1NNVA

The solution structure of hi1450
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
MTTEIKKLDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADDWEEEIGVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVIWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein HI1450
publication title Solution structure of the highly acidic protein HI1450 from Haemophilus influenzae, a putative double-stranded DNA mimic.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 16
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04269 DUF440 Protein of unknown function, DUF440
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.140 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, dsDNA mimic, putative 1nnvA01
1NNVA
chains in the Genus database with same CATH superfamily
5CK6A 3CC23 1DE3A 1O7MB 2L1SA 2KXGA 1LQGC 2OCTA 1RNBA 3DXOA 1A67A 2R41A 4LSOA 1GD4A 3MG1A 4OUQA 1GS3A 1EG9B 1UCKA 2MC8A 8RNTA 3F8HA 2BO9B 2E2TA 2KF5A 3CD63 2CH9A 4L7KA 1N5PA 1W6YA 1DETA 1W6GA 4HM7B 1KSIA 1W2B2 1Q7Y4 1EEJA 4EW5A 2HMKB 3LOYA 1JB4A 1B2UA 4WYKA 3UB1A 1T3BA 4GB5A 4R9LA 2CC3A 5DREA 3SXXA 1C7HA 3CCQ3 1ZO2A 2BNGA 4MMYB 1CEWI 2FGTA 5FW5A 3WOEB 4N6OB 3QRDA 3EN1B 3LTBA 2W6JH 3KN4A 3GRDA 2W9PA 3BLZA 2CFLA 3UL6A 1PY3A 1RN1A 1WMPA 3EF8A 1I3IA 2AADA 4FCZA 3N54B 4MJDA 4O8SA 5IW9A 1RGCA 1TP6A 1YI23 1BNRA 4EBGA 3FG1A 2HMMB 1UI7A 1PU4A 1MWTA 1YNVX 3KSPA 2E2UA 3CC73 4ZM8A 1BSBA 3NQYA 1GY7A 2RSXA 2ZDJA 3SEDA 4O02B 2CW9A 4AKYA 4EYCA 1ULJB 5IEPA 3Q1CA 1FUWA 1FUTA 4HYZA 3V99A 2AAEA 2WOFA 3A5EA 3MWZA 4WFOA 1T2HA 4KVHA 2IUJA 3FG4A 1IDPA 3GAXA 2W2CA 1FA3A 1GY5A 4IT7A 4HJLB 2YFLB 3HZPA 1UCIA 3PCRA 3N9HA 4EV5A 3X3XA 4HM2B 7STDA 4OVMA 3S67A 5IG3A 1FGRA 2RBIA 2M7OA 1VQN3 3OWUA 5TGNA 3CPOA 3KCHA 1RGLA 1VZZA 2ZL8A 3DGOA 3SYUA 2O3OA 3MG3A 1EA2A 2XSOB 1JBTA 2XF3A 2LQVA 5IG4A 1MWRA 2SARA 2CFDA 3D4AA 1FGOA 2OQEC 4ILFA 2IMJA 1Q814 1DMQA 4X2OA 3N8BA 2GU1A 4HZBB 5A0OB 3G713 5G1LA 1GYBA 3ZG5A 1D6UA 1Y4KA 1PYLA 4HM4B 1U5OA 1KQS2 5G1KA 3CCJ3 1AR0A 3GZXB 1O7GB 1VQ83 3FF2A 3CCU3 1TTOA 2GXFA 4O3VA 4HM3B 1OHSA 2H0HA 1DMMA 3V98A 1JKGA 1JN5B 1YJN3 2W03A 3PZWA 1OUNA 2P0MA 3UNLA 1OF5A 1UUVB 3MSOA 4HOHA 1R4YA 1O7WB 4KT3B 4BIRA 4N6V0 1HU9A 1K734 3EQQB 1YVSA 5D83A 3T8UA 1YIT3 1NB3I 2WO0A 3HK4A 3LYGA 4K1VA 4WHAA 4RZMA 3WODG 1I70A 1IT7A 2GU3A 2CFKA 1OACA 3ALAA 3NV0A 3JUPA 4N3VA 1IYYA 1I2GA 1T5YA 1V57A 2KF3A 3I563 2ZA4A 4OK0A 3DGLA 4FMCA 3G8ZA 5AEWB 2RCDA 3DM8A 5AYRB 5KP4A 1VQ43 3MYTA 4XDWA 2UUGC 3X42A 1UUGB 1RLSA 4G1MB 2OTJ3 1JB5A 3K9MC 2CWVA 1K41A 1RCKA 2MF7A 4GHOA 2CX1A 2Y73A 1SIHA 3A76A 3U1WA 3WA2X 1FUSA 3CPW2 2KF6A 1VQP3 1OCVA 2C11A 2CWUA 5EVHA 3MHEA 5HGRA 1RSNA 1UCJA 1RMSA 3LTCA 3RGAA 3WMDA 1GMQA 1GMRA 3IPTA 2F98A 3CCV3 2PZVA 2KRTA 1V74A 1JBRA 1RHLA 2XFSA 5IG0A 3L0RA 1SJWA 1BSDA 2HMLB 2H0GA 1M1XB 2ML5A 2HMOB 2CWTA 2BMRB 3DGYA 3WOFB 3GZBA 4BU4A 3KZTA 3JUOA 2QEX3 3BNDA 3G16A 3TDGA 5BU4A 3ROBA 1VQM3 1BVIA 1LXEA 2OTL3 1IQ8A 1GSPA 4K1UA 3VSYA 2CX0A 3VF1A 2WGQA 5RNTA 3UJMA 5LC7A 1YHQ3 1B2ZA 1ZX2A 3LXUX 4H3UA 1YIJ3 1ASKA 4XBYA 2IA7A 4L8PA 3S5CA 1BRIA 2A15A 4H61A 1N8QA 1BSAA 3NQZA 1J2BA 3AHWA 1RJOA 1GOYA 1WNHA 1IVWA 1Q42A 1IT8A 1YJ93 4GL6A 3KSED 5AIGA 1BRGA 1O7HB 1U8CB 1ZS7A 4CJNA 3M8CA 2B1XB 2F4YA 1RGEA 5CF2A 3ZG0A 3URPA 1BUJA 1OGZA 1WMNA 5D82A 4GSPA 2W56A 1YVBI 2BIRA 3F8XA 3GSPA 1UDII 1TU5A 1W7CA 3WHOA 1TFOA 1NB5I 1D6YA 2W04A 1TFKA 6RNTA 4EC6A 3T0UA 1JJ22 2ZHXB 3KFQC 1W4NA 3B7CA 4EV2A 3FKAA 1TUHA 3NBJA 3PS8A 1S723 1DVCA 4KFEA 1RN7A 5LC6A 3CCM3 1IVUA 3DGNA 3DUKA 1B2MA 2P05A 2XFTA 3CNXA 3VGNA 4FCJA 2HOHA 1GY6A 3WDGB 2XR8B 1UCLA 1VQO3 3BNEA 1KC84 1L5GB 3S29A 2CG0A 1E97A 3G4S3 1VQ73 1IVXA 1JNQA 2D42A 1AVKA 4XDVA 1VQ93 1RKYA 1W02A 2QGUA 3EBTA 1B2XA 3F40A 3CU3A 3H51A 1BNJA 3CMA3 5ELJA 3B8LA 4XBTA 1A2PA 1RRLA 1OHPA 4R9KA 3OW22 3KKGA 2BT3A 1JN5A 5BVBA 3HI7A 5JPPA 2CK3H 4HKVB 5I97A 4NHFA 1YGWA 1BANA 5EQLA 4FMBA 3MKIA 4QWTA 2IUKA 3RGRA 1M9GA 2H0IA 2W0QA 2GBXB 2XSHB 5KP3A 2F5WA 1B20A 2KF4A 5AIFA 3SOYA 4XB5A 3K63A 1K8A4 3O8YA 3WA3A 3BNCA 4HM6B 1F8NA 1AVLA 3FGYA 1MWUA 3EJVA 3K5TA 1FW7A 1LOYA 5G2GA 1ROAA 3GZRA 4R1KA 4PEJA 1BNEA 4KFFA 1IQXA 2RGQA 3FF0A 5AIIA 3EB8A 1KWIA 4FMAA 1FZUA 2BHMA 1JZOA 3K7CA 5D81A 4HM5B 5CF1A 2STDA 3SOAA 5IG5A 3WR2A 3DGMA 2QIYA 3G6E3 4JF8A 3STDA 2V1LA 1ROVA 3MG2A 1JV2B 1VQK3 3QK9A 3I0YA 2GEXA 2K3DA 4J8TA 1LOWA 5IF6A 3D3LA 3HX8A 2XH9A 3ZFZA 1VQ53 1LQMB 1QALA 1K9M4 1LRAA 3CCR3 3PCSA 1RGHA 1I0XA 1RTUA 1BRNL 2INXA 1G0TA 2BMOB 1SPUA 2FNQA 3AGNA 3OXAA 1B27A 3AGOA 2OWPA 3D5GA 1DMNA 3F9SA 3EX9A 3DMCA 4J5KA 3AMOB 4XBXA 1N9EA 2K0MA 2OOVC 2OOVA 1QVG2 2J8XB 2Q07A 4X2HA 3J7Yd 4LGQA 1DYUA 1G96A 5ELUA 1X1YA 1FGTA 3IJEB 2P0XA 3EC9A 1Q40B 1I0VA 4FMDA 1WTHA 3NBRA 4J5GA 3CME3 1SARA 3U97A 4HAAA 4LMIA 5FGOA 3CXC2 1LOXA 4MMXB 1BRJA 3JUNA 3LTAA 1CQSA 1UGHI 3NUVA 1FGMA 2CIUA 2F86B 3PXMA 4BTXA 4CDLA 1YJW3 1RGKA 4HBRA 3K0ZA 4K61A 1A2KA 1QAFA 1GOVA 1DVDA 4STDA 1VQ63 2F56A 4I4KA 4DKIA 3CNMA 3HOHA 1FYSA 1NDOB 4L8OA 1K28A 4BTWA 1TRQA 3UL5A 3HIIA 4AEQA 3RNTA 4LYLB 1RRHA 1JBSA 1FGQA 4LEHA 1BUQA 1I2FA 4R4KA 1BGSA 1BNGA 1NWWA 2W9QA 4IPBA 1N8R4 1CYVA 1RGFA 3CCL3 1VQL3 1STDA 1TRPA 2UX0A 4BL2A 4WWUC 3I553 1WMOA 2ML6A 2BU4A 1HZ1A 1BRHA 3FCSB 1YGEA 2FXTA 3X3YA 2L4VA 7GSPA 1Z1SA 3Q3FA 1GMPA 5GSPA 1N5HA 3SX1A 3CC43 2CKFB 1MOLA 3H3HA 5CLKA 1GOUA 2O9UX 4HZ9B 1A2VA 3F7XA 1C54A 1JRQA 4RNTA 2P09A 1LOVA 1E3RA 3Q90A 1X1UA 1Q864 2CFWA 1CH0A 2BMQB 2KAAA 3B4OA 3ECFA 3GZYB 2XGNA 4WYKB 1BRSA 3V92A 1Q7HA 3X41A 8CHOA 5M18A 4RNYA 1T2IA 4HM1B 1BAOA 1OHOA 1KD14 2XRXB 4N6MA 2YFJB 4NREA 2KCDA 5STDA 1M904 5M19A 3CCS3 1HYFA 3EBYA 3DH2A 2D1WA 3X40A 1Q824 3E99A 1A90A 3B4PA 2Y74A 2P38A 3BNBA 1QAKA 5AYSC 4FCMA 5AEUB 3PGBA 3KE7A 2JDIH 3MPHA 4IIAA 3FH1A 4CPKA 2IY2A 1V58A 1IK3A 3RDEA 1G02A 3NX0A 2RFRA 5BIRA 1OPYA 3FSDA 3D9RA 5HOHA 1LVNA 1US1A 3D5IA 3NHXA 4R80A 1AY7A 2W56B 1EUIC 3CCE3 4N6TA 1BSEA 3OWYA 3BU4A 1SQWA 2YX9A 1RGAA 1LNIA 4MMZB 1TJDA 3BB9A 3F7SA 5AI1A 1D6ZA 1IU7A 1E3VA 5CXOA 1JZDA 3NXJA 1O7NB 1BU4A 1RCLA 3OV4A 1AV4A 1RNTA 4O2HA 3IMAB 2R4IA 1EKMA 4RBNA 2WGOA 1O7PB 1JB2A 4CCVA 2PNCA 2B24B 3FZWA 2WOHA 5IERA 1NNVA 3JVCA 2YFIB 1UW1A 3X3ZA 4N6NB 2OQEA 2XEPA 4AKZA 3EE1A 2CG1A 1CYUA 1OH0A 4HVNA 3BIRA 3FG3A 1RDSA 2K54A 2Z6BA 1HKXA 1AQZA 1BNIA 1BNFA 1PFPA 1SIIA 3LTDA 1QJGA 3JUQA 3LZAA 6GSPA 1QVF2 3S27A 1QMAA 1NO3A 1MGWA 4EXRA 1UUWB 1W5ZA 2RNTA 2HMNB 1OGXA 5JBSA 1TIJA 3ER7A 3FLJA 4KZ1A 4I5QA 2QA43 3LT8A 2CHCA 5KP1A 1LNHA 1STFI 1VQQA 6STDA 3AMOA 1ZGXA 1W01A 1Q9EA 1B3SA 1BOXA 2F99A 4JRFA 3NM2A 2UGIA 1JKGB 3LH4A 3LT9A 4Q53A 1IQYA 2GSPA 3SVAA 2HMJB 1BSCA 1I2EA 1Q40A 5M1AA 1R4CA 1I8VA 1IV9A 3JUMA 4N6LA 3SLUA 1ISKA 2C10A 1OF5B 4U13A 3Q2PA 4NPBA 5IENA 2LYXA 1BRKA 1S5AA 2JQ5A 4HM0B 3NM7A 2Z7AA 1W2ZA 3AHSA 2IYJA 4FR9A 2CFGA 1ULIB 2Z77A 3LMLA 5DRVA 1W00A 3DY5A 5JPUA 1UGIA 4HM8B 2Z76A 3S28A 4BTYA 1GD3A 1IVVA 1B2SA 4KFDA 3NV0B 3PYJA 3KIIA 1WQLB 1M1K4 1I3FA 2F5MA 2XGLA 4XM4A 3T8NA 4K90B 1IV7A 1MWSA 2GEYA 2I9WA 4BL3A 7RNTA 1BNSA 1RGGA 1UI8A 9RNTA 5IEOA 1EQKA 2E2VA 3DZLA 3NBBA 3D79A 4WP5A 1BIRA 5BXQA 1X1XA 1X1WA 3OX9A 4J9AA 4ORLA 1NJI4 1B21A 4N6UA 4RNZA 1MNLA 1RN4A 1N9JA 2C4BA 3EN8A 1MGRA 3G0KA 3EHCA 1NU3A 4LZIA 2SBLA 3GWRA 1W6CA 5AIHA 3HIGA 4MEIA 3OWSA 2GBWB 4TX4A 5EEOA 3F14A
chains in the Genus database with same CATH topology
1NNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNV A; 
#chains in the Genus database with same CATH topology
 5CK6 A;  3CC2 3;  1DE3 A;  1O7M B;  2L1S A;  2KXG A;  1LQG C;  2OCT A;  1RNB A;  3DXO A;  1A67 A;  2R41 A;  4LSO A;  1GD4 A;  3MG1 A;  4OUQ A;  1GS3 A;  1EG9 B;  1UCK A;  2MC8 A;  8RNT A;  3F8H A;  2BO9 B;  2E2T A;  2KF5 A;  3CD6 3;  2CH9 A;  4L7K A;  1N5P A;  1W6Y A;  1DET A;  1W6G A;  4HM7 B;  1KSI A;  1W2B 2;  1Q7Y 4;  1EEJ A;  4EW5 A;  2HMK B;  3LOY A;  1JB4 A;  1B2U A;  4WYK A;  3UB1 A;  1T3B A;  4GB5 A;  4R9L A;  2CC3 A;  5DRE A;  3SXX A;  1C7H A;  3CCQ 3;  1ZO2 A;  2BNG A;  4MMY B;  1CEW I;  2FGT A;  5FW5 A;  3WOE B;  4N6O B;  3QRD A;  3EN1 B;  3LTB A;  2W6J H;  3KN4 A;  3GRD A;  2W9P A;  3BLZ A;  2CFL A;  3UL6 A;  1PY3 A;  1RN1 A;  1WMP A;  3EF8 A;  1I3I A;  2AAD A;  4FCZ A;  3N54 B;  4MJD A;  4O8S A;  5IW9 A;  1RGC A;  1TP6 A;  1YI2 3;  1BNR A;  4EBG A;  3FG1 A;  2HMM B;  1UI7 A;  1PU4 A;  1MWT A;  1YNV X;  3KSP A;  2E2U A;  3CC7 3;  4ZM8 A;  1BSB A;  3NQY A;  1GY7 A;  2RSX A;  2ZDJ A;  3SED A;  4O02 B;  2CW9 A;  4AKY A;  4EYC A;  1ULJ B;  5IEP A;  3Q1C A;  1FUW A;  1FUT A;  4HYZ A;  3V99 A;  2AAE A;  2WOF A;  3A5E A;  3MWZ A;  4WFO A;  1T2H A;  4KVH A;  2IUJ A;  3FG4 A;  1IDP A;  3GAX A;  2W2C A;  1FA3 A;  1GY5 A;  4IT7 A;  4HJL B;  2YFL B;  3HZP A;  1UCI A;  3PCR A;  3N9H A;  4EV5 A;  3X3X A;  4HM2 B;  7STD A;  4OVM A;  3S67 A;  5IG3 A;  1FGR A;  2RBI A;  2M7O A;  1VQN 3;  3OWU A;  5TGN A;  3CPO A;  3KCH A;  1RGL A;  1VZZ A;  2ZL8 A;  3DGO A;  3SYU A;  2O3O A;  3MG3 A;  1EA2 A;  2XSO B;  1JBT A;  2XF3 A;  2LQV A;  5IG4 A;  1MWR A;  2SAR A;  2CFD A;  3D4A A;  1FGO A;  2OQE C;  4ILF A;  2IMJ A;  1Q81 4;  1DMQ A;  4X2O A;  3N8B A;  2GU1 A;  4HZB B;  5A0O B;  3G71 3;  5G1L A;  1GYB A;  3ZG5 A;  1D6U A;  1Y4K A;  1PYL A;  4HM4 B;  1U5O A;  1KQS 2;  5G1K A;  3CCJ 3;  1AR0 A;  3GZX B;  1O7G B;  1VQ8 3;  3FF2 A;  3CCU 3;  1TTO A;  2GXF A;  4O3V A;  4HM3 B;  1OHS A;  2H0H A;  1DMM A;  3V98 A;  1JKG A;  1JN5 B;  1YJN 3;  2W03 A;  3PZW A;  1OUN A;  2P0M A;  3UNL A;  1OF5 A;  1UUV B;  3MSO A;  4HOH A;  1R4Y A;  1O7W B;  4KT3 B;  4BIR A;  4N6V 0;  1HU9 A;  1K73 4;  3EQQ B;  1YVS A;  5D83 A;  3T8U A;  1YIT 3;  1NB3 I;  2WO0 A;  3HK4 A;  3LYG A;  4K1V A;  4WHA A;  4RZM A;  3WOD G;  1I70 A;  1IT7 A;  2GU3 A;  2CFK A;  1OAC A;  3ALA A;  3NV0 A;  3JUP A;  4N3V A;  1IYY A;  1I2G A;  1T5Y A;  1V57 A;  2KF3 A;  3I56 3;  2ZA4 A;  4OK0 A;  3DGL A;  4FMC A;  3G8Z A;  5AEW B;  2RCD A;  3DM8 A;  5AYR B;  5KP4 A;  1VQ4 3;  3MYT A;  4XDW A;  2UUG C;  3X42 A;  1UUG B;  1RLS A;  4G1M B;  2OTJ 3;  1JB5 A;  3K9M C;  2CWV A;  1K41 A;  1RCK A;  2MF7 A;  4GHO A;  2CX1 A;  2Y73 A;  1SIH A;  3A76 A;  3U1W A;  3WA2 X;  1FUS A;  3CPW 2;  2KF6 A;  1VQP 3;  1OCV A;  2C11 A;  2CWU A;  5EVH A;  3MHE A;  5HGR A;  1RSN A;  1UCJ A;  1RMS A;  3LTC A;  3RGA A;  3WMD A;  1GMQ A;  1GMR A;  3IPT A;  2F98 A;  3CCV 3;  2PZV A;  2KRT A;  1V74 A;  1JBR A;  1RHL A;  2XFS A;  5IG0 A;  3L0R A;  1SJW A;  1BSD A;  2HML B;  2H0G A;  1M1X B;  2ML5 A;  2HMO B;  2CWT A;  2BMR B;  3DGY A;  3WOF B;  3GZB A;  4BU4 A;  3KZT A;  3JUO A;  2QEX 3;  3BND A;  3G16 A;  3TDG A;  5BU4 A;  3ROB A;  1VQM 3;  1BVI A;  1LXE A;  2OTL 3;  1IQ8 A;  1GSP A;  4K1U A;  3VSY A;  2CX0 A;  3VF1 A;  2WGQ A;  5RNT A;  3UJM A;  5LC7 A;  1YHQ 3;  1B2Z A;  1ZX2 A;  3LXU X;  4H3U A;  1YIJ 3;  1ASK A;  4XBY A;  2IA7 A;  4L8P A;  3S5C A;  1BRI A;  2A15 A;  4H61 A;  1N8Q A;  1BSA A;  3NQZ A;  1J2B A;  3AHW A;  1RJO A;  1GOY A;  1WNH A;  1IVW A;  1Q42 A;  1IT8 A;  1YJ9 3;  4GL6 A;  3KSE D;  5AIG A;  1BRG A;  1O7H B;  1U8C B;  1ZS7 A;  4CJN A;  3M8C A;  2B1X B;  2F4Y A;  1RGE A;  5CF2 A;  3ZG0 A;  3URP A;  1BUJ A;  1OGZ A;  1WMN A;  5D82 A;  4GSP A;  2W56 A;  1YVB I;  2BIR A;  3F8X A;  3GSP A;  1UDI I;  1TU5 A;  1W7C A;  3WHO A;  1TFO A;  1NB5 I;  1D6Y A;  2W04 A;  1TFK A;  6RNT A;  4EC6 A;  3T0U A;  1JJ2 2;  2ZHX B;  3KFQ C;  1W4N A;  3B7C A;  4EV2 A;  3FKA A;  1TUH A;  3NBJ A;  3PS8 A;  1S72 3;  1DVC A;  4KFE A;  1RN7 A;  5LC6 A;  3CCM 3;  1IVU A;  3DGN A;  3DUK A;  1B2M A;  2P05 A;  2XFT A;  3CNX A;  3VGN A;  4FCJ A;  2HOH A;  1GY6 A;  3WDG B;  2XR8 B;  1UCL A;  1VQO 3;  3BNE A;  1KC8 4;  1L5G B;  3S29 A;  2CG0 A;  1E97 A;  3G4S 3;  1VQ7 3;  1IVX A;  1JNQ A;  2D42 A;  1AVK A;  4XDV A;  1VQ9 3;  1RKY A;  1W02 A;  2QGU A;  3EBT A;  1B2X A;  3F40 A;  3CU3 A;  3H51 A;  1BNJ A;  3CMA 3;  5ELJ A;  3B8L A;  4XBT A;  1A2P A;  1RRL A;  1OHP A;  4R9K A;  3OW2 2;  3KKG A;  2BT3 A;  1JN5 A;  5BVB A;  3HI7 A;  5JPP A;  2CK3 H;  4HKV B;  5I97 A;  4NHF A;  1YGW A;  1BAN A;  5EQL A;  4FMB A;  3MKI A;  4QWT A;  2IUK A;  3RGR A;  1M9G A;  2H0I A;  2W0Q A;  2GBX B;  2XSH B;  5KP3 A;  2F5W A;  1B20 A;  2KF4 A;  5AIF A;  3SOY A;  4XB5 A;  3K63 A;  1K8A 4;  3O8Y A;  3WA3 A;  3BNC A;  4HM6 B;  1F8N A;  1AVL A;  3FGY A;  1MWU A;  3EJV A;  3K5T A;  1FW7 A;  1LOY A;  5G2G A;  1ROA A;  3GZR A;  4R1K A;  4PEJ A;  1BNE A;  4KFF A;  1IQX A;  2RGQ A;  3FF0 A;  5AII A;  3EB8 A;  1KWI A;  4FMA A;  1FZU A;  2BHM A;  1JZO A;  3K7C A;  5D81 A;  4HM5 B;  5CF1 A;  2STD A;  3SOA A;  5IG5 A;  3WR2 A;  3DGM A;  2QIY A;  3G6E 3;  4JF8 A;  3STD A;  2V1L A;  1ROV A;  3MG2 A;  1JV2 B;  1VQK 3;  3QK9 A;  3I0Y A;  2GEX A;  2K3D A;  4J8T A;  1LOW A;  5IF6 A;  3D3L A;  3HX8 A;  2XH9 A;  3ZFZ A;  1VQ5 3;  1LQM B;  1QAL A;  1K9M 4;  1LRA A;  3CCR 3;  3PCS A;  1RGH A;  1I0X A;  1RTU A;  1BRN L;  2INX A;  1G0T A;  2BMO B;  1SPU A;  2FNQ A;  3AGN A;  3OXA A;  1B27 A;  3AGO A;  2OWP A;  3D5G A;  1DMN A;  3F9S A;  3EX9 A;  3DMC A;  4J5K A;  3AMO B;  4XBX A;  1N9E A;  2K0M A;  2OOV C;  2OOV A;  1QVG 2;  2J8X B;  2Q07 A;  4X2H A;  3J7Y d;  4LGQ A;  1DYU A;  1G96 A;  5ELU A;  1X1Y A;  1FGT A;  3IJE B;  2P0X A;  3EC9 A;  1Q40 B;  1I0V A;  4FMD A;  1WTH A;  3NBR A;  4J5G A;  3CME 3;  1SAR A;  3U97 A;  4HAA A;  4LMI A;  5FGO A;  3CXC 2;  1LOX A;  4MMX B;  1BRJ A;  3JUN A;  3LTA A;  1CQS A;  1UGH I;  3NUV A;  1FGM A;  2CIU A;  2F86 B;  3PXM A;  4BTX A;  4CDL A;  1YJW 3;  1RGK A;  4HBR A;  3K0Z A;  4K61 A;  1A2K A;  1QAF A;  1GOV A;  1DVD A;  4STD A;  1VQ6 3;  2F56 A;  4I4K A;  4DKI A;  3CNM A;  3HOH A;  1FYS A;  1NDO B;  4L8O A;  1K28 A;  4BTW A;  1TRQ A;  3UL5 A;  3HII A;  4AEQ A;  3RNT A;  4LYL B;  1RRH A;  1JBS A;  1FGQ A;  4LEH A;  1BUQ A;  1I2F A;  4R4K A;  1BGS A;  1BNG A;  1NWW A;  2W9Q A;  4IPB A;  1N8R 4;  1CYV A;  1RGF A;  3CCL 3;  1VQL 3;  1STD A;  1TRP A;  2UX0 A;  4BL2 A;  4WWU C;  3I55 3;  1WMO A;  2ML6 A;  2BU4 A;  1HZ1 A;  1BRH A;  3FCS B;  1YGE A;  2FXT A;  3X3Y A;  2L4V A;  7GSP A;  1Z1S A;  3Q3F A;  1GMP A;  5GSP A;  1N5H A;  3SX1 A;  3CC4 3;  2CKF B;  1MOL A;  3H3H A;  5CLK A;  1GOU A;  2O9U X;  4HZ9 B;  1A2V A;  3F7X A;  1C54 A;  1JRQ A;  4RNT A;  2P09 A;  1LOV A;  1E3R A;  3Q90 A;  1X1U A;  1Q86 4;  2CFW A;  1CH0 A;  2BMQ B;  2KAA A;  3B4O A;  3ECF A;  3GZY B;  2XGN A;  4WYK B;  1BRS A;  3V92 A;  1Q7H A;  3X41 A;  8CHO A;  5M18 A;  4RNY A;  1T2I A;  4HM1 B;  1BAO A;  1OHO A;  1KD1 4;  2XRX B;  4N6M A;  2YFJ B;  4NRE A;  2KCD A;  5STD A;  1M90 4;  5M19 A;  3CCS 3;  1HYF A;  3EBY A;  3DH2 A;  2D1W A;  3X40 A;  1Q82 4;  3E99 A;  1A90 A;  3B4P A;  2Y74 A;  2P38 A;  3BNB A;  1QAK A;  5AYS C;  4FCM A;  5AEU B;  3PGB A;  3KE7 A;  2JDI H;  3MPH A;  4IIA A;  3FH1 A;  4CPK A;  2IY2 A;  1V58 A;  1IK3 A;  3RDE A;  1G02 A;  3NX0 A;  2RFR A;  5BIR A;  1OPY A;  3FSD A;  3D9R A;  5HOH A;  1LVN A;  1US1 A;  3D5I A;  3NHX A;  4R80 A;  1AY7 A;  2W56 B;  1EUI C;  3CCE 3;  4N6T A;  1BSE A;  3OWY A;  3BU4 A;  1SQW A;  2YX9 A;  1RGA A;  1LNI A;  4MMZ B;  1TJD A;  3BB9 A;  3F7S A;  5AI1 A;  1D6Z A;  1IU7 A;  1E3V A;  5CXO A;  1JZD A;  3NXJ A;  1O7N B;  1BU4 A;  1RCL A;  3OV4 A;  1AV4 A;  1RNT A;  4O2H A;  3IMA B;  2R4I A;  1EKM A;  4RBN A;  2WGO A;  1O7P B;  1JB2 A;  4CCV A;  2PNC A;  2B24 B;  3FZW A;  2WOH A;  5IER A;  1NNV A;  3JVC A;  2YFI B;  1UW1 A;  3X3Z A;  4N6N B;  2OQE A;  2XEP A;  4AKZ A;  3EE1 A;  2CG1 A;  1CYU A;  1OH0 A;  4HVN A;  3BIR A;  3FG3 A;  1RDS A;  2K54 A;  2Z6B A;  1HKX A;  1AQZ A;  1BNI A;  1BNF A;  1PFP A;  1SII A;  3LTD A;  1QJG A;  3JUQ A;  3LZA A;  6GSP A;  1QVF 2;  3S27 A;  1QMA A;  1NO3 A;  1MGW A;  4EXR A;  1UUW B;  1W5Z A;  2RNT A;  2HMN B;  1OGX A;  5JBS A;  1TIJ A;  3ER7 A;  3FLJ A;  4KZ1 A;  4I5Q A;  2QA4 3;  3LT8 A;  2CHC A;  5KP1 A;  1LNH A;  1STF I;  1VQQ A;  6STD A;  3AMO A;  1ZGX A;  1W01 A;  1Q9E A;  1B3S A;  1BOX A;  2F99 A;  4JRF A;  3NM2 A;  2UGI A;  1JKG B;  3LH4 A;  3LT9 A;  4Q53 A;  1IQY A;  2GSP A;  3SVA A;  2HMJ B;  1BSC A;  1I2E A;  1Q40 A;  5M1A A;  1R4C A;  1I8V A;  1IV9 A;  3JUM A;  4N6L A;  3SLU A;  1ISK A;  2C10 A;  1OF5 B;  4U13 A;  3Q2P A;  4NPB A;  5IEN A;  2LYX A;  1BRK A;  1S5A A;  2JQ5 A;  4HM0 B;  3NM7 A;  2Z7A A;  1W2Z A;  3AHS A;  2IYJ A;  4FR9 A;  2CFG A;  1ULI B;  2Z77 A;  3LML A;  5DRV A;  1W00 A;  3DY5 A;  5JPU A;  1UGI A;  4HM8 B;  2Z76 A;  3S28 A;  4BTY A;  1GD3 A;  1IVV A;  1B2S A;  4KFD A;  3NV0 B;  3PYJ A;  3KII A;  1WQL B;  1M1K 4;  1I3F A;  2F5M A;  2XGL A;  4XM4 A;  3T8N A;  4K90 B;  1IV7 A;  1MWS A;  2GEY A;  2I9W A;  4BL3 A;  7RNT A;  1BNS A;  1RGG A;  1UI8 A;  9RNT A;  5IEO A;  1EQK A;  2E2V A;  3DZL A;  3NBB A;  3D79 A;  4WP5 A;  1BIR A;  5BXQ A;  1X1X A;  1X1W A;  3OX9 A;  4J9A A;  4ORL A;  1NJI 4;  1B21 A;  4N6U A;  4RNZ A;  1MNL A;  1RN4 A;  1N9J A;  2C4B A;  3EN8 A;  1MGR A;  3G0K A;  3EHC A;  1NU3 A;  4LZI A;  2SBL A;  3GWR A;  1W6C A;  5AIH A;  3HIG A;  4MEI A;  3OWS A;  2GBW B;  4TX4 A;  5EEO A;  3F14 A; 
#chains in the Genus database with same CATH homology
 1NNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...