1NNVA

The solution structure of hi1450
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
b'MTTEIKKLDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADDWEEEIGVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVIWKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI1450
publication title Solution structure of the highly acidic protein HI1450 from Haemophilus influenzae, a putative double-stranded DNA mimic.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Unknown function
total genus 16
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04269 DUF440 Protein of unknown function, DUF440
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.140 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, dsDNA mimic, putative 1nnvA01
1NNVA
chains in the Genus database with same CATH superfamily
5GSPA 1OGXA 3NBJA 1UW1A 4EXRA 2XR8B 3WOEB 1AQZA 3A76A 3CCM3 2KRTA 5AIIA 2W56A 4RNTA 1DETA 1CEWI 3ALAA 1I0VA 1KWIA 1MGWA 1AVKA 3UL6A 4EC6A 3G0KA 1W6CA 1O7PB 2XEPA 5CLKA 3DGLA 3VGNA 1R4YA 2RCDA 2AADA 2KF3A 3AGOA 3LTDA 4WP5A 1GS3A 1PU4A 4FMBA 3MHEA 3F9SA 5I97A 3SEDA 4MMXB 2Y73A 5IG0A 3S5CA 2XSOB 4RZMA 1KSIA 3NBRA 1BRNL 1IVUA 1FGMA 2GEXA 4LGQA 3CMA3 5FW5A 3UNLA 4GSPA 1O7NB 1TU5A 1JN5A 2FXTA 2Z77A 4HM1B 1SPUA 4HBRA 4XBXA 3CXC2 1W4NA 1ROAA 3BB9A 3EE1A 3UJMA 2OTL3 1IU7A 2F99A 3UL5A 3X41A 1IVWA 4FMAA 4MMYB 1OHOA 4N6NB 3X3ZA 1O7MB 2YFJB 2ZL8A 4KT3B 1LNIA 1TFKA 1LOWA 1LOYA 1OGZA 1QALA 1GY5A 5ELUA 4MEIA 1GOYA 5D81A 1DYUA 3FZWA 1DMQA 1Q814 1A2KA 1RGCA 3LTCA 1AV4A 5G1LA 4RNYA 3DGMA 3BLZA 1MOLA 3FG4A 3SLUA 3CCL3 1O7WB 2KCDA 2UUGC 2F5MA 2IMJA 1YGWA 3FKAA 3RNTA 1OUNA 3KKGA 3LMLA 3S28A 1YVSA 3I553 5JPPA 9RNTA 1JB5A 2JQ5A 1UGIA 1DE3A 2XF3A 2ZA4A 3WR2A 5IG4A 3MWZA 1EQKA 1MWTA 1ASKA 3V92A 5IG3A 2F5WA 1S723 4HZBB 1T5YA 3BNBA 2OOVA 3ECFA 4QWTA 4KVHA 1GMRA 3KSED 1X1YA 3MPHA 2JDIH 2HMJB 4HJLB 1TRPA 2OCTA 3OXAA 3RGRA 1EUIC 3LZAA 4HKVB 2KAAA 2C4BA 2E2VA 1N8QA 2BT3A 1RCKA 5CK6A 1TFOA 1IT7A 2F86B 6STDA 1BNRA 1V57A 4BTWA 1SQWA 1BRKA 3EX9A 3CCJ3 3F8XA 3MYTA 2CWTA 5JBSA 2RBIA 4H61A 1SIHA 3GAXA 2CH9A 2LYXA 4HAAA 1E97A 3S27A 3VSYA 1SARA 2O9UX 3OWYA 4EV5A 4XB5A 4X2HA 1STDA 5A0OB 4N6MA 1JKGA 3KE7A 1BSEA 3QRDA 5KP3A 1IQXA 1EG9B 1ZX2A 1I0XA 1ZGXA 3CCE3 4J5KA 5TGNA 1GYBA 1C7HA 2CFDA 1RCLA 2CFKA 1VQ83 1BRSA 1MGRA 2P05A 1LQGC 3DGYA 1LNHA 4FMDA 4O02B 1FZUA 1BNGA 4XBYA 2QGUA 1A90A 4N6V0 1FW7A 1JZOA 4J5GA 1BRJA 1CH0A 4CDLA 1I70A 4K61A 5DRVA 1FUSA 2BO9B 5CF1A 3WA3A 3B4OA 1X1XA 4NHFA 1OH0A 1Z1SA 1L5GB 2HMMB 3GZYB 3I0YA 1BNEA 4XDVA 2P0XA 1FGOA 3GSPA 3X42A 5AYSC 4WFOA 3LTAA 3FSDA 5DREA 1BUQA 3KCHA 1BSCA 2R4IA 3PGBA 1FUTA 2SARA 3S67A 2CHCA 4O2HA 4HZ9B 2STDA 4K1VA 3A5EA 3S29A 1VQ93 1TTOA 3D79A 3OV4A 3CNXA 4R1KA 1W6YA 1G02A 1VQO3 2XFTA 3LH4A 1R4CA 1T3BA 2WO0A 3IMAB 1CYUA 1K734 7STDA 4MJDA 1UUVB 3D5IA 3NBBA 1Q824 1W00A 1GOVA 4LMIA 1B2ZA 3DMCA 1JRQA 3WODG 1BRGA 3DY5A 3T8UA 2ZHXB 1BSDA 2OWPA 1EA2A 1M1XB 4OVMA 1J2BA 2KF6A 1IK3A 1N5HA 1CYVA 2IA7A 5D82A 1GOUA 1BRHA 1YVBI 2QIYA 1LOXA 3EC9A 1RMSA 2F4YA 3LT8A 1QAKA 5KP1A 3CCR3 3L0RA 4OUQA 1AR0A 4FR9A 3DH2A 2XRXB 4HM3B 1IVVA 1ZO2A 5LC7A 1HZ1A 3GZXB 4GB5A 4WWUC 1ZS7A 3FGYA 4HM7B 4LEHA 3X3YA 3CCQ3 1B21A 1JN5B 1I8VA 3DZLA 1U8CB 3G8ZA 4BU4A 1BU4A 3HI7A 4NPBA 1FYSA 2BMOB 3H51A 4LZIA 2KF5A 2V1LA 1EKMA 2CFGA 3CME3 3LXUX 3GRDA 3EQQB 1I3FA 1QAFA 3KZTA 3EBTA 1NDOB 5HGRA 4ZM8A 1EEJA 1RN7A 3EN8A 3SXXA 2XSHB 4N3VA 4CPKA 2CIUA 3AMOA 3T0UA 3CU3A 1I2EA 1Q864 1SIIA 4IPBA 3SOAA 2BU4A 2FGTA 1UCLA 4GHOA 1UCIA 3Q3FA 3FG1A 4Q53A 1VQ73 5EVHA 1JZDA 1ULJB 2H0GA 1BSAA 1BNJA 5LC6A 2C10A 3Q2PA 2RNTA 3HIIA 1PY3A 3BU4A 3K7CA 5BIRA 1WMOA 1YHQ3 2CKFB 1G0TA 2ML6A 1OHPA 3MSOA 1JB4A 2XFSA 3AHSA 1I2GA 3NQYA 1TJDA 2B1XB 1BNFA 1GSPA 2QEX3 1TP6A 3BNCA 3WHOA 2L1SA 2WGQA 4HM8B 4N6TA 1JBTA 1K8A4 1M1K4 3EN1B 1WTHA 3O8YA 4AKYA 4L8OA 1IYYA 3UB1A 1V74A 2D1WA 3OW22 1NO3A 1RJOA 1QJGA 4MMZB 3HIGA 4NREA 1W02A 2BMQB 2HMKB 1NB5I 1KQS2 5STDA 3U1WA 3TDGA 4FCMA 1GD3A 3CCV3 4PEJA 3FCSB 1VQM3 1O7HB 1Q40A 1BIRA 1JKGB 1N8R4 3U97A 3HX8A 3NXJA 2KF4A 3B7CA 3PYJA 1G96A 3CCS3 2H0IA 1Q9EA 4K1UA 8RNTA 3K0ZA 4BL2A 2Q07A 3EHCA 1LQMB 2BHMA 1YJN3 1IQYA 1B2XA 1X1WA 3CC23 5M19A 3JUPA 1UUGB 4J9AA 3IPTA 7GSPA 1RNTA 5BU4A 1RN4A 1RRLA 1YIJ3 1BGSA 1LXEA 5HOHA 2ZDJA 1LOVA 4RNZA 4HM5B 2GSPA 3F40A 4WYKB 1E3RA 3DGNA 1JBRA 1IV9A 2AAEA 1VQ53 1VQQA 2RGQA 5D83A 2BNGA 3V98A 1CQSA 1MWSA 1NWWA 1T2HA 3JUOA 3D5GA 3K63A 3J7Yd 3G4S3 5RNTA 1RGEA 2BIRA 1VQ63 4L7KA 1VQN3 3WDGB 1V58A 2H0HA 2CWVA 2RSXA 4CCVA 3LYGA 1B2SA 3BNEA 2PZVA 4CJNA 1RSNA 3IJEB 3ZG0A 3MG1A 4EW5A 3N9HA 3LOYA 3MG2A 3EJVA 2CG0A 6RNTA 2W6JH 1GY7A 1WMNA 3SX1A 2W2CA 3CPOA 4KZ1A 1LRAA 1RGGA 1HKXA 2MC8A 2WOHA 4O8SA 3FF2A 1US1A 2RFRA 4R9LA 5AIGA 5IF6A 3E99A 2GU3A 4HM4B 4ORLA 3PS8A 5AEWB 1MWUA 1BNSA 5AEUB 2Y74A 5AIFA 3F7SA 3H3HA 2CWUA 1UCKA 1NU3A 2W56B 3FH1A 2B24B 2CW9A 1OHSA 4TX4A 3N8BA 4O3VA 1O7GB 4U13A 3D3LA 3PXMA 5AYRB 1VQP3 1I2FA 3RDEA 2GEYA 2E2UA 5G1KA 6GSPA 1M904 4EV2A 1B20A 3URPA 1YGEA 1A2VA 4XDWA 2W9QA 4EYCA 1QMAA 1U5OA 4AEQA 4IIAA 1SJWA 3PCSA 1OACA 1GY6A 5CXOA 7RNTA 4R80A 1N9EA 1IQ8A 3NHXA 3HK4A 1MWRA 1FGRA 4R9KA 3B4PA 3NV0A 3N54B 4N6LA 3OWUA 5EEOA 3ROBA 3AMOB 2CFWA 3WOFB 1BAOA 2E2TA 1AVLA 2YFIB 2HMLB 1AY7A 3LT9A 3LTBA 1IV7A 3M8CA 3OX9A 3OWSA 1F8NA 4R4KA 1N9JA 3EF8A 1BVIA 2W0QA 4HVNA 1KC84 1JJ22 4AKZA 2GBWB 3NQZA 1IVXA 1K41A 1UCJA 5BVBA 1S5AA 2CK3H 1X1UA 3DXOA 1YI23 1RGAA 1OF5A 5EQLA 2F98A 2FNQA 4HM2B 4HYZA 2P38A 3NM2A 4L8PA 2Z7AA 3FF0A 3CD63 1UDII 1MNLA 3PCRA 2HMNB 3PZWA 3B8LA 4FMCA 1Q7Y4 1QVF2 1M9GA 3FG3A 1W6GA 3F14A 5FGOA 4BL3A 4ILFA 1RTUA 1UGHI 2P09A 5CF2A 4FCJA 1RGKA 1E3VA 1UI8A 2WOFA 4I5QA 2MF7A 2CG1A 1D6YA 1FGQA 1WNHA 3D4AA 3KN4A 4HM6B 2A15A 3CPW2 3D9RA 3WA2X 1DVCA 1TRQA 1TUHA 3GWRA 5M1AA 3F8HA 1DVDA 2CFLA 4J8TA 3V99A 5IEPA 3DM8A 1JB2A 4KFEA 4LSOA 2IYJA 1W2B2 1FA3A 4HOHA 2OQEA 3ZFZA 5G2GA 1Q40B 3AGNA 1GD4A 3KFQC 1W5ZA 2Z76A 1D6ZA 2GBXB 3DUKA 3NUVA 3CCU3 1DMMA 1A2PA 1RKYA 1IT8A 3JUNA 3QK9A 1ISKA 3MG3A 1OCVA 2K0MA 3EB8A 3JVCA 4JF8A 4WHAA 4BIRA 5IW9A 1B2MA 3BIRA 1K28A 3HOHA 1RGFA 1A67A 2XGLA 2YX9A 3CC73 3NX0A 4RBNA 4XM4A 3G713 1DMNA 4K90B 2IUKA 4N6OB 1BSBA 2IY2A 1RLSA 1JBSA 2UGIA 1UI7A 2XGNA 3KSPA 1HU9A 1RGLA 4H3UA 3BNDA 3STDA 2BMRB 1LVNA 1BOXA 4HM0B 1BRIA 5BXQA 1D6UA 1OPYA 2GXFA 1N5PA 5IEOA 1C54A 1RHLA 1JNQA 2PNCA 4BTYA 2QA43 4LYLB 2K3DA 1QVG2 1HYFA 3AHWA 1BANA 1PFPA 1BNIA 2OQEC 2L4VA 2IUJA 3SVAA 3WMDA 4EBGA 1NNVA 2INXA 3FLJA 2CX1A 5IENA 1FGTA 5AI1A 5AIHA 1WMPA 1YIT3 1ULIB 5M18A 1B2UA 3K5TA 3NM7A 3SOYA 1VQ43 1VQL3 2SBLA 1B27A 1YJ93 1NJI4 3JUMA 2WGOA 2P0MA 3GZRA 4JRFA 1Q7HA 3SYUA 1VZZA 1W7CA 2I9WA 4GL6A 1GMPA 3X3XA 3KIIA 4DKIA 3ZG5A 8CHOA 1W01A 1WQLB 2D42A 2ML5A 1RNBA 1I3IA 2CX0A 5ELJA 5IERA 1JV2B 2LQVA 2W9PA 1RDSA 1ROVA 3F7XA 1RRHA 1YNVX 4XBTA 3T8NA 5JPUA 2OOVC 2C11A 3G6E3 2F56A 4IT7A 4G1MB 1NB3I 3EBYA 1T2IA 2K54A 2CC3A 3I563 2HOHA 4WYKA 3GZBA 3G16A 1W2ZA 4N6UA 2YFLB 1Y4KA 1RGHA 1KD14 4KFDA 1TIJA 4KFFA 1VQK3 2Z6BA 1PYLA 2OTJ3 3RGAA 4BTXA 5KP4A 1STFI 1FUWA 2O3OA 3DGOA 2W03A 1Q42A 1UUWB 3Q1CA 3ER7A 3NV0B 4FCZA 2R41A 2XH9A 2KXGA 2W04A 1K9M4 1BUJA 4OK0A 1GMQA 1IDPA 2GU1A 3JUQA 4X2OA 3X40A 4STDA 2M7OA 1YJW3 3K9MC 3CC43 2J8XB 1OF5B 2UX0A 1RN1A 3CNMA 3MKIA 1B3SA 3Q90A 5IG5A 4I4KA 2HMOB 3VF1A 3HZPA
chains in the Genus database with same CATH topology
1NNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNV A; 
#chains in the Genus database with same CATH topology
 5GSP A;  1OGX A;  3NBJ A;  1UW1 A;  4EXR A;  2XR8 B;  3WOE B;  1AQZ A;  3A76 A;  3CCM 3;  2KRT A;  5AII A;  2W56 A;  4RNT A;  1DET A;  1CEW I;  3ALA A;  1I0V A;  1KWI A;  1MGW A;  1AVK A;  3UL6 A;  4EC6 A;  3G0K A;  1W6C A;  1O7P B;  2XEP A;  5CLK A;  3DGL A;  3VGN A;  1R4Y A;  2RCD A;  2AAD A;  2KF3 A;  3AGO A;  3LTD A;  4WP5 A;  1GS3 A;  1PU4 A;  4FMB A;  3MHE A;  3F9S A;  5I97 A;  3SED A;  4MMX B;  2Y73 A;  5IG0 A;  3S5C A;  2XSO B;  4RZM A;  1KSI A;  3NBR A;  1BRN L;  1IVU A;  1FGM A;  2GEX A;  4LGQ A;  3CMA 3;  5FW5 A;  3UNL A;  4GSP A;  1O7N B;  1TU5 A;  1JN5 A;  2FXT A;  2Z77 A;  4HM1 B;  1SPU A;  4HBR A;  4XBX A;  3CXC 2;  1W4N A;  1ROA A;  3BB9 A;  3EE1 A;  3UJM A;  2OTL 3;  1IU7 A;  2F99 A;  3UL5 A;  3X41 A;  1IVW A;  4FMA A;  4MMY B;  1OHO A;  4N6N B;  3X3Z A;  1O7M B;  2YFJ B;  2ZL8 A;  4KT3 B;  1LNI A;  1TFK A;  1LOW A;  1LOY A;  1OGZ A;  1QAL A;  1GY5 A;  5ELU A;  4MEI A;  1GOY A;  5D81 A;  1DYU A;  3FZW A;  1DMQ A;  1Q81 4;  1A2K A;  1RGC A;  3LTC A;  1AV4 A;  5G1L A;  4RNY A;  3DGM A;  3BLZ A;  1MOL A;  3FG4 A;  3SLU A;  3CCL 3;  1O7W B;  2KCD A;  2UUG C;  2F5M A;  2IMJ A;  1YGW A;  3FKA A;  3RNT A;  1OUN A;  3KKG A;  3LML A;  3S28 A;  1YVS A;  3I55 3;  5JPP A;  9RNT A;  1JB5 A;  2JQ5 A;  1UGI A;  1DE3 A;  2XF3 A;  2ZA4 A;  3WR2 A;  5IG4 A;  3MWZ A;  1EQK A;  1MWT A;  1ASK A;  3V92 A;  5IG3 A;  2F5W A;  1S72 3;  4HZB B;  1T5Y A;  3BNB A;  2OOV A;  3ECF A;  4QWT A;  4KVH A;  1GMR A;  3KSE D;  1X1Y A;  3MPH A;  2JDI H;  2HMJ B;  4HJL B;  1TRP A;  2OCT A;  3OXA A;  3RGR A;  1EUI C;  3LZA A;  4HKV B;  2KAA A;  2C4B A;  2E2V A;  1N8Q A;  2BT3 A;  1RCK A;  5CK6 A;  1TFO A;  1IT7 A;  2F86 B;  6STD A;  1BNR A;  1V57 A;  4BTW A;  1SQW A;  1BRK A;  3EX9 A;  3CCJ 3;  3F8X A;  3MYT A;  2CWT A;  5JBS A;  2RBI A;  4H61 A;  1SIH A;  3GAX A;  2CH9 A;  2LYX A;  4HAA A;  1E97 A;  3S27 A;  3VSY A;  1SAR A;  2O9U X;  3OWY A;  4EV5 A;  4XB5 A;  4X2H A;  1STD A;  5A0O B;  4N6M A;  1JKG A;  3KE7 A;  1BSE A;  3QRD A;  5KP3 A;  1IQX A;  1EG9 B;  1ZX2 A;  1I0X A;  1ZGX A;  3CCE 3;  4J5K A;  5TGN A;  1GYB A;  1C7H A;  2CFD A;  1RCL A;  2CFK A;  1VQ8 3;  1BRS A;  1MGR A;  2P05 A;  1LQG C;  3DGY A;  1LNH A;  4FMD A;  4O02 B;  1FZU A;  1BNG A;  4XBY A;  2QGU A;  1A90 A;  4N6V 0;  1FW7 A;  1JZO A;  4J5G A;  1BRJ A;  1CH0 A;  4CDL A;  1I70 A;  4K61 A;  5DRV A;  1FUS A;  2BO9 B;  5CF1 A;  3WA3 A;  3B4O A;  1X1X A;  4NHF A;  1OH0 A;  1Z1S A;  1L5G B;  2HMM B;  3GZY B;  3I0Y A;  1BNE A;  4XDV A;  2P0X A;  1FGO A;  3GSP A;  3X42 A;  5AYS C;  4WFO A;  3LTA A;  3FSD A;  5DRE A;  1BUQ A;  3KCH A;  1BSC A;  2R4I A;  3PGB A;  1FUT A;  2SAR A;  3S67 A;  2CHC A;  4O2H A;  4HZ9 B;  2STD A;  4K1V A;  3A5E A;  3S29 A;  1VQ9 3;  1TTO A;  3D79 A;  3OV4 A;  3CNX A;  4R1K A;  1W6Y A;  1G02 A;  1VQO 3;  2XFT A;  3LH4 A;  1R4C A;  1T3B A;  2WO0 A;  3IMA B;  1CYU A;  1K73 4;  7STD A;  4MJD A;  1UUV B;  3D5I A;  3NBB A;  1Q82 4;  1W00 A;  1GOV A;  4LMI A;  1B2Z A;  3DMC A;  1JRQ A;  3WOD G;  1BRG A;  3DY5 A;  3T8U A;  2ZHX B;  1BSD A;  2OWP A;  1EA2 A;  1M1X B;  4OVM A;  1J2B A;  2KF6 A;  1IK3 A;  1N5H A;  1CYV A;  2IA7 A;  5D82 A;  1GOU A;  1BRH A;  1YVB I;  2QIY A;  1LOX A;  3EC9 A;  1RMS A;  2F4Y A;  3LT8 A;  1QAK A;  5KP1 A;  3CCR 3;  3L0R A;  4OUQ A;  1AR0 A;  4FR9 A;  3DH2 A;  2XRX B;  4HM3 B;  1IVV A;  1ZO2 A;  5LC7 A;  1HZ1 A;  3GZX B;  4GB5 A;  4WWU C;  1ZS7 A;  3FGY A;  4HM7 B;  4LEH A;  3X3Y A;  3CCQ 3;  1B21 A;  1JN5 B;  1I8V A;  3DZL A;  1U8C B;  3G8Z A;  4BU4 A;  1BU4 A;  3HI7 A;  4NPB A;  1FYS A;  2BMO B;  3H51 A;  4LZI A;  2KF5 A;  2V1L A;  1EKM A;  2CFG A;  3CME 3;  3LXU X;  3GRD A;  3EQQ B;  1I3F A;  1QAF A;  3KZT A;  3EBT A;  1NDO B;  5HGR A;  4ZM8 A;  1EEJ A;  1RN7 A;  3EN8 A;  3SXX A;  2XSH B;  4N3V A;  4CPK A;  2CIU A;  3AMO A;  3T0U A;  3CU3 A;  1I2E A;  1Q86 4;  1SII A;  4IPB A;  3SOA A;  2BU4 A;  2FGT A;  1UCL A;  4GHO A;  1UCI A;  3Q3F A;  3FG1 A;  4Q53 A;  1VQ7 3;  5EVH A;  1JZD A;  1ULJ B;  2H0G A;  1BSA A;  1BNJ A;  5LC6 A;  2C10 A;  3Q2P A;  2RNT A;  3HII A;  1PY3 A;  3BU4 A;  3K7C A;  5BIR A;  1WMO A;  1YHQ 3;  2CKF B;  1G0T A;  2ML6 A;  1OHP A;  3MSO A;  1JB4 A;  2XFS A;  3AHS A;  1I2G A;  3NQY A;  1TJD A;  2B1X B;  1BNF A;  1GSP A;  2QEX 3;  1TP6 A;  3BNC A;  3WHO A;  2L1S A;  2WGQ A;  4HM8 B;  4N6T A;  1JBT A;  1K8A 4;  1M1K 4;  3EN1 B;  1WTH A;  3O8Y A;  4AKY A;  4L8O A;  1IYY A;  3UB1 A;  1V74 A;  2D1W A;  3OW2 2;  1NO3 A;  1RJO A;  1QJG A;  4MMZ B;  3HIG A;  4NRE A;  1W02 A;  2BMQ B;  2HMK B;  1NB5 I;  1KQS 2;  5STD A;  3U1W A;  3TDG A;  4FCM A;  1GD3 A;  3CCV 3;  4PEJ A;  3FCS B;  1VQM 3;  1O7H B;  1Q40 A;  1BIR A;  1JKG B;  1N8R 4;  3U97 A;  3HX8 A;  3NXJ A;  2KF4 A;  3B7C A;  3PYJ A;  1G96 A;  3CCS 3;  2H0I A;  1Q9E A;  4K1U A;  8RNT A;  3K0Z A;  4BL2 A;  2Q07 A;  3EHC A;  1LQM B;  2BHM A;  1YJN 3;  1IQY A;  1B2X A;  1X1W A;  3CC2 3;  5M19 A;  3JUP A;  1UUG B;  4J9A A;  3IPT A;  7GSP A;  1RNT A;  5BU4 A;  1RN4 A;  1RRL A;  1YIJ 3;  1BGS A;  1LXE A;  5HOH A;  2ZDJ A;  1LOV A;  4RNZ A;  4HM5 B;  2GSP A;  3F40 A;  4WYK B;  1E3R A;  3DGN A;  1JBR A;  1IV9 A;  2AAE A;  1VQ5 3;  1VQQ A;  2RGQ A;  5D83 A;  2BNG A;  3V98 A;  1CQS A;  1MWS A;  1NWW A;  1T2H A;  3JUO A;  3D5G A;  3K63 A;  3J7Y d;  3G4S 3;  5RNT A;  1RGE A;  2BIR A;  1VQ6 3;  4L7K A;  1VQN 3;  3WDG B;  1V58 A;  2H0H A;  2CWV A;  2RSX A;  4CCV A;  3LYG A;  1B2S A;  3BNE A;  2PZV A;  4CJN A;  1RSN A;  3IJE B;  3ZG0 A;  3MG1 A;  4EW5 A;  3N9H A;  3LOY A;  3MG2 A;  3EJV A;  2CG0 A;  6RNT A;  2W6J H;  1GY7 A;  1WMN A;  3SX1 A;  2W2C A;  3CPO A;  4KZ1 A;  1LRA A;  1RGG A;  1HKX A;  2MC8 A;  2WOH A;  4O8S A;  3FF2 A;  1US1 A;  2RFR A;  4R9L A;  5AIG A;  5IF6 A;  3E99 A;  2GU3 A;  4HM4 B;  4ORL A;  3PS8 A;  5AEW B;  1MWU A;  1BNS A;  5AEU B;  2Y74 A;  5AIF A;  3F7S A;  3H3H A;  2CWU A;  1UCK A;  1NU3 A;  2W56 B;  3FH1 A;  2B24 B;  2CW9 A;  1OHS A;  4TX4 A;  3N8B A;  4O3V A;  1O7G B;  4U13 A;  3D3L A;  3PXM A;  5AYR B;  1VQP 3;  1I2F A;  3RDE A;  2GEY A;  2E2U A;  5G1K A;  6GSP A;  1M90 4;  4EV2 A;  1B20 A;  3URP A;  1YGE A;  1A2V A;  4XDW A;  2W9Q A;  4EYC A;  1QMA A;  1U5O A;  4AEQ A;  4IIA A;  1SJW A;  3PCS A;  1OAC A;  1GY6 A;  5CXO A;  7RNT A;  4R80 A;  1N9E A;  1IQ8 A;  3NHX A;  3HK4 A;  1MWR A;  1FGR A;  4R9K A;  3B4P A;  3NV0 A;  3N54 B;  4N6L A;  3OWU A;  5EEO A;  3ROB A;  3AMO B;  2CFW A;  3WOF B;  1BAO A;  2E2T A;  1AVL A;  2YFI B;  2HML B;  1AY7 A;  3LT9 A;  3LTB A;  1IV7 A;  3M8C A;  3OX9 A;  3OWS A;  1F8N A;  4R4K A;  1N9J A;  3EF8 A;  1BVI A;  2W0Q A;  4HVN A;  1KC8 4;  1JJ2 2;  4AKZ A;  2GBW B;  3NQZ A;  1IVX A;  1K41 A;  1UCJ A;  5BVB A;  1S5A A;  2CK3 H;  1X1U A;  3DXO A;  1YI2 3;  1RGA A;  1OF5 A;  5EQL A;  2F98 A;  2FNQ A;  4HM2 B;  4HYZ A;  2P38 A;  3NM2 A;  4L8P A;  2Z7A A;  3FF0 A;  3CD6 3;  1UDI I;  1MNL A;  3PCR A;  2HMN B;  3PZW A;  3B8L A;  4FMC A;  1Q7Y 4;  1QVF 2;  1M9G A;  3FG3 A;  1W6G A;  3F14 A;  5FGO A;  4BL3 A;  4ILF A;  1RTU A;  1UGH I;  2P09 A;  5CF2 A;  4FCJ A;  1RGK A;  1E3V A;  1UI8 A;  2WOF A;  4I5Q A;  2MF7 A;  2CG1 A;  1D6Y A;  1FGQ A;  1WNH A;  3D4A A;  3KN4 A;  4HM6 B;  2A15 A;  3CPW 2;  3D9R A;  3WA2 X;  1DVC A;  1TRQ A;  1TUH A;  3GWR A;  5M1A A;  3F8H A;  1DVD A;  2CFL A;  4J8T A;  3V99 A;  5IEP A;  3DM8 A;  1JB2 A;  4KFE A;  4LSO A;  2IYJ A;  1W2B 2;  1FA3 A;  4HOH A;  2OQE A;  3ZFZ A;  5G2G A;  1Q40 B;  3AGN A;  1GD4 A;  3KFQ C;  1W5Z A;  2Z76 A;  1D6Z A;  2GBX B;  3DUK A;  3NUV A;  3CCU 3;  1DMM A;  1A2P A;  1RKY A;  1IT8 A;  3JUN A;  3QK9 A;  1ISK A;  3MG3 A;  1OCV A;  2K0M A;  3EB8 A;  3JVC A;  4JF8 A;  4WHA A;  4BIR A;  5IW9 A;  1B2M A;  3BIR A;  1K28 A;  3HOH A;  1RGF A;  1A67 A;  2XGL A;  2YX9 A;  3CC7 3;  3NX0 A;  4RBN A;  4XM4 A;  3G71 3;  1DMN A;  4K90 B;  2IUK A;  4N6O B;  1BSB A;  2IY2 A;  1RLS A;  1JBS A;  2UGI A;  1UI7 A;  2XGN A;  3KSP A;  1HU9 A;  1RGL A;  4H3U A;  3BND A;  3STD A;  2BMR B;  1LVN A;  1BOX A;  4HM0 B;  1BRI A;  5BXQ A;  1D6U A;  1OPY A;  2GXF A;  1N5P A;  5IEO A;  1C54 A;  1RHL A;  1JNQ A;  2PNC A;  4BTY A;  2QA4 3;  4LYL B;  2K3D A;  1QVG 2;  1HYF A;  3AHW A;  1BAN A;  1PFP A;  1BNI A;  2OQE C;  2L4V A;  2IUJ A;  3SVA A;  3WMD A;  4EBG A;  1NNV A;  2INX A;  3FLJ A;  2CX1 A;  5IEN A;  1FGT A;  5AI1 A;  5AIH A;  1WMP A;  1YIT 3;  1ULI B;  5M18 A;  1B2U A;  3K5T A;  3NM7 A;  3SOY A;  1VQ4 3;  1VQL 3;  2SBL A;  1B27 A;  1YJ9 3;  1NJI 4;  3JUM A;  2WGO A;  2P0M A;  3GZR A;  4JRF A;  1Q7H A;  3SYU A;  1VZZ A;  1W7C A;  2I9W A;  4GL6 A;  1GMP A;  3X3X A;  3KII A;  4DKI A;  3ZG5 A;  8CHO A;  1W01 A;  1WQL B;  2D42 A;  2ML5 A;  1RNB A;  1I3I A;  2CX0 A;  5ELJ A;  5IER A;  1JV2 B;  2LQV A;  2W9P A;  1RDS A;  1ROV A;  3F7X A;  1RRH A;  1YNV X;  4XBT A;  3T8N A;  5JPU A;  2OOV C;  2C11 A;  3G6E 3;  2F56 A;  4IT7 A;  4G1M B;  1NB3 I;  3EBY A;  1T2I A;  2K54 A;  2CC3 A;  3I56 3;  2HOH A;  4WYK A;  3GZB A;  3G16 A;  1W2Z A;  4N6U A;  2YFL B;  1Y4K A;  1RGH A;  1KD1 4;  4KFD A;  1TIJ A;  4KFF A;  1VQK 3;  2Z6B A;  1PYL A;  2OTJ 3;  3RGA A;  4BTX A;  5KP4 A;  1STF I;  1FUW A;  2O3O A;  3DGO A;  2W03 A;  1Q42 A;  1UUW B;  3Q1C A;  3ER7 A;  3NV0 B;  4FCZ A;  2R41 A;  2XH9 A;  2KXG A;  2W04 A;  1K9M 4;  1BUJ A;  4OK0 A;  1GMQ A;  1IDP A;  2GU1 A;  3JUQ A;  4X2O A;  3X40 A;  4STD A;  2M7O A;  1YJW 3;  3K9M C;  3CC4 3;  2J8X B;  1OF5 B;  2UX0 A;  1RN1 A;  3CNM A;  3MKI A;  1B3S A;  3Q90 A;  5IG5 A;  4I4K A;  2HMO B;  3VF1 A;  3HZP A; 
#chains in the Genus database with same CATH homology
 1NNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...