1NNVA

The solution structure of hi1450
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
MTTEIKKLDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADDWEEEIGVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVIWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI1450
publication title Solution structure of the highly acidic protein HI1450 from Haemophilus influenzae, a putative double-stranded DNA mimic.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Unknown function
total genus 16
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04269 DUF440 Protein of unknown function, DUF440
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.140 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, dsDNA mimic, putative 1nnvA01
1NNVA
chains in the Genus database with same CATH superfamily
3I0YA 4O2HA 4EV2A 2W9QA 1IK3A 3DY5A 1FGMA 1AVKA 3MYTA 3FGYA 4X2HA 3EHCA 5CLKA 3FG1A 3DGNA 3AHSA 3AHWA 3AMOA 2CHCA 3WODG 2JQ5A 3UNLA 3LZAA 3K5TA 3SLUA 1K41A 1PFPA 2C10A 3LOYA 3SX1A 1WMNA 1S5AA 3VGNA 1T5YA 2ML5A 3D5IA 1JZOA 2CFGA 5AIIA 3MHEA 2CC3A 1O7HB 3G4S3 3UL6A 2FNQA 2Q07A 1ASKA 1KWIA 3SVAA 3SXXA 1IVUA 3OV4A 2STDA 2F5WA 3KSED 1B21A 1WQLB 3ROBA 5CXOA 5IEPA 3CC43 1IV7A 1W00A 2W2CA 5D81A 3MWZA 3EB8A 3GAXA 2CFKA 4XM4A 4RNYA 3S67A 1N5PA 3LTCA 5HGRA 1GY5A 3S5CA 5IEOA 3LT9A 1JKGB 2QEX3 1QVG2 1ULIB 2GEYA 3CNXA 1LQMB 3DM8A 4NREA 4GL6A 1MWTA 4HKVB 1OHOA 3KCHA 4KFFA 3CCE3 4I4KA 3OXAA 3PCSA 3SEDA 4N6UA 2P0XA 4HM7B 4LGQA 3G16A 1M1K4 4EBGA 1CH0A 1T3BA 1VQM3 1MGWA 1GMRA 2CWTA 4N6NB 3MG2A 3O8YA 1BSBA 1YJ93 1GOVA 4H3UA 1FZUA 5BVBA 2H0IA 1GOYA 1U8CB 3PCRA 1OF5B 2XEPA 1BRKA 1BGSA 4BTXA 1FGOA 4K61A 3EE1A 1NO3A 2CFLA 2RSXA 4IPBA 1JN5A 1IU7A 3IPTA 2F98A 2W04A 1BNSA 1WNHA 2F5MA 3HK4A 1W5ZA 3N8BA 4N6V0 3CNMA 3F14A 5EQLA 5BXQA 5IENA 4MJDA 4N6TA 1MOLA 1UCKA 1X1UA 2KCDA 2P09A 3FF2A 4HM1B 3CPW2 1AY7A 1G96A 1IVXA 2GBWB 4GB5A 1W7CA 3D4AA 1W6CA 2J8XB 2C11A 4EV5A 1NNVA 2ZA4A 1UGIA 1JZDA 1I0XA 5BIRA 4LEHA 4AKYA 1ROVA 1UDII 3F8HA 3OWUA 5GSPA 1RCKA 4AKZA 1EKMA 1BAOA 4BIRA 3AMOB 3N9HA 4STDA 4HZBB 3FCSB 1JB2A 4K1UA 1BUQA 3AGOA 5I97A 1IDPA 1LNHA 3UB1A 4I5QA 2W03A 3NV0A 1B2XA 1B27A 1K9M4 2BMQB 5AIHA 1FW7A 4U13A 3RDEA 1NU3A 4R4KA 4BL2A 1RGAA 1YHQ3 3PZWA 1VQ83 4FMAA 1BNJA 2UX0A 2XR8B 4GHOA 1DMNA 3L0RA 1IV9A 1Z1SA 3HIIA 2IUJA 4R9KA 3CCV3 1TUHA 2BT3A 1WMPA 3STDA 4QWTA 4K90B 3CCQ3 1VQL3 1JBTA 1EEJA 1R4YA 3DH2A 2CIUA 1BRIA 2FGTA 3PS8A 3X3ZA 1W6YA 3CCS3 2P38A 5HOHA 2CWUA 1ISKA 3OWYA 3ZG5A 1LQGC 2B1XB 2B24B 5IG3A 5IG4A 1BRNL 1UW1A 4BL3A 2O3OA 4XB5A 4IIAA 1HZ1A 4MMYB 3CCU3 3D3LA 1BNEA 3WA2X 2YFIB 1B20A 2GSPA 1V57A 1O7WB 3QRDA 3ZG0A 4NPBA 7STDA 5KP4A 1IVVA 4BTYA 4FMDA 4R9LA 8RNTA 4HOHA 1I3FA 1I2EA 5IG5A 2OOVA 1RSNA 1Q814 3KIIA 4OUQA 1UCIA 4GSPA 5FGOA 3BU4A 4EXRA 2CFWA 2WGQA 3NBJA 2HOHA 1WMOA 3KFQC 3JUPA 4MMZB 1CQSA 1JN5B 2Z77A 4LMIA 3WDGB 3OW22 3VF1A 1A2PA 3EN8A 1YI23 1RGCA 3X40A 1IYYA 3B8LA 1T2IA 1IQ8A 1RJOA 3E99A 4BU4A 1EQKA 2E2TA 2H0GA 3IJEB 3CCM3 2C4BA 3FKAA 3AGNA 1RGHA 2OQEA 4DKIA 1UUWB 1SARA 3B4OA 5AI1A 7GSPA 1R4CA 4HM8B 1FUSA 2ZDJA 1Q40A 2KF6A 3GZXB 3T8UA 1N9EA 2F56A 1LOVA 3U1WA 1Q824 5STDA 3F7XA 3MSOA 1ULJB 4FR9A 4KFEA 3WOFB 4ZM8A 4J8TA 2XRXB 1BNIA 2XSOB 1KC84 1GMQA 2P0MA 5LC7A 1PU4A 1B2UA 4L7KA 1FA3A 1VQQA 1ZGXA 2FXTA 2IUKA 3F40A 5BU4A 5M19A 3NV0B 1YIJ3 1HKXA 1GY6A 1FGTA 1QAKA 2V1LA 1M9GA 3JVCA 4LYLB 4WYKA 1N8QA 1RGGA 1D6UA 4HBRA 3LT8A 3IMAB 2HMJB 3HI7A 3U97A 2INXA 4L8PA 1D6YA 1NWWA 2SARA 3RNTA 3SYUA 1NJI4 1E3RA 1RRLA 4HM0B 2CW9A 3NX0A 1F8NA 2BIRA 1D6ZA 1RDSA 2BO9B 1LOXA 3ZFZA 1L5GB 5AEUB 2MF7A 1K734 4K1VA 1OACA 1LOYA 4X2OA 3V98A 3WHOA 2E2VA 3CC23 2BMOB 1G02A 4N3VA 4ORLA 1DMQA 3DGYA 1PYLA 4KT3B 3H3HA 1O7NB 3H51A 1JJ22 1EA2A 5AYRB 3HZPA 4HM6B 1B2ZA 1EG9B 5ELUA 1HU9A 2JDIH 1MNLA 5IF6A 2I9WA 1OCVA 2O9UX 2OCTA 3WMDA 1T2HA 2IY2A 5IW9A 1N5HA 3FZWA 5ELJA 1UI8A 2KRTA 3KKGA 3KN4A 4HM5B 2BNGA 3JUMA 3T0UA 3VSYA 3X3YA 3EN1B 4L8OA 2BMRB 1BSEA 1G0TA 1K28A 1EUIC 1FYSA 3UJMA 3GZBA 2KXGA 3LMLA 4JRFA 1O7MB 2CH9A 3BIRA 3LH4A 4EW5A 1GY7A 1KQS2 2RGQA 4WP5A 1BIRA 1VQ93 3FG4A 2CK3H 3A5EA 3DGLA 1YJW3 3Q90A 3CXC2 4IT7A 2E2UA 1BRJA 3D9RA 4ILFA 4EYCA 1W2B2 3DUKA 3Q1CA 1BNRA 1Q9EA 3S27A 3BNCA 5G1KA 2W9PA 2H0HA 1GOUA 2K3DA 1UCLA 3LTBA 2ZL8A 1BSDA 2F86B 3KSPA 1RN1A 1SIIA 2HMKB 2YFJB 1I2FA 1RN7A 3BNEA 1BOXA 1X1WA 1N9JA 3MG1A 3NUVA 3X42A 4AEQA 3B7CA 4XBXA 3RGAA 1N8R4 3CCJ3 1Q40B 4WFOA 4XDWA 1Q7Y4 1US1A 4WWUC 5G1LA 1TU5A 4NHFA 1W6GA 1B2MA 1Q7HA 3FLJA 5EEOA 2CX1A 2HMNB 2MC8A 1TJDA 1W2ZA 1JV2B 4FMCA 2F99A 3EJVA 3V99A 5M18A 4RZMA 1C7HA 1BSCA 5RNTA 1J2BA 1TFOA 1STDA 8CHOA 2ZHXB 5IERA 1TFKA 4N6MA 2OOVC 3HOHA 4WYKB 3HX8A 1GSPA 3FH1A 2UUGC 1UUVB 5FW5A 1RHLA 1Q42A 1BRHA 4RBNA 3LYGA 3JUNA 3I563 1I3IA 1OGZA 2D1WA 3SOYA 1VQP3 3OWSA 1Q864 3MG3A 3HIGA 5KP1A 1VQ73 1A67A 3N54B 1MGRA 1RLSA 3BB9A 3DMCA 3NHXA 3URPA 4KZ1A 2GBXB 2BHMA 1QVF2 1ZX2A 1A2VA 4HJLB 1DETA 3LTDA 3DGMA 3NM7A 1RTUA 1WTHA 1JB5A 1UI7A 3GSPA 2A15A 1IT8A 1E97A 4Q53A 3BNDA 4N6OB 1VQ43 4HM4B 2KAAA 3RGRA 1JBRA 2KF3A 1OUNA 1OHPA 2GXFA 3LTAA 1RNTA 2HMOB 1JRQA 3B4PA 1YVSA 5CF2A 2W56A 1VQ63 4O02B 1OH0A 2KF4A 3F7SA 1GD4A 1M904 1VQO3 1BNFA 1YJN3 3S28A 1TIJA 1UGHI 3FG3A 5AYSC 2WOFA 4JF8A 5TGNA 3G8ZA 1RN4A 3BLZA 3CD63 3DZLA 2BU4A 1FGRA 1DMMA 1DVDA 3G713 1I8VA 3CPOA 2LYXA 3J7Yd 1YVBI 2XFSA 4XBTA 3G6E3 2L4VA 3PGBA 2OTL3 4FCMA 3NQYA 3D79A 4OK0A 5JPPA 3CCR3 3EBTA 1STFI 3EF8A 3G0KA 3EC9A 4CCVA 5A0OB 1SIHA 4XBYA 1TRQA 3WA3A 3CU3A 2IYJA 1UCJA 3X41A 4J5KA 1VQN3 1VQ53 1FUTA 4LSOA 4LZIA 3JUQA 1AQZA 1W02A 5JBSA 1IQXA 5D83A 1RCLA 3K63A 3NXJA 1W4NA 1NDOB 1ROAA 2HMMB 2WOHA 4OVMA 5AEWB 1CYUA 1RRHA 1M1XB 4WHAA 3S29A 3M8CA 1DYUA 4HAAA 4XDVA 2CG0A 1LRAA 1HYFA 3GRDA 1FGQA 3CCL3 2IA7A 3MPHA 4RNZA 2GEXA 2HMLB 3NM2A 3FSDA 1SPUA 3JUOA 3CMA3 1IT7A 1IQYA 2QGUA 1VQK3 3EQQB 2CX0A 2YFLB 1IVWA 1KD14 1W01A 1GYBA 1FUWA 1I2GA 3Q2PA 3OX9A 4N6LA 2F4YA 1MWRA 5CF1A 2RNTA 2AADA 3I553 1K8A4 1JNQA 4MMXB 1GMPA 4CJNA 5AIGA 1AV4A 2WO0A 3QK9A 2CKFB 2GU3A 3DGOA 4HM2B 1RMSA 2K54A 1RGFA 5EVHA 3GWRA 1B2SA 4TX4A 5CK6A 1UUGB 2RCDA 1LVNA 1YIT3 1A2KA 1V58A 2W6JH 3EX9A 1BUJA 3MKIA 1DVCA 1X1YA 2M7OA 3F9SA 1BRGA 2XSHB 5DREA 1B3SA 3D5GA 1NB3I 1NB5I 2XH9A 1AVLA 2P05A 3SOAA 1YGWA 1RGEA 2QIYA 4HVNA 3TDGA 1SQWA 2W56B 3NQZA 4KVHA 2AAEA 1OPYA 5AIFA 2W0QA 3UL5A 2SBLA 9RNTA 1TP6A 1ZS7A 1X1XA 4O8SA 4RNTA 3K9MC 2CG1A 4CPKA 4CDLA 1RKYA 2Y74A 4J9AA 1ZO2A 3F8XA 1SJWA 1BSAA 1E3VA 1MWUA 3FF0A 1I70A 6STDA 1GD3A 3ECFA 3GZYB 1I0VA 4PEJA 2XGLA 1BVIA 1YGEA 1AR0A 3V92A 1C54A 1LOWA 3T8NA 4R80A 3DXOA 3WR2A 1QJGA 1CYVA 1LXEA 2Y73A 2LQVA 1Y4KA 5LC6A 2K0MA 1RGKA 2Z6BA 3A76A 4BTWA 3NBRA 2L1SA 1JKGA 1BU4A 1U5OA 2WGOA 4FCJA 7RNTA 2RBIA 3EBYA 4H61A 3CME3 1V74A 1O7PB 2PZVA 2R41A 6RNTA 4R1KA 3Q3FA 1JB4A 2XF3A 3WOEB 5G2GA 4FMBA 1BRSA 1QMAA 4O3VA 2ML6A 3K0ZA 2YX9A 5DRVA 3BNBA 4KFDA 1S723 3ER7A 2OTJ3 2Z7AA 1O7GB 3LXUX 1BNGA 1BANA 1OHSA 1QAFA 4MEIA 1VZZA 2GU1A 2RFRA 3KZTA 1RNBA 2OQEC 1A90A 1QALA 4EC6A 2OWPA 1OGXA 1MWSA 1TRPA 1LNIA 1KSIA 1TTOA 3ALAA 3NBBA 4HM3B 3X3XA 6GSPA 1OF5A 4J5GA 2KF5A 2XFTA 3PXMA 3KE7A 5IG0A 4FCZA 2CFDA 2UGIA 2R4IA 5D82A 1YNVX 5JPUA 4G1MB 3K7CA 1CEWI 4HZ9B 5M1AA 1PY3A 2PNCA 3CC73 2D42A 1RGLA 1JBSA 3PYJA 4HYZA 2IMJA 5KP3A 1GS3A 2XGNA 2Z76A 2QA43 3GZRA 1DE3A 2CWVA
chains in the Genus database with same CATH topology
1NNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNV A; 
#chains in the Genus database with same CATH topology
 3I0Y A;  4O2H A;  4EV2 A;  2W9Q A;  1IK3 A;  3DY5 A;  1FGM A;  1AVK A;  3MYT A;  3FGY A;  4X2H A;  3EHC A;  5CLK A;  3FG1 A;  3DGN A;  3AHS A;  3AHW A;  3AMO A;  2CHC A;  3WOD G;  2JQ5 A;  3UNL A;  3LZA A;  3K5T A;  3SLU A;  1K41 A;  1PFP A;  2C10 A;  3LOY A;  3SX1 A;  1WMN A;  1S5A A;  3VGN A;  1T5Y A;  2ML5 A;  3D5I A;  1JZO A;  2CFG A;  5AII A;  3MHE A;  2CC3 A;  1O7H B;  3G4S 3;  3UL6 A;  2FNQ A;  2Q07 A;  1ASK A;  1KWI A;  3SVA A;  3SXX A;  1IVU A;  3OV4 A;  2STD A;  2F5W A;  3KSE D;  1B21 A;  1WQL B;  3ROB A;  5CXO A;  5IEP A;  3CC4 3;  1IV7 A;  1W00 A;  2W2C A;  5D81 A;  3MWZ A;  3EB8 A;  3GAX A;  2CFK A;  4XM4 A;  4RNY A;  3S67 A;  1N5P A;  3LTC A;  5HGR A;  1GY5 A;  3S5C A;  5IEO A;  3LT9 A;  1JKG B;  2QEX 3;  1QVG 2;  1ULI B;  2GEY A;  3CNX A;  1LQM B;  3DM8 A;  4NRE A;  4GL6 A;  1MWT A;  4HKV B;  1OHO A;  3KCH A;  4KFF A;  3CCE 3;  4I4K A;  3OXA A;  3PCS A;  3SED A;  4N6U A;  2P0X A;  4HM7 B;  4LGQ A;  3G16 A;  1M1K 4;  4EBG A;  1CH0 A;  1T3B A;  1VQM 3;  1MGW A;  1GMR A;  2CWT A;  4N6N B;  3MG2 A;  3O8Y A;  1BSB A;  1YJ9 3;  1GOV A;  4H3U A;  1FZU A;  5BVB A;  2H0I A;  1GOY A;  1U8C B;  3PCR A;  1OF5 B;  2XEP A;  1BRK A;  1BGS A;  4BTX A;  1FGO A;  4K61 A;  3EE1 A;  1NO3 A;  2CFL A;  2RSX A;  4IPB A;  1JN5 A;  1IU7 A;  3IPT A;  2F98 A;  2W04 A;  1BNS A;  1WNH A;  2F5M A;  3HK4 A;  1W5Z A;  3N8B A;  4N6V 0;  3CNM A;  3F14 A;  5EQL A;  5BXQ A;  5IEN A;  4MJD A;  4N6T A;  1MOL A;  1UCK A;  1X1U A;  2KCD A;  2P09 A;  3FF2 A;  4HM1 B;  3CPW 2;  1AY7 A;  1G96 A;  1IVX A;  2GBW B;  4GB5 A;  1W7C A;  3D4A A;  1W6C A;  2J8X B;  2C11 A;  4EV5 A;  1NNV A;  2ZA4 A;  1UGI A;  1JZD A;  1I0X A;  5BIR A;  4LEH A;  4AKY A;  1ROV A;  1UDI I;  3F8H A;  3OWU A;  5GSP A;  1RCK A;  4AKZ A;  1EKM A;  1BAO A;  4BIR A;  3AMO B;  3N9H A;  4STD A;  4HZB B;  3FCS B;  1JB2 A;  4K1U A;  1BUQ A;  3AGO A;  5I97 A;  1IDP A;  1LNH A;  3UB1 A;  4I5Q A;  2W03 A;  3NV0 A;  1B2X A;  1B27 A;  1K9M 4;  2BMQ B;  5AIH A;  1FW7 A;  4U13 A;  3RDE A;  1NU3 A;  4R4K A;  4BL2 A;  1RGA A;  1YHQ 3;  3PZW A;  1VQ8 3;  4FMA A;  1BNJ A;  2UX0 A;  2XR8 B;  4GHO A;  1DMN A;  3L0R A;  1IV9 A;  1Z1S A;  3HII A;  2IUJ A;  4R9K A;  3CCV 3;  1TUH A;  2BT3 A;  1WMP A;  3STD A;  4QWT A;  4K90 B;  3CCQ 3;  1VQL 3;  1JBT A;  1EEJ A;  1R4Y A;  3DH2 A;  2CIU A;  1BRI A;  2FGT A;  3PS8 A;  3X3Z A;  1W6Y A;  3CCS 3;  2P38 A;  5HOH A;  2CWU A;  1ISK A;  3OWY A;  3ZG5 A;  1LQG C;  2B1X B;  2B24 B;  5IG3 A;  5IG4 A;  1BRN L;  1UW1 A;  4BL3 A;  2O3O A;  4XB5 A;  4IIA A;  1HZ1 A;  4MMY B;  3CCU 3;  3D3L A;  1BNE A;  3WA2 X;  2YFI B;  1B20 A;  2GSP A;  1V57 A;  1O7W B;  3QRD A;  3ZG0 A;  4NPB A;  7STD A;  5KP4 A;  1IVV A;  4BTY A;  4FMD A;  4R9L A;  8RNT A;  4HOH A;  1I3F A;  1I2E A;  5IG5 A;  2OOV A;  1RSN A;  1Q81 4;  3KII A;  4OUQ A;  1UCI A;  4GSP A;  5FGO A;  3BU4 A;  4EXR A;  2CFW A;  2WGQ A;  3NBJ A;  2HOH A;  1WMO A;  3KFQ C;  3JUP A;  4MMZ B;  1CQS A;  1JN5 B;  2Z77 A;  4LMI A;  3WDG B;  3OW2 2;  3VF1 A;  1A2P A;  3EN8 A;  1YI2 3;  1RGC A;  3X40 A;  1IYY A;  3B8L A;  1T2I A;  1IQ8 A;  1RJO A;  3E99 A;  4BU4 A;  1EQK A;  2E2T A;  2H0G A;  3IJE B;  3CCM 3;  2C4B A;  3FKA A;  3AGN A;  1RGH A;  2OQE A;  4DKI A;  1UUW B;  1SAR A;  3B4O A;  5AI1 A;  7GSP A;  1R4C A;  4HM8 B;  1FUS A;  2ZDJ A;  1Q40 A;  2KF6 A;  3GZX B;  3T8U A;  1N9E A;  2F56 A;  1LOV A;  3U1W A;  1Q82 4;  5STD A;  3F7X A;  3MSO A;  1ULJ B;  4FR9 A;  4KFE A;  3WOF B;  4ZM8 A;  4J8T A;  2XRX B;  1BNI A;  2XSO B;  1KC8 4;  1GMQ A;  2P0M A;  5LC7 A;  1PU4 A;  1B2U A;  4L7K A;  1FA3 A;  1VQQ A;  1ZGX A;  2FXT A;  2IUK A;  3F40 A;  5BU4 A;  5M19 A;  3NV0 B;  1YIJ 3;  1HKX A;  1GY6 A;  1FGT A;  1QAK A;  2V1L A;  1M9G A;  3JVC A;  4LYL B;  4WYK A;  1N8Q A;  1RGG A;  1D6U A;  4HBR A;  3LT8 A;  3IMA B;  2HMJ B;  3HI7 A;  3U97 A;  2INX A;  4L8P A;  1D6Y A;  1NWW A;  2SAR A;  3RNT A;  3SYU A;  1NJI 4;  1E3R A;  1RRL A;  4HM0 B;  2CW9 A;  3NX0 A;  1F8N A;  2BIR A;  1D6Z A;  1RDS A;  2BO9 B;  1LOX A;  3ZFZ A;  1L5G B;  5AEU B;  2MF7 A;  1K73 4;  4K1V A;  1OAC A;  1LOY A;  4X2O A;  3V98 A;  3WHO A;  2E2V A;  3CC2 3;  2BMO B;  1G02 A;  4N3V A;  4ORL A;  1DMQ A;  3DGY A;  1PYL A;  4KT3 B;  3H3H A;  1O7N B;  3H51 A;  1JJ2 2;  1EA2 A;  5AYR B;  3HZP A;  4HM6 B;  1B2Z A;  1EG9 B;  5ELU A;  1HU9 A;  2JDI H;  1MNL A;  5IF6 A;  2I9W A;  1OCV A;  2O9U X;  2OCT A;  3WMD A;  1T2H A;  2IY2 A;  5IW9 A;  1N5H A;  3FZW A;  5ELJ A;  1UI8 A;  2KRT A;  3KKG A;  3KN4 A;  4HM5 B;  2BNG A;  3JUM A;  3T0U A;  3VSY A;  3X3Y A;  3EN1 B;  4L8O A;  2BMR B;  1BSE A;  1G0T A;  1K28 A;  1EUI C;  1FYS A;  3UJM A;  3GZB A;  2KXG A;  3LML A;  4JRF A;  1O7M B;  2CH9 A;  3BIR A;  3LH4 A;  4EW5 A;  1GY7 A;  1KQS 2;  2RGQ A;  4WP5 A;  1BIR A;  1VQ9 3;  3FG4 A;  2CK3 H;  3A5E A;  3DGL A;  1YJW 3;  3Q90 A;  3CXC 2;  4IT7 A;  2E2U A;  1BRJ A;  3D9R A;  4ILF A;  4EYC A;  1W2B 2;  3DUK A;  3Q1C A;  1BNR A;  1Q9E A;  3S27 A;  3BNC A;  5G1K A;  2W9P A;  2H0H A;  1GOU A;  2K3D A;  1UCL A;  3LTB A;  2ZL8 A;  1BSD A;  2F86 B;  3KSP A;  1RN1 A;  1SII A;  2HMK B;  2YFJ B;  1I2F A;  1RN7 A;  3BNE A;  1BOX A;  1X1W A;  1N9J A;  3MG1 A;  3NUV A;  3X42 A;  4AEQ A;  3B7C A;  4XBX A;  3RGA A;  1N8R 4;  3CCJ 3;  1Q40 B;  4WFO A;  4XDW A;  1Q7Y 4;  1US1 A;  4WWU C;  5G1L A;  1TU5 A;  4NHF A;  1W6G A;  1B2M A;  1Q7H A;  3FLJ A;  5EEO A;  2CX1 A;  2HMN B;  2MC8 A;  1TJD A;  1W2Z A;  1JV2 B;  4FMC A;  2F99 A;  3EJV A;  3V99 A;  5M18 A;  4RZM A;  1C7H A;  1BSC A;  5RNT A;  1J2B A;  1TFO A;  1STD A;  8CHO A;  2ZHX B;  5IER A;  1TFK A;  4N6M A;  2OOV C;  3HOH A;  4WYK B;  3HX8 A;  1GSP A;  3FH1 A;  2UUG C;  1UUV B;  5FW5 A;  1RHL A;  1Q42 A;  1BRH A;  4RBN A;  3LYG A;  3JUN A;  3I56 3;  1I3I A;  1OGZ A;  2D1W A;  3SOY A;  1VQP 3;  3OWS A;  1Q86 4;  3MG3 A;  3HIG A;  5KP1 A;  1VQ7 3;  1A67 A;  3N54 B;  1MGR A;  1RLS A;  3BB9 A;  3DMC A;  3NHX A;  3URP A;  4KZ1 A;  2GBX B;  2BHM A;  1QVF 2;  1ZX2 A;  1A2V A;  4HJL B;  1DET A;  3LTD A;  3DGM A;  3NM7 A;  1RTU A;  1WTH A;  1JB5 A;  1UI7 A;  3GSP A;  2A15 A;  1IT8 A;  1E97 A;  4Q53 A;  3BND A;  4N6O B;  1VQ4 3;  4HM4 B;  2KAA A;  3RGR A;  1JBR A;  2KF3 A;  1OUN A;  1OHP A;  2GXF A;  3LTA A;  1RNT A;  2HMO B;  1JRQ A;  3B4P A;  1YVS A;  5CF2 A;  2W56 A;  1VQ6 3;  4O02 B;  1OH0 A;  2KF4 A;  3F7S A;  1GD4 A;  1M90 4;  1VQO 3;  1BNF A;  1YJN 3;  3S28 A;  1TIJ A;  1UGH I;  3FG3 A;  5AYS C;  2WOF A;  4JF8 A;  5TGN A;  3G8Z A;  1RN4 A;  3BLZ A;  3CD6 3;  3DZL A;  2BU4 A;  1FGR A;  1DMM A;  1DVD A;  3G71 3;  1I8V A;  3CPO A;  2LYX A;  3J7Y d;  1YVB I;  2XFS A;  4XBT A;  3G6E 3;  2L4V A;  3PGB A;  2OTL 3;  4FCM A;  3NQY A;  3D79 A;  4OK0 A;  5JPP A;  3CCR 3;  3EBT A;  1STF I;  3EF8 A;  3G0K A;  3EC9 A;  4CCV A;  5A0O B;  1SIH A;  4XBY A;  1TRQ A;  3WA3 A;  3CU3 A;  2IYJ A;  1UCJ A;  3X41 A;  4J5K A;  1VQN 3;  1VQ5 3;  1FUT A;  4LSO A;  4LZI A;  3JUQ A;  1AQZ A;  1W02 A;  5JBS A;  1IQX A;  5D83 A;  1RCL A;  3K63 A;  3NXJ A;  1W4N A;  1NDO B;  1ROA A;  2HMM B;  2WOH A;  4OVM A;  5AEW B;  1CYU A;  1RRH A;  1M1X B;  4WHA A;  3S29 A;  3M8C A;  1DYU A;  4HAA A;  4XDV A;  2CG0 A;  1LRA A;  1HYF A;  3GRD A;  1FGQ A;  3CCL 3;  2IA7 A;  3MPH A;  4RNZ A;  2GEX A;  2HML B;  3NM2 A;  3FSD A;  1SPU A;  3JUO A;  3CMA 3;  1IT7 A;  1IQY A;  2QGU A;  1VQK 3;  3EQQ B;  2CX0 A;  2YFL B;  1IVW A;  1KD1 4;  1W01 A;  1GYB A;  1FUW A;  1I2G A;  3Q2P A;  3OX9 A;  4N6L A;  2F4Y A;  1MWR A;  5CF1 A;  2RNT A;  2AAD A;  3I55 3;  1K8A 4;  1JNQ A;  4MMX B;  1GMP A;  4CJN A;  5AIG A;  1AV4 A;  2WO0 A;  3QK9 A;  2CKF B;  2GU3 A;  3DGO A;  4HM2 B;  1RMS A;  2K54 A;  1RGF A;  5EVH A;  3GWR A;  1B2S A;  4TX4 A;  5CK6 A;  1UUG B;  2RCD A;  1LVN A;  1YIT 3;  1A2K A;  1V58 A;  2W6J H;  3EX9 A;  1BUJ A;  3MKI A;  1DVC A;  1X1Y A;  2M7O A;  3F9S A;  1BRG A;  2XSH B;  5DRE A;  1B3S A;  3D5G A;  1NB3 I;  1NB5 I;  2XH9 A;  1AVL A;  2P05 A;  3SOA A;  1YGW A;  1RGE A;  2QIY A;  4HVN A;  3TDG A;  1SQW A;  2W56 B;  3NQZ A;  4KVH A;  2AAE A;  1OPY A;  5AIF A;  2W0Q A;  3UL5 A;  2SBL A;  9RNT A;  1TP6 A;  1ZS7 A;  1X1X A;  4O8S A;  4RNT A;  3K9M C;  2CG1 A;  4CPK A;  4CDL A;  1RKY A;  2Y74 A;  4J9A A;  1ZO2 A;  3F8X A;  1SJW A;  1BSA A;  1E3V A;  1MWU A;  3FF0 A;  1I70 A;  6STD A;  1GD3 A;  3ECF A;  3GZY B;  1I0V A;  4PEJ A;  2XGL A;  1BVI A;  1YGE A;  1AR0 A;  3V92 A;  1C54 A;  1LOW A;  3T8N A;  4R80 A;  3DXO A;  3WR2 A;  1QJG A;  1CYV A;  1LXE A;  2Y73 A;  2LQV A;  1Y4K A;  5LC6 A;  2K0M A;  1RGK A;  2Z6B A;  3A76 A;  4BTW A;  3NBR A;  2L1S A;  1JKG A;  1BU4 A;  1U5O A;  2WGO A;  4FCJ A;  7RNT A;  2RBI A;  3EBY A;  4H61 A;  3CME 3;  1V74 A;  1O7P B;  2PZV A;  2R41 A;  6RNT A;  4R1K A;  3Q3F A;  1JB4 A;  2XF3 A;  3WOE B;  5G2G A;  4FMB A;  1BRS A;  1QMA A;  4O3V A;  2ML6 A;  3K0Z A;  2YX9 A;  5DRV A;  3BNB A;  4KFD A;  1S72 3;  3ER7 A;  2OTJ 3;  2Z7A A;  1O7G B;  3LXU X;  1BNG A;  1BAN A;  1OHS A;  1QAF A;  4MEI A;  1VZZ A;  2GU1 A;  2RFR A;  3KZT A;  1RNB A;  2OQE C;  1A90 A;  1QAL A;  4EC6 A;  2OWP A;  1OGX A;  1MWS A;  1TRP A;  1LNI A;  1KSI A;  1TTO A;  3ALA A;  3NBB A;  4HM3 B;  3X3X A;  6GSP A;  1OF5 A;  4J5G A;  2KF5 A;  2XFT A;  3PXM A;  3KE7 A;  5IG0 A;  4FCZ A;  2CFD A;  2UGI A;  2R4I A;  5D82 A;  1YNV X;  5JPU A;  4G1M B;  3K7C A;  1CEW I;  4HZ9 B;  5M1A A;  1PY3 A;  2PNC A;  3CC7 3;  2D42 A;  1RGL A;  1JBS A;  3PYJ A;  4HYZ A;  2IMJ A;  5KP3 A;  1GS3 A;  2XGN A;  2Z76 A;  2QA4 3;  3GZR A;  1DE3 A;  2CWV A; 
#chains in the Genus database with same CATH homology
 1NNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...