;  2D42 A;  2JQ5 A;  8RNT A;  3FG1 A;  3CC2 3;  1B27 A;  3WOF B;  3VSY A;  2BIR A;  3FSD A;  1BRS A;  1FGR A;  1FUT A;  2CWT A;  2F86 B;  2GXF A;  3KFQ C;  1K28 A;  2GSP A;  4WYK A;  3HIG A;  1MGR A;  1LRA A;  2IYJ A;  3CCU 3;  1SQW A;  1ZS7 A;  2Y74 A;  5AYR B;  3RGR A;  3CC4 3;  3PCS A;  4RZM A;  4AKY A;  2KF6 A;  2MC8 A;  1G02 A;  3IJE B;  1JV2 B;  4GL6 A;  1RMS A;  3J7Y d;  1M1K 4;  1MNL A;  1IVW A;  1BNI A;  1EUI C;  3BNE A;  3S27 A;  4DKI A;  1X1U A;  2Z76 A;  5FGO A;  1IVV A;  4OVM A;  4RBN A;  2HML B;  3D3L A;  3V98 A;  1W00 A;  1W4N A;  2CFL A;  1DMM A;  2L4V A;  1UI8 A;  1LNH A;  2QGU A;  2ZDJ A;  3MKI A;  2XF3 A;  2ML5 A;  3FZW A;  2E2U A;  3KZT A;  3UL6 A;  5IW9 A;  2QA4 3;  3LML A;  5IF6 A;  4H61 A;  3S29 A;  1EKM A;  2XSH B;  3MG2 A;  3VF1 A;  1VQK 3;  1OHS A;  3B7C A;  1BIR A;  1GYB A;  5BU4 A;  1BOX A;  2CW9 A;  2WOH A;  4FCJ A;  3CMA 3;  1YVB I;  2OWP A;  4FCZ A;  2CG1 A;  1CEW I;  1JB2 A;  1HZ1 A;  1Q40 B;  2O3O A;  3M8C A;  2P05 A;  1W01 A;  1AQZ A;  2W9Q A;  1V74 A;  3N9H A;  1NWW A;  4PEJ A;  1PU4 A;  4G1M B;  4J5G A;  3K63 A;  2P0X A;  1GOV A;  4J9A A;  4N6N B;  3CCV 3;  2KF3 A;  1KQS 2;  1X1X A;  1OF5 B;  2UGI A;  1DVC A;  1WMO A;  2BMR B;  3WDG B;  3DGL A;  1MWU A;  4OK0 A;  1WTH A;  3X3X A;  2YFI B;  3G71 3;  5CK6 A;  2YFJ B;  3BLZ A;  3T0U A;  1GY5 A;  4FR9 A;  3UJM A;  5BIR A;  2F98 A;  1N9E A;  3B4O A;  1SJW A;  4HVN A;  7GSP A;  3G6E 3;  3CC7 3;  4FMC A;  1VQ6 3;  3NQY A;  1JN5 B;  2XFT A;  1VZZ A;  1AY7 A;  2OCT A;  1IYY A;  1JKG A;  2MF7 A;  5IER A;  2WOF A;  5AIF A;  1B2Z A;  4K1V A;  4ILF A;  2P38 A;  2GEY A;  1LVN A;  4MMX B;  1IVU A;  1GS3 A;  2F4Y A;  1JB5 A;  2INX A;  1NDO B;  1RGF A;  1JBR A;  3CXC 2;  3V92 A;  2GBW B;  4EW5 A;  1MWT A;  3EE1 A;  3NBJ A;  7STD A;  5IEP A;  5D81 A;  1HKX A;  3CCM 3;  2V1L A;  3PXM A;  3ROB A;  3T8U A;  5HOH A;  3D5G A;  1BRJ A;  5EEO A;  3B8L A;  3I55 3;  3G4S 3;  3NM2 A;  3JUQ A;  1ZO2 A;  1YJ9 3;  2CFW A;  4X2O A;  4FMA A;  1OPY A;  1QAL A;  3IPT A;  3ZG5 A;  2L1S A;  4HKV B;  3HI7 A;  4LSO A;  4CCV A;  1SII A;  4HM7 B;  4RNT A;  3SX1 A;  1BUQ A;  4J8T A;  3WR2 A;  1UGI A;  3MG3 A;  4K1U A;  1DYU A;  2K0M A;  2XRX B;  2W04 A;  3FKA A;  2BMO B;  1R4C A;  3JUO A;  1EQK A;  1F8N A;  1JNQ A;  1RHL A;  3DZL A;  1ULJ B;  1KWI A;  4R1K A;  2AAE A;  3LYG A;  4MMY B;  3PZW A;  2KF5 A;  2CX1 A;  1VQN 3;  2JDI H;  2OTJ 3;  1UUG B;  1LQM B;  1T5Y A;  3I0Y A;  1UW1 A;  5D83 A;  4EXR A;  3GZX B;  1BNG A;  3EJV A;  1I3F A;  2BHM A;  4LGQ A;  4EC6 A;  2CHC A;  1S72 3;  3CCS 3;  1FW7 A;  4R80 A;  4AKZ A;  3OX9 A;  2HMJ B;  5IEO A;  1VQL 3;  1K73 4;  3SOA A;  3CME 3;  1GMR A;  1VQ8 3;  3WA2 X;  1KD1 4;  1I2E A;  4N6U A;  3SED A;  1RGC A;  3EN8 A;  3X40 A;  3FF0 A;  4WP5 A;  2YFL B;  1RGH A;  2B1X B;  3PCR A;  5IEN A;  4ZM8 A;  1OHP A;  5ELU A;  3CCJ 3;  1VQP 3;  4KFE A;  1OGX A;  2W56 B;  2OTL 3;  3EB8 A;  4HZ9 B;  3JUN A;  2I9W A;  3EBT A;  5M1A A;  3ZFZ A;  1OUN A;  1N5P A;  1UI7 A;  4IT7 A;  4BIR A;  4HM0 B;  1NB5 I;  5RNT A;  1OF5 A;  2P0M A;  2XFS A;  3DMC A;  5IG4 A;  3CCL 3;  1B2M A;  1BSD A;  1FUS A;  3D9R A;  4N6O B;  2Z7A A;  1LXE A;  4CJN A;  4KFD A;  4I4K A;  3F7X A;  1BNR A;  3LT9 A;  2OOV A;  5IG5 A;  4LZI A;  5AII A;  1IV7 A;  3H3H A;  3F9S A;  3G16 A;  3ER7 A;  5TGN A;  3X41 A;  1JZD A;  3S28 A;  3D5I A;  1JN5 A;  1Y4K A;  5IG3 A;  1I0X A;  2CC3 A;  5FW5 A;  4AEQ A;  1IT8 A;  2HOH A;  3EBY A;  1JBT A;  1QMA A;  1TJD A;  2H0G A;  1TRQ A;  2RSX A;  3EX9 A;  1W5Z A;  5CF2 A;  1B21 A;  2E2V A;  3DXO A;  1MOL A;  4N6L A;  1QAK A;  2ZL8 A;  3STD A;  4HM8 B;  3CNM A;  3OWS A;  1VQ4 3;  1RN7 A;  1STF I;  1JZO A;  1PFP A;  1B20 A;  3NM7 A;  5BXQ A;  4HM6 B;  1BSC A;  5AEU B;  1FGM A;  1UDI I;  3K7C A;  4Q53 A;  4HM5 B;  1A2V A;  1BGS A;  4XM4 A;  1VQQ A;  1RRL A;  4EV5 A;  1BUJ A;  1YHQ 3;  3DY5 A;  3GAX A;  4HZB B;  3LTA A;  3EN1 B;  1TP6 A;  1YJN 3;  1WNH A;  2KF4 A;  4OUQ A;  1RNB A;  2J8X B;  2UUG C;  2CK3 H;  3CPW 2;  4BTW A;  1FUW A;  4BU4 A;  1T2I A;  2WGO A;  4HM2 B;  1RN1 A;  4MEI A;  1QAF A;  2W0Q A;  3JUP A;  3O8Y A;  1VQ7 3;  3NBB A;  8CHO A;  3HK4 A;  3V99 A;  3HOH A;  3FCS B;  1RGA A;  1FGQ A;  4N6V 0;  1K9M 4;  1O7M B;  4EYC A;  1TU5 A;  1MWS A;  1O7P B;  4O3V A;  1IDP A;  1D6Y A;  3A76 A;  4CPK A;  2IMJ A;  1RCL A;  1T3B A;  4JRF A;  4O02 B;  4GSP A;  4LMI A;  1B2X A;  1FGT A;  2OQE C;  3AHS A;  2W9P A;  1YGE A;  3A5E A;  1RNT A;  2RCD A;  1UCL A;  1HU9 A;  1GMP A;  1LNI A;  1W2Z A;  1BRG A;  1G0T A;  3CCR 3;  3NV0 B;  3WHO A;  1GOU A;  3GWR A;  1NNV A;  3ZG0 A;  1I70 A;  1JRQ A;  2XR8 B;  1STD A;  5EVH A;  4EBG A;  4WYK B;  1VQ5 3;  3FF2 A;  1UGH I;  4HM1 B;  3NBR A;  3G8Z A;  3KSE D;  1WQL B;  1CH0 A;  2BO9 B;  1RKY A;  3BIR A;  3Q90 A;  2W56 A;  1QJG A;  1ASK A;  2F99 A;  2RFR A;  2KXG A;  4KVH A;  5DRE A;  5GSP A;  2C11 A;  1S5A A;  2F5M A;  3K0Z A;  1ZGX A;  2LQV A;  1Q7Y 4;  3E99 A;  1CYU A;  2LYX A;  2Z6B A;  3F14 A;  1UUV B;  4RNZ A;  5G1K A;  1RSN A;  1WMP A;  1ZX2 A;  3F40 A;  1ULI B;  2C4B A;  3DUK A;  3IMA B;  5CLK A;  4MJD A;  4BTX A;  3MG1 A;  3UL5 A;  3DM8 A;  1E3V A;  2ML6 A;  1RGG A;  3AMO B;  3MHE A;  4HAA A;  3KSP A;  4J5K A;  4NRE A;  3KKG A;  3CCQ 3;  4X2H A;  1RGL A;  2IA7 A;  1IQ8 A;  4N3V A;  1TIJ A;  4XDW A;  2WO0 A;  1T2H A;  2W03 A;  5KP4 A;  1L5G B;  4HM3 B;  2CWU A;  3NQZ A;  1FZU A;  2HMM B;  1RLS A;  3WOE B;  3PGB A;  4HM4 B;  1IU7 A;  2R41 A;  3B4P A;  5AIH A;  2GEX A;  5JBS A;  1E97 A;  4XBY A;  1HYF A;  1BRH A;  2Q07 A;  4N6T A;  3BU4 A;  3HZP A;  3S67 A;  1NJI 4;  5AIG A;  1BSE A;  1OHO A;  1NO3 A;  3MWZ A;  3K9M C;  4HOH A;  2PZV A;  3SVA A;  3CNX A;  1CYV A;  1FA3 A;  2GU3 A;  4N6M A;  1TTO A;  1JKG B;  1TFK A;  1UCK A;  3HII A;  3OWU A;  3HX8 A;  4I5Q A;  1Q40 A;  5KP3 A;  1BU4 A;  1YGW A;  1ISK A;  4FMB A;  1JBS A;  3T8N A;  4LEH A;  4O2H A;  3U1W A;  1DET A;  1FGO A;  2F5W A;  1GD3 A;  6RNT A;  5AEW B;  4TX4 A;  1OGZ A;  4BL3 A;  1BSB A;  4L8P A;  3S5C A;  1EG9 B;  1GOY A;  1BRI A;  2WGQ A;  3LZA A;  2OOV C;  3GSP A;  5ELJ A;  1I8V A;  3FG4 A;  2C10 A;  2CH9 A;  2YX9 A;  3BNC A;  3GZR A;  1M90 4;  1BSA A;  1RGK A;  2SAR A;  3PS8 A;  3OW2 2;  1A90 A;  1YJW 3;  1LOW A;  4XBT A;  2F56 A;  1Q7H A;  1NU3 A;  4BTY A;  1JJ2 2;  5LC7 A;  1AR0 A;  1LOX A;  2RNT A;  1TFO A;  1IV9 A;  3LH4 A;  2GBX B;  1IT7 A;  3KII A;  3UB1 A;  1Q9E A;  1SIH A;  4IPB A;  2KAA A;  3UNL A;  1MWR A;  3N8B A;  1TRP A;  3NV0 A;  4KFF A;  2CFD A;  3SLU A;  1C7H A;  3RNT A;  2E2T A;  1K8A 4;  4NPB A;  1W2B 2;  1OAC A;  3SYU A;  4ORL A;  1OH0 A;  3I56 3;  1BVI A;  5EQL A;  3BB9 A;  3LTC A;  1QVG 2;  1I3I A;  4FCM A;  1U5O A;  1JB4 A;  4KZ1 A;  4JF8 A;  1BRN L;  4GB5 A;  4WFO A;  1UUW B;  3FG3 A;  3LXU X;  3Q2P A;  1BNJ A;  4NHF A;  3X3Z A;  4WHA A;  1Q82 4;  1ROA A;  4XB5 A;  1W6G A;  2CX0 A;  2KCD A;  1TUH A;  5CF1 A;  2HMN B;  1NB3 I;  2BNG A;  2STD A;  1RDS A;  1GY7 A;  1A2K A;  4KT3 B;  4BL2 A;  1AVK A;  1W7C A;  1I0V A;  2O9U X;  3NHX A;  1IVX A;  3NXJ A;  4R9K A;  2BU4 A;  3MPH A;  1A2P A;  1K41 A;  2CG0 A;  3URP A;  4HJL B;  1SAR A;  1V58 A;  3CD6 3;  1O7N B;  3OWY A;  1OCV A;  1O7H B;  3AMO A;  3ALA A;  3OV4 A;  4WWU C;  1VQM 3;  2GU1 A;  3X3Y A;  2Y73 A;  5I97 A;  5JPU A;  3FGY A;  1V57 A;  2PNC A;  3G0K A;  3X42 A;  1QVF 2;  1B3S A;  1I2G A;  1YNV X;  3CPO A;  4STD A;  1RCK A;  1RTU A;  6STD A;  1AV4 A;  3CU3 A;  3FH1 A;  2K54 A;  1BAO A;  5G2G A;  4QWT A;  1IQX A;  3WMD A;  1LQG C;  1O7G B;  2FGT A;  3GRD A;  1W02 A;  1WMN A;  5G1L A;  1BNE A;  1GSP A;  2W6J H;  5LC6 A;  3QK9 A;  1US1 A;  1N8Q A;  1UCJ A;  3LOY A;  4GHO A;  3RGA A;  3JVC A;  2D1W A;  3U97 A;  2P09 A;  1DVD A;  5A0O B;  2QEX 3;  5AYS C;  1X1W A;  4MMZ B;  3VGN A;  3Q1C A;  4RNY A;  5BVB A;  1SPU A;  2XEP A;  1RRH A;  1Q86 4;  3EC9 A;  4R9L A;  2BMQ B;  1R4Y A;  2H0H A;  2FNQ A;  1I2F A;  2OQE A;  1FYS A;  1D6Z A;  3DGO A;  1BNS A;  3DGN A;  1N9J A;  1AVL A;  2W2C A;  1BNF A;  1N5H A;  1YVS A;  2M7O A;  3D4A A;  3GZB A;  1EA2 A;  3KN4 A;  3MSO A;  3LTB A;  2XGN A;  5DRV A;  1BAN A;  2UX0 A;  3F8H A;  3NUV A;  5HGR A;  1C54 A;  2K3D A;  2CWV A;  1LOV A;  4H3U A;  3QRD A;  1PYL A;  4U13 A;  3SOY A;  4FMD A;  3OXA A;  3AHW A;  1KSI A;  3SXX A;  2ZA4 A;  3NX0 A;  4K90 B;  2IY2 A;  3H51 A;  1Q81 4;  2FXT A;  2XSO B;  2Z77 A;  3PYJ A;  3EQQ B;  1IK3 A;  3K5T A;  4HBR A;  4IIA A;  4XBX A;  2CFG A;  3LT8 A;  1G96 A;  3JUM A;  2QIY A;  1B2S A;  1DMQ A;  1RJO A;  2R4I A;  2B24 B;  3MYT A;  4LYL B;  3DGY A;  1M9G A;  3DH2 A;  3ECF A;  5CXO A;  2IUJ A;  5M18 A;  2ZHX B;  5AI1 A;  1Z1S A;  3D79 A;  1D6U A;  1YIT 3;  1U8C B;  1E3R A;  1MGW A;  2HMK B;  4R4K A;  4XDV A;  2CFK A;  2CIU A;  3RDE A;  2RBI A;  3EHC A;  3FLJ A;  1UCI A;  5M19 A;  3F8X A;  3TDG A;  4K61 A;  6GSP A;  3DGM A;  3EF8 A;  1CQS A;  2RGQ A;  4HYZ A;  1N8R 4;  2HMO B;  2XH9 A;  1EEJ A;  4O8S A;  3WA3 A;  1B2U A; 
#chains in the Genus database with same CATH homology
 1LOY A;  1TRP A;  3HOH A;  1RGA A;  9RNT A;  1RGE A;  3AGN A;  3RNT A;  1BRK A;  3Q3F A;  1DE3 A;  3AGO A;  3SYU A;  1RCL A;  1BVI A;  1GMQ A;  1PY3 A;  1I3I A;  4GSP A;  1BRN L;  1B2X A;  1RN4 A;  4RNT A;  3AHS A;  3A5E A;  3WR2 A;  1RNT A;  1BNJ A;  1UCL A;  1GMP A;  1LNI A;  2AAD A;  1BRG A;  3KCH A;  3WHO A;  1GOU A;  1RHL A;  1X1Y A;  7RNT A;  1RDS A;  2AAE A;  1I70 A;  2KF5 A;  1CH0 A;  1I0V A;  8RNT A;  2BU4 A;  1A2P A;  1B27 A;  3BIR A;  3URP A;  1SAR A;  2BIR A;  1BRS A;  1BNG A;  5GSP A;  1I3F A;  1FW7 A;  1FUT A;  2F5M A;  2GSP A;  1ZGX A;  1MGR A;  1LRA A;  1B3S A;  1GMR A;  1I2G A;  1YNV X;  1I2E A;  1RCK A;  1RTU A;  2KF6 A;  1RGC A;  1G02 A;  1RGH A;  1BAO A;  1RSN A;  1RMS A;  2C4B A;  1BNI A;  1X1U A;  1BNE A;  1GSP A;  1UCJ A;  4GHO A;  1RGG A;  4HAA A;  4J5K A;  4BIR A;  1X1W A;  1RGL A;  5RNT A;  1B2M A;  1BSD A;  1FUS A;  1T2H A;  1BNR A;  1FZU A;  1RLS A;  1R4Y A;  1BIR A;  5BU4 A;  1BOX A;  1I2F A;  1FYS A;  1BNS A;  1HYF A;  3D5I A;  1BRH A;  3D4A A;  1BNF A;  1B2U A;  1YVS A;  1HZ1 A;  3BU4 A;  1AQZ A;  1I0X A;  1BAN A;  2HOH A;  4J5G A;  1GOV A;  1BSE A;  1JBT A;  2KF3 A;  1C54 A;  1X1X A;  1LOV A;  4HOH A;  1PYL A;  1TRQ A;  1TTO A;  1UCK A;  3AHW A;  1B21 A;  1BU4 A;  1YGW A;  1JBS A;  2ZA4 A;  5BIR A;  7GSP A;  1DET A;  2F5W A;  6RNT A;  1AY7 A;  1BSB A;  1IYY A;  1B20 A;  1B2S A;  1BRI A;  1GOY A;  3GSP A;  1B2Z A;  1BSC A;  1I8V A;  3DGY A;  3DH2 A;  1BGS A;  1BSA A;  1RGK A;  2F4Y A;  2SAR A;  1MGW A;  1LOW A;  1BUJ A;  1RGF A;  2F56 A;  1JBR A;  2KF4 A;  1RNB A;  2RNT A;  2RBI A;  1UCI A;  6GSP A;  4BU4 A;  1T2I A;  1RN1 A;  1Q9E A;  2KAA A;  5HOH A;  3D5G A;  1BRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...