1MGWA

Crystal structure of rnase sa3, cytotoxic microbial ribonuclease
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
b'ASVKAVGRVCYSALPSQAHDTLDLIDEGGPFPYSQDGVVFQNREGLLPAHSTGYYHEYTVITPGSPTRGARRIITGQQWQEDYYTADHYASFRRVDFAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa3
publication title Links X-ray Structure of Two Crystalline Forms of a Streptomycete Ribonuclease with Cytotoxic Activity
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 23
structure length 99
sequence length 99
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1mgwA00
1LOYA 1B21A 1RMSA 1X1UA 1MGWA 2GSPA 1BNIA 1X1WA 1GMRA 1FW7A 1BRJA 1RGHA 1UCLA 1GOYA 1SARA 1I2EA 1I8VA 1B2ZA 3A5EA 2HOHA 1RGEA 4HOHA 1LNIA 1ZGXA 4BU4A 1B2XA 1BNEA 1DETA 1PYLA 1BRSA 1RSNA 2KF5A 3D4AA 1UCJA 1AQZA 3GSPA 2KAAA 1RCLA 3D5IA 3D5GA 5HOHA 1FYSA 1AY7A 1I2FA 1BOXA 1RLSA 1BRGA 9RNTA 1BSEA 7GSPA 1BU4A 5BU4A 1BANA 1B2UA 1X1YA 4J5GA 4RNTA 3URPA 1GOVA 3RNTA 1RGGA 1LOVA 3AHWA 3BU4A 1LRAA 1BSCA 1FZUA 4J5KA 2KF3A 8RNTA 1JBSA 1YVSA 1HZ1A 1FUTA 5RNTA 1GSPA 1YGWA 1LOWA 1G02A 1CH0A 1I0XA 3Q3FA 1RGKA 1RCKA 5GSPA 1RHLA 1BRHA 1RGAA 1RGLA 1YNVX 2KF6A 1IYYA 3DH2A 1RGFA 1I3FA 1BNGA 5BIRA 1RNTA 1BNSA 7RNTA 1MGRA 1RNBA 2SARA 1BNRA 1TTOA 4GHOA 1RGCA 2AADA 2BU4A 1BSAA 2RBIA 4GSPA 1DE3A 6RNTA 1R4YA 1RN4A 1X1XA 3WR2A 1BRNL 1RN1A 1RDSA 1B2MA 1B20A 3WHOA 1BSDA 1PY3A 1HYFA 1T2IA 2F56A 1BNFA 1BRKA 1T2HA 1B2SA 4HAAA 1BGSA 3AGNA 1UCKA 1I0VA 1GOUA 1BIRA 1A2PA 1Q9EA 3DGYA 2F5WA 3HOHA 1FUSA 2ZA4A 1RTUA 1BUJA 3AGOA 2F4YA 3KCHA 2C4BA 1GMQA 1UCIA 3BIRA 3AHSA 1BVIA 1I3IA 2KF4A 1GMPA 1BNJA 1BAOA 1B27A 1BRIA 6GSPA 1C54A 2AAEA 2BIRA 1I2GA 2F5MA 3SYUA 1TRPA 1JBTA 2RNTA 1I70A 4BIRA 1B3SA 1JBRA 1BSBA 1TRQA
chains in the Genus database with same CATH superfamily
2B24B 1K9M4 4CDLA 1MGWA 1W00A 7STDA 1M1XB 3HIIA 1IU7A 2XH9A 1BNIA 4LYLB 1X1WA 1UUGB 3MG3A 1CEWI 2CKFB 3BNCA 3ECFA 4HJLB 2HMKB 1GOYA 1SARA 2F86B 2RFRA 1K734 2FNQA 2YX9A 2WO0A 3ALAA 3FG3A 3A5EA 4PEJA 2HOHA 4OVMA 3DGOA 3CD63 1W01A 4HOHA 4AEQA 1WNHA 2W6JH 3CC23 1MOLA 2ML6A 3UL5A 1BNEA 5M19A 1BRSA 3HX8A 1O7WB 1IQYA 4ZM8A 4HZBB 3GSPA 2YFJB 2Y73A 4HM5B 3S27A 5HOHA 1JKGB 1FYSA 3JVCA 1I2FA 3X3XA 3BB9A 2CG0A 2ZDJA 1BSEA 1QALA 4MMXB 4R9LA 1OUNA 5BU4A 1B2UA 2O3OA 3OWYA 1NWWA 4RNTA 3JUNA 1SIHA 3NHXA 3Q90A 3RNTA 3ZFZA 3NQYA 2STDA 1W2B2 4MJDA 3AHWA 1FGOA 2D42A 3BU4A 1FZUA 4STDA 2OOVA 1RRLA 3IJEB 1Q824 8RNTA 3BNDA 1JBSA 3LTCA 1VQQA 2XSOB 1VQO3 3G16A 2I9WA 3JUOA 1SJWA 1GSPA 1A2VA 3HZPA 5CF1A 5ELUA 1YGWA 2Z6BA 3JUQA 2YFLB 1YJN3 1RGKA 1OCVA 3MPHA 3K5TA 1BRHA 4I4KA 1RGAA 1EG9B 1YNVX 3GWRA 4OK0A 3T8UA 1YJW3 5AYSC 1IYYA 5LC7A 1JKGA 5BIRA 1EEJA 3FG1A 1K41A 1O7NB 2Z76A 3NBRA 1A90A 1BNSA 7RNTA 1K8A4 1ROVA 1SIIA 3V98A 2SARA 3S5CA 4L8OA 1OHOA 1TTOA 3MKIA 4GHOA 1GY7A 3CNMA 4GSPA 3H51A 1GD4A 5IG4A 4GB5A 3GAXA 3WA3A 1RN4A 2WOHA 2BMRB 2M7OA 3X3ZA 1OACA 1LNHA 3EBYA 5CXOA 1VQ73 1YIT3 3V92A 5IG5A 1RN1A 2BT3A 1Q814 1B2MA 1B20A 1IV7A 1BSDA 3EJVA 3WHOA 2GU1A 2IMJA 1G96A 4RBNA 1JZOA 1YJ93 1KSIA 1HU9A 2KRTA 3F8XA 1B2SA 1QAKA 3LOYA 1BGSA 1CYUA 2IY2A 1WQLB 4CJNA 3CCL3 1GOUA 3B4OA 2HMNB 2H0HA 5IENA 1TUHA 2F5WA 1FUSA 2CC3A 5AEUB 4N6TA 3X40A 1UI8A 1JB4A 1EKMA 3GRDA 1QJGA 2Z77A 1GMQA 4N6V0 5A0OB 2P0MA 3V99A 4LEHA 1RN7A 3AHSA 3LTBA 2QA43 1I3IA 1BAOA 1BRIA 1UDII 2KCDA 5FGOA 1S723 2OTL3 3I0YA 1C54A 1IVWA 3K7CA 3M8CA 1TRPA 2GEXA 4JF8A 4BTXA 1JBTA 4BIRA 3LH4A 3MWZA 4HKVB 2CW9A 1LOYA 4KFDA 5D81A 3FG4A 3LT8A 3NM2A 3SVAA 2W0QA 2W03A 1AV4A 4NPBA 4O8SA 3WOEB 1FW7A 4R4KA 2F98A 1RGHA 2XR8B 3QK9A 2Z7AA 4FMDA 1Q7HA 1A2KA 3A76A 4NHFA 2BHMA 1JN5B 4K90B 4XBXA 4N6UA 3EC9A 2A15A 3X3YA 5G1LA 3D4AA 1DETA 4WYKB 1RSNA 4O02B 1MWRA 4O3VA 2F99A 2WGQA 5CK6A 4EXRA 2KAAA 3D5IA 4KT3B 1W6CA 1Q864 2W9PA 4N6NB 1BOXA 1VQ93 3NV0B 1QVF2 1KWIA 4IPBA 9RNTA 4HYZA 3HI7A 7GSPA 4ORLA 1X1YA 5AEWB 2IUKA 3WMDA 2OQEA 3DM8A 3NXJA 2FGTA 3FLJA 4HM1B 4LGQA 1Q7Y4 3BNEA 1M1K4 2W56B 1CQSA 3CCE3 2CFKA 1KC84 2K0MA 3DUKA 2XGNA 1NDOB 3ER7A 3PXMA 5IEOA 2KF3A 5D82A 3NBBA 1ZS7A 4GL6A 1JN5A 1FUTA 1TP6A 1DMMA 2ML5A 2CWTA 2Q07A 1YVBI 3DY5A 3LT9A 4HZ9B 4EV2A 5KP4A 1QVG2 3EE1A 4WYKA 3Q3FA 2XF3A 5I97A 1RHLA 3KZTA 1JNQA 3FGYA 3KIIA 1RGLA 5BVBA 6STDA 1KD14 1IV9A 3DH2A 3KSED 4R80A 5IEPA 1PFPA 2HMLB 1M904 4EYCA 3D3LA 1FGTA 1SQWA 1N5PA 3N9HA 4AKYA 3NV0A 4N6OB 2O9UX 1RNBA 1UI7A 3B4PA 1BNRA 1O7GB 3O8YA 2RBIA 3DGLA 3G4S3 4BL3A 2ZL8A 1R4YA 3DMCA 3FF2A 1X1XA 3K9MC 2W56A 4WHAA 2IUJA 1LQGC 3LTDA 2K3DA 4HM4B 1A67A 4CPKA 6GSPA 1VQN3 1RDSA 3OWUA 1E3RA 4KFFA 1OHPA 3ZG0A 1VQP3 2E2TA 1FGRA 1S5AA 1SPUA 1MNLA 2FXTA 1NJI4 3ROBA 2F56A 2KXGA 1U5OA 4ILFA 2GU3A 1T2HA 1T3BA 2QIYA 4J9AA 3AGNA 3X42A 1UUWB 4K61A 3VSYA 4BTWA 1O7PB 1OH0A 1Q9EA 3DGYA 3EN8A 2RSXA 3EHCA 2QEX3 2ZA4A 1EUIC 4WWUC 5FW5A 2F4YA 3KCHA 3GZBA 4K1UA 2W2CA 5ELJA 4IIAA 3H3HA 3HIGA 3BIRA 2CG1A 4HM6B 3S67A 5IW9A 2BO9B 3KSPA 1GMPA 4H61A 1B27A 3PCSA 4Q53A 2CFDA 3F14A 8CHOA 2CX0A 2F5MA 4N3VA 1MWSA 3X41A 1KQS2 1LQMB 2RNTA 3CNXA 1I70A 4KFEA 4OUQA 1TFOA 1BSBA 3LXUX 1X1UA 2CX1A 2L1SA 2E2UA 3CCQ3 1YGEA 2IA7A 4XB5A 1EA2A 3B7CA 1BRJA 1JZDA 1UCLA 3Q2PA 1I8VA 1VQ43 4N6LA 3CPW2 1B2ZA 1IDPA 1V74A 1DVDA 1FA3A 3U1WA 1RGEA 3STDA 1RKYA 2UGIA 5IG3A 2B1XB 4BU4A 1PYLA 4BL2A 1QMAA 1WMOA 3B8LA 1UCJA 1AQZA 1RCLA 1EQKA 3FZWA 1YI23 5M1AA 2CK3H 2P38A 3K0ZA 4EBGA 1RLSA 1FGMA 1K28A 2RGQA 1IQ8A 5CLKA 4BTYA 4QWTA 4HBRA 5LC6A 4U13A 1L5GB 1HKXA 4FMCA 4L7KA 1BU4A 4XBYA 1BANA 4FR9A 2WOFA 3URPA 3OXAA 1GY6A 4H3UA 1RGGA 1W5ZA 1LOVA 3F9SA 1LVNA 2CFLA 1YHQ3 1G0TA 2ZHXB 5KP3A 3CCV3 1E3VA 3WDGB 4J5KA 4KZ1A 5JPUA 4DKIA 3CMA3 1UUVB 1OPYA 2INXA 3MYTA 1GD3A 4R1KA 5AIGA 1VQ63 4FCZA 4IT7A 3BNBA 4NREA 4MMYB 1OGXA 4L8PA 2P05A 4HM0B 2R41A 1I0XA 1CH0A 3LZAA 3TDGA 3CCR3 1OHSA 2Y74A 3DXOA 1N8QA 5DREA 1IK3A 2CH9A 3SX1A 2CWUA 4HM3B 1RGFA 1GS3A 4K1VA 1I3FA 3JUPA 1BNGA 2XGLA 3F7SA 3G0KA 3UNLA 5AIHA 1RJOA 3ZG5A 2BNGA 4HM8B 1ZX2A 1QAFA 2P0XA 1Q42A 2R4IA 2AADA 3EN1B 1BSAA 4JRFA 4R9KA 3D79A 5D83A 1DE3A 3D9RA 1LXEA 6RNTA 3RGRA 4I5QA 1GY5A 3I563 3WR2A 4FCJA 3CCS3 3FKAA 3PCRA 1D6UA 1UW1A 1E97A 5AIIA 5JPPA 1AR0A 1PY3A 3GZRA 1V58A 3T8NA 1JV2B 1US1A 1IQXA 1DVCA 2MC8A 3KE7A 4EW5A 1T2IA 5EVHA 1W4NA 1BNFA 2IYJA 3FCSB 2WGOA 1ASKA 2YFIB 3HK4A 4HAAA 3FH1A 4RNYA 1UCKA 5KP1A 2SBLA 4KVHA 1WTHA 1I0VA 1NO3A 1A2PA 1NB5I 2JDIH 3HOHA 5M18A 1W2ZA 2PZVA 1W6YA 2C11A 3AGOA 1T5YA 3WODG 2OCTA 3G713 4J8TA 3LYGA 2OWPA 2L4VA 2KF4A 3UL6A 1BNJA 3DGMA 1D6ZA 3VF1A 3CU3A 3GZXB 2QGUA 1VQ83 1TFKA 2MF7A 3JUMA 3IMAB 3SYUA 3N8BA 3SOYA 3KN4A 1B3SA 3E99A 3UB1A 2BMQB 2CIUA 1WMNA 3UJMA 1W6GA 4EV5A 1B21A 1RMSA 1GYBA 3NUVA 4HVNA 2GSPA 2UX0A 3NBJA 3CCU3 5AIFA 1GMRA 3FSDA 1ISKA 5DRVA 3SOAA 4HM7B 2XFSA 3CCJ3 2CFGA 1I2EA 2C10A 4O2HA 3MG2A 5IG0A 2GXFA 1N5HA 5IF6A 3F40A 3PZWA 3G8ZA 1YIJ3 2RCDA 2HMOB 4TX4A 1LNIA 1ZGXA 3EB8A 3U97A 2XRXB 1O7HB 1B2XA 2KF5A 3EF8A 3MHEA 5STDA 1V57A 2CHCA 3CCM3 4FMBA 3EX9A 5HGRA 3S28A 1TU5A 1VQK3 3NM7A 3RGAA 3D5GA 2E2VA 3GZYB 3IPTA 1AY7A 1WMPA 2HMJB 1BRGA 5JBSA 2OQEC 4FMAA 1O7MB 1ULJB 1LOXA 1Y4KA 3BLZA 1FGQA 3OV4A 1DMQA 1OF5B 1F8NA 4J5GA 2W9QA 4XDVA 3K63A 1IVXA 3DZLA 5G2GA 3OX9A 1GOVA 4FCMA 3OW22 1IT7A 3PGBA 4RNZA 1BUQA 5EEOA 3SEDA 1LRAA 1BSCA 1VZZA 2XFTA 2GBXB 4MEIA 5BXQA 1VQM3 3MG1A 1CYVA 3F7XA 1DYUA 3T0UA 1YVSA 1Q40B 1W02A 3MSOA 1HZ1A 2CFWA 5RNTA 2XSHB 2UUGC 5G1KA 2GBWB 1IVVA 3KFQC 3I553 1LOWA 1G02A 1IT8A 1M9GA 1RCKA 3OWSA 5GSPA 1C7HA 1TIJA 1AVLA 2KF6A 2H0GA 4X2HA 2J8XB 1TJDA 1STDA 4LSOA 1FUWA 1RNTA 2CWVA 4LZIA 1N9EA 1STFI 2D1WA 1MGRA 4X2OA 4G1MB 1W7CA 1ULIB 1RGCA 1OF5A 2BU4A 1UGHI 2JQ5A 2OOVC 4XBTA 1PU4A 5TGNA 1J2BA 3F8HA 2PNCA 1NB3I 3SLUA 2P09A 1MWUA 1NNVA 3KKGA 2BMOB 3VGNA 3AMOB 1N9JA 2LQVA 3LMLA 5AI1A 4N6MA 3CXC2 1BRNL 2XEPA 3CPOA 3WOFB 1Q40A 4RZMA 4EC6A 3N54B 2W04A 1HYFA 1JJ22 1UGIA 3L0RA 2V1LA 1VQ53 3LTAA 4XM4A 4XDWA 1BRKA 1VQL3 1JRQA 1U8CB 5IERA 3CC43 4LMIA 1AVKA 1RRHA 3Q1CA 1IVUA 1BIRA 1OGZA 1D6YA 1N8R4 3PS8A 4WP5A 1RTUA 3NX0A 2HMMB 3PYJA 1BUJA 5AYRB 3CC73 2C4BA 1Z1SA 3FF0A 4MMZB 3CME3 1UCIA 3QRDA 3J7Yd 3SXXA 3NQZA 1JB5A 5CF2A 3DGNA 2K54A 1ZO2A 1ROAA 2H0IA 1BVIA 4CCVA 2LYXA 2GEYA 4AKZA 2AAEA 2BIRA 1I2GA 1MWTA 4WFOA 3RDEA 3S29A 1JB2A 1R4CA 3EBTA 3AMOA 1DMNA 4HM2B 1NU3A 3WA2X 3EQQB 3G6E3 2OTJ3 1JBRA 5EQLA 1TRQA
chains in the Genus database with same CATH topology
1LOYA 1B21A 1RMSA 1X1UA 1MGWA 2GSPA 1BNIA 1X1WA 1GMRA 1FW7A 1BRJA 1RGHA 1UCLA 1GOYA 1SARA 1I2EA 1I8VA 1B2ZA 3A5EA 2HOHA 1RGEA 4HOHA 1LNIA 1ZGXA 4BU4A 1B2XA 1BNEA 1DETA 1PYLA 1BRSA 1RSNA 2KF5A 3D4AA 1UCJA 1AQZA 3GSPA 2KAAA 1RCLA 3D5IA 3D5GA 5HOHA 1FYSA 1AY7A 1I2FA 1BOXA 1RLSA 1BRGA 9RNTA 1BSEA 7GSPA 1BU4A 5BU4A 1BANA 1B2UA 1X1YA 4J5GA 4RNTA 3URPA 1GOVA 3RNTA 1RGGA 1LOVA 3AHWA 3BU4A 1LRAA 1BSCA 1FZUA 4J5KA 2KF3A 8RNTA 1JBSA 1YVSA 1HZ1A 1FUTA 5RNTA 1GSPA 1YGWA 1LOWA 1G02A 1CH0A 1I0XA 3Q3FA 1RGKA 1RCKA 5GSPA 1RHLA 1BRHA 1RGAA 1RGLA 1YNVX 2KF6A 1IYYA 3DH2A 1RGFA 1I3FA 1BNGA 5BIRA 1RNTA 1BNSA 7RNTA 1MGRA 1RNBA 2SARA 1BNRA 1TTOA 4GHOA 1RGCA 2AADA 2BU4A 1BSAA 2RBIA 4GSPA 1DE3A 6RNTA 1R4YA 1RN4A 1X1XA 3WR2A 1BRNL 1RN1A 1RDSA 1B2MA 1B20A 3WHOA 1BSDA 1PY3A 1HYFA 1T2IA 2F56A 1BNFA 1BRKA 1T2HA 1B2SA 4HAAA 1BGSA 3AGNA 1UCKA 1I0VA 1GOUA 1BIRA 1A2PA 1Q9EA 3DGYA 2F5WA 3HOHA 1FUSA 2ZA4A 1RTUA 1BUJA 3AGOA 2F4YA 3KCHA 2C4BA 1GMQA 1UCIA 3BIRA 3AHSA 1BVIA 1I3IA 2KF4A 1GMPA 1BNJA 1BAOA 1B27A 1BRIA 6GSPA 1C54A 2AAEA 2BIRA 1I2GA 2F5MA 3SYUA 1TRPA 1JBTA 2RNTA 1I70A 4BIRA 1B3SA 1JBRA 1BSBA 1TRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOY A;  1B21 A;  1RMS A;  1X1U A;  1MGW A;  2GSP A;  1BNI A;  1X1W A;  1GMR A;  1FW7 A;  1BRJ A;  1RGH A;  1UCL A;  1GOY A;  1SAR A;  1I2E A;  1I8V A;  1B2Z A;  3A5E A;  2HOH A;  1RGE A;  4HOH A;  1LNI A;  1ZGX A;  4BU4 A;  1B2X A;  1BNE A;  1DET A;  1PYL A;  1BRS A;  1RSN A;  2KF5 A;  3D4A A;  1UCJ A;  1AQZ A;  3GSP A;  2KAA A;  1RCL A;  3D5I A;  3D5G A;  5HOH A;  1FYS A;  1AY7 A;  1I2F A;  1BOX A;  1RLS A;  1BRG A;  9RNT A;  1BSE A;  7GSP A;  1BU4 A;  5BU4 A;  1BAN A;  1B2U A;  1X1Y A;  4J5G A;  4RNT A;  3URP A;  1GOV A;  3RNT A;  1RGG A;  1LOV A;  3AHW A;  3BU4 A;  1LRA A;  1BSC A;  1FZU A;  4J5K A;  2KF3 A;  8RNT A;  1JBS A;  1YVS A;  1HZ1 A;  1FUT A;  5RNT A;  1GSP A;  1YGW A;  1LOW A;  1G02 A;  1CH0 A;  1I0X A;  3Q3F A;  1RGK A;  1RCK A;  5GSP A;  1RHL A;  1BRH A;  1RGA A;  1RGL A;  1YNV X;  2KF6 A;  1IYY A;  3DH2 A;  1RGF A;  1I3F A;  1BNG A;  5BIR A;  1RNT A;  1BNS A;  7RNT A;  1MGR A;  1RNB A;  2SAR A;  1BNR A;  1TTO A;  4GHO A;  1RGC A;  2AAD A;  2BU4 A;  1BSA A;  2RBI A;  4GSP A;  1DE3 A;  6RNT A;  1R4Y A;  1RN4 A;  1X1X A;  3WR2 A;  1BRN L;  1RN1 A;  1RDS A;  1B2M A;  1B20 A;  3WHO A;  1BSD A;  1PY3 A;  1HYF A;  1T2I A;  2F56 A;  1BNF A;  1BRK A;  1T2H A;  1B2S A;  4HAA A;  1BGS A;  3AGN A;  1UCK A;  1I0V A;  1GOU A;  1BIR A;  1A2P A;  1Q9E A;  3DGY A;  2F5W A;  3HOH A;  1FUS A;  2ZA4 A;  1RTU A;  1BUJ A;  3AGO A;  2F4Y A;  3KCH A;  2C4B A;  1GMQ A;  1UCI A;  3BIR A;  3AHS A;  1BVI A;  1I3I A;  2KF4 A;  1GMP A;  1BNJ A;  1BAO A;  1B27 A;  1BRI A;  6GSP A;  1C54 A;  2AAE A;  2BIR A;  1I2G A;  2F5M A;  3SYU A;  1TRP A;  1JBT A;  2RNT A;  1I70 A;  4BIR A;  1B3S A;  1JBR A;  1BSB A;  1TRQ A; 
#chains in the Genus database with same CATH topology
 2B24 B;  1K9M 4;  4CDL A;  1MGW A;  1W00 A;  7STD A;  1M1X B;  3HII A;  1IU7 A;  2XH9 A;  1BNI A;  4LYL B;  1X1W A;  1UUG B;  3MG3 A;  1CEW I;  2CKF B;  3BNC A;  3ECF A;  4HJL B;  2HMK B;  1GOY A;  1SAR A;  2F86 B;  2RFR A;  1K73 4;  2FNQ A;  2YX9 A;  2WO0 A;  3ALA A;  3FG3 A;  3A5E A;  4PEJ A;  2HOH A;  4OVM A;  3DGO A;  3CD6 3;  1W01 A;  4HOH A;  4AEQ A;  1WNH A;  2W6J H;  3CC2 3;  1MOL A;  2ML6 A;  3UL5 A;  1BNE A;  5M19 A;  1BRS A;  3HX8 A;  1O7W B;  1IQY A;  4ZM8 A;  4HZB B;  3GSP A;  2YFJ B;  2Y73 A;  4HM5 B;  3S27 A;  5HOH A;  1JKG B;  1FYS A;  3JVC A;  1I2F A;  3X3X A;  3BB9 A;  2CG0 A;  2ZDJ A;  1BSE A;  1QAL A;  4MMX B;  4R9L A;  1OUN A;  5BU4 A;  1B2U A;  2O3O A;  3OWY A;  1NWW A;  4RNT A;  3JUN A;  1SIH A;  3NHX A;  3Q90 A;  3RNT A;  3ZFZ A;  3NQY A;  2STD A;  1W2B 2;  4MJD A;  3AHW A;  1FGO A;  2D42 A;  3BU4 A;  1FZU A;  4STD A;  2OOV A;  1RRL A;  3IJE B;  1Q82 4;  8RNT A;  3BND A;  1JBS A;  3LTC A;  1VQQ A;  2XSO B;  1VQO 3;  3G16 A;  2I9W A;  3JUO A;  1SJW A;  1GSP A;  1A2V A;  3HZP A;  5CF1 A;  5ELU A;  1YGW A;  2Z6B A;  3JUQ A;  2YFL B;  1YJN 3;  1RGK A;  1OCV A;  3MPH A;  3K5T A;  1BRH A;  4I4K A;  1RGA A;  1EG9 B;  1YNV X;  3GWR A;  4OK0 A;  3T8U A;  1YJW 3;  5AYS C;  1IYY A;  5LC7 A;  1JKG A;  5BIR A;  1EEJ A;  3FG1 A;  1K41 A;  1O7N B;  2Z76 A;  3NBR A;  1A90 A;  1BNS A;  7RNT A;  1K8A 4;  1ROV A;  1SII A;  3V98 A;  2SAR A;  3S5C A;  4L8O A;  1OHO A;  1TTO A;  3MKI A;  4GHO A;  1GY7 A;  3CNM A;  4GSP A;  3H51 A;  1GD4 A;  5IG4 A;  4GB5 A;  3GAX A;  3WA3 A;  1RN4 A;  2WOH A;  2BMR B;  2M7O A;  3X3Z A;  1OAC A;  1LNH A;  3EBY A;  5CXO A;  1VQ7 3;  1YIT 3;  3V92 A;  5IG5 A;  1RN1 A;  2BT3 A;  1Q81 4;  1B2M A;  1B20 A;  1IV7 A;  1BSD A;  3EJV A;  3WHO A;  2GU1 A;  2IMJ A;  1G96 A;  4RBN A;  1JZO A;  1YJ9 3;  1KSI A;  1HU9 A;  2KRT A;  3F8X A;  1B2S A;  1QAK A;  3LOY A;  1BGS A;  1CYU A;  2IY2 A;  1WQL B;  4CJN A;  3CCL 3;  1GOU A;  3B4O A;  2HMN B;  2H0H A;  5IEN A;  1TUH A;  2F5W A;  1FUS A;  2CC3 A;  5AEU B;  4N6T A;  3X40 A;  1UI8 A;  1JB4 A;  1EKM A;  3GRD A;  1QJG A;  2Z77 A;  1GMQ A;  4N6V 0;  5A0O B;  2P0M A;  3V99 A;  4LEH A;  1RN7 A;  3AHS A;  3LTB A;  2QA4 3;  1I3I A;  1BAO A;  1BRI A;  1UDI I;  2KCD A;  5FGO A;  1S72 3;  2OTL 3;  3I0Y A;  1C54 A;  1IVW A;  3K7C A;  3M8C A;  1TRP A;  2GEX A;  4JF8 A;  4BTX A;  1JBT A;  4BIR A;  3LH4 A;  3MWZ A;  4HKV B;  2CW9 A;  1LOY A;  4KFD A;  5D81 A;  3FG4 A;  3LT8 A;  3NM2 A;  3SVA A;  2W0Q A;  2W03 A;  1AV4 A;  4NPB A;  4O8S A;  3WOE B;  1FW7 A;  4R4K A;  2F98 A;  1RGH A;  2XR8 B;  3QK9 A;  2Z7A A;  4FMD A;  1Q7H A;  1A2K A;  3A76 A;  4NHF A;  2BHM A;  1JN5 B;  4K90 B;  4XBX A;  4N6U A;  3EC9 A;  2A15 A;  3X3Y A;  5G1L A;  3D4A A;  1DET A;  4WYK B;  1RSN A;  4O02 B;  1MWR A;  4O3V A;  2F99 A;  2WGQ A;  5CK6 A;  4EXR A;  2KAA A;  3D5I A;  4KT3 B;  1W6C A;  1Q86 4;  2W9P A;  4N6N B;  1BOX A;  1VQ9 3;  3NV0 B;  1QVF 2;  1KWI A;  4IPB A;  9RNT A;  4HYZ A;  3HI7 A;  7GSP A;  4ORL A;  1X1Y A;  5AEW B;  2IUK A;  3WMD A;  2OQE A;  3DM8 A;  3NXJ A;  2FGT A;  3FLJ A;  4HM1 B;  4LGQ A;  1Q7Y 4;  3BNE A;  1M1K 4;  2W56 B;  1CQS A;  3CCE 3;  2CFK A;  1KC8 4;  2K0M A;  3DUK A;  2XGN A;  1NDO B;  3ER7 A;  3PXM A;  5IEO A;  2KF3 A;  5D82 A;  3NBB A;  1ZS7 A;  4GL6 A;  1JN5 A;  1FUT A;  1TP6 A;  1DMM A;  2ML5 A;  2CWT A;  2Q07 A;  1YVB I;  3DY5 A;  3LT9 A;  4HZ9 B;  4EV2 A;  5KP4 A;  1QVG 2;  3EE1 A;  4WYK A;  3Q3F A;  2XF3 A;  5I97 A;  1RHL A;  3KZT A;  1JNQ A;  3FGY A;  3KII A;  1RGL A;  5BVB A;  6STD A;  1KD1 4;  1IV9 A;  3DH2 A;  3KSE D;  4R80 A;  5IEP A;  1PFP A;  2HML B;  1M90 4;  4EYC A;  3D3L A;  1FGT A;  1SQW A;  1N5P A;  3N9H A;  4AKY A;  3NV0 A;  4N6O B;  2O9U X;  1RNB A;  1UI7 A;  3B4P A;  1BNR A;  1O7G B;  3O8Y A;  2RBI A;  3DGL A;  3G4S 3;  4BL3 A;  2ZL8 A;  1R4Y A;  3DMC A;  3FF2 A;  1X1X A;  3K9M C;  2W56 A;  4WHA A;  2IUJ A;  1LQG C;  3LTD A;  2K3D A;  4HM4 B;  1A67 A;  4CPK A;  6GSP A;  1VQN 3;  1RDS A;  3OWU A;  1E3R A;  4KFF A;  1OHP A;  3ZG0 A;  1VQP 3;  2E2T A;  1FGR A;  1S5A A;  1SPU A;  1MNL A;  2FXT A;  1NJI 4;  3ROB A;  2F56 A;  2KXG A;  1U5O A;  4ILF A;  2GU3 A;  1T2H A;  1T3B A;  2QIY A;  4J9A A;  3AGN A;  3X42 A;  1UUW B;  4K61 A;  3VSY A;  4BTW A;  1O7P B;  1OH0 A;  1Q9E A;  3DGY A;  3EN8 A;  2RSX A;  3EHC A;  2QEX 3;  2ZA4 A;  1EUI C;  4WWU C;  5FW5 A;  2F4Y A;  3KCH A;  3GZB A;  4K1U A;  2W2C A;  5ELJ A;  4IIA A;  3H3H A;  3HIG A;  3BIR A;  2CG1 A;  4HM6 B;  3S67 A;  5IW9 A;  2BO9 B;  3KSP A;  1GMP A;  4H61 A;  1B27 A;  3PCS A;  4Q53 A;  2CFD A;  3F14 A;  8CHO A;  2CX0 A;  2F5M A;  4N3V A;  1MWS A;  3X41 A;  1KQS 2;  1LQM B;  2RNT A;  3CNX A;  1I70 A;  4KFE A;  4OUQ A;  1TFO A;  1BSB A;  3LXU X;  1X1U A;  2CX1 A;  2L1S A;  2E2U A;  3CCQ 3;  1YGE A;  2IA7 A;  4XB5 A;  1EA2 A;  3B7C A;  1BRJ A;  1JZD A;  1UCL A;  3Q2P A;  1I8V A;  1VQ4 3;  4N6L A;  3CPW 2;  1B2Z A;  1IDP A;  1V74 A;  1DVD A;  1FA3 A;  3U1W A;  1RGE A;  3STD A;  1RKY A;  2UGI A;  5IG3 A;  2B1X B;  4BU4 A;  1PYL A;  4BL2 A;  1QMA A;  1WMO A;  3B8L A;  1UCJ A;  1AQZ A;  1RCL A;  1EQK A;  3FZW A;  1YI2 3;  5M1A A;  2CK3 H;  2P38 A;  3K0Z A;  4EBG A;  1RLS A;  1FGM A;  1K28 A;  2RGQ A;  1IQ8 A;  5CLK A;  4BTY A;  4QWT A;  4HBR A;  5LC6 A;  4U13 A;  1L5G B;  1HKX A;  4FMC A;  4L7K A;  1BU4 A;  4XBY A;  1BAN A;  4FR9 A;  2WOF A;  3URP A;  3OXA A;  1GY6 A;  4H3U A;  1RGG A;  1W5Z A;  1LOV A;  3F9S A;  1LVN A;  2CFL A;  1YHQ 3;  1G0T A;  2ZHX B;  5KP3 A;  3CCV 3;  1E3V A;  3WDG B;  4J5K A;  4KZ1 A;  5JPU A;  4DKI A;  3CMA 3;  1UUV B;  1OPY A;  2INX A;  3MYT A;  1GD3 A;  4R1K A;  5AIG A;  1VQ6 3;  4FCZ A;  4IT7 A;  3BNB A;  4NRE A;  4MMY B;  1OGX A;  4L8P A;  2P05 A;  4HM0 B;  2R41 A;  1I0X A;  1CH0 A;  3LZA A;  3TDG A;  3CCR 3;  1OHS A;  2Y74 A;  3DXO A;  1N8Q A;  5DRE A;  1IK3 A;  2CH9 A;  3SX1 A;  2CWU A;  4HM3 B;  1RGF A;  1GS3 A;  4K1V A;  1I3F A;  3JUP A;  1BNG A;  2XGL A;  3F7S A;  3G0K A;  3UNL A;  5AIH A;  1RJO A;  3ZG5 A;  2BNG A;  4HM8 B;  1ZX2 A;  1QAF A;  2P0X A;  1Q42 A;  2R4I A;  2AAD A;  3EN1 B;  1BSA A;  4JRF A;  4R9K A;  3D79 A;  5D83 A;  1DE3 A;  3D9R A;  1LXE A;  6RNT A;  3RGR A;  4I5Q A;  1GY5 A;  3I56 3;  3WR2 A;  4FCJ A;  3CCS 3;  3FKA A;  3PCR A;  1D6U A;  1UW1 A;  1E97 A;  5AII A;  5JPP A;  1AR0 A;  1PY3 A;  3GZR A;  1V58 A;  3T8N A;  1JV2 B;  1US1 A;  1IQX A;  1DVC A;  2MC8 A;  3KE7 A;  4EW5 A;  1T2I A;  5EVH A;  1W4N A;  1BNF A;  2IYJ A;  3FCS B;  2WGO A;  1ASK A;  2YFI B;  3HK4 A;  4HAA A;  3FH1 A;  4RNY A;  1UCK A;  5KP1 A;  2SBL A;  4KVH A;  1WTH A;  1I0V A;  1NO3 A;  1A2P A;  1NB5 I;  2JDI H;  3HOH A;  5M18 A;  1W2Z A;  2PZV A;  1W6Y A;  2C11 A;  3AGO A;  1T5Y A;  3WOD G;  2OCT A;  3G71 3;  4J8T A;  3LYG A;  2OWP A;  2L4V A;  2KF4 A;  3UL6 A;  1BNJ A;  3DGM A;  1D6Z A;  3VF1 A;  3CU3 A;  3GZX B;  2QGU A;  1VQ8 3;  1TFK A;  2MF7 A;  3JUM A;  3IMA B;  3SYU A;  3N8B A;  3SOY A;  3KN4 A;  1B3S A;  3E99 A;  3UB1 A;  2BMQ B;  2CIU A;  1WMN A;  3UJM A;  1W6G A;  4EV5 A;  1B21 A;  1RMS A;  1GYB A;  3NUV A;  4HVN A;  2GSP A;  2UX0 A;  3NBJ A;  3CCU 3;  5AIF A;  1GMR A;  3FSD A;  1ISK A;  5DRV A;  3SOA A;  4HM7 B;  2XFS A;  3CCJ 3;  2CFG A;  1I2E A;  2C10 A;  4O2H A;  3MG2 A;  5IG0 A;  2GXF A;  1N5H A;  5IF6 A;  3F40 A;  3PZW A;  3G8Z A;  1YIJ 3;  2RCD A;  2HMO B;  4TX4 A;  1LNI A;  1ZGX A;  3EB8 A;  3U97 A;  2XRX B;  1O7H B;  1B2X A;  2KF5 A;  3EF8 A;  3MHE A;  5STD A;  1V57 A;  2CHC A;  3CCM 3;  4FMB A;  3EX9 A;  5HGR A;  3S28 A;  1TU5 A;  1VQK 3;  3NM7 A;  3RGA A;  3D5G A;  2E2V A;  3GZY B;  3IPT A;  1AY7 A;  1WMP A;  2HMJ B;  1BRG A;  5JBS A;  2OQE C;  4FMA A;  1O7M B;  1ULJ B;  1LOX A;  1Y4K A;  3BLZ A;  1FGQ A;  3OV4 A;  1DMQ A;  1OF5 B;  1F8N A;  4J5G A;  2W9Q A;  4XDV A;  3K63 A;  1IVX A;  3DZL A;  5G2G A;  3OX9 A;  1GOV A;  4FCM A;  3OW2 2;  1IT7 A;  3PGB A;  4RNZ A;  1BUQ A;  5EEO A;  3SED A;  1LRA A;  1BSC A;  1VZZ A;  2XFT A;  2GBX B;  4MEI A;  5BXQ A;  1VQM 3;  3MG1 A;  1CYV A;  3F7X A;  1DYU A;  3T0U A;  1YVS A;  1Q40 B;  1W02 A;  3MSO A;  1HZ1 A;  2CFW A;  5RNT A;  2XSH B;  2UUG C;  5G1K A;  2GBW B;  1IVV A;  3KFQ C;  3I55 3;  1LOW A;  1G02 A;  1IT8 A;  1M9G A;  1RCK A;  3OWS A;  5GSP A;  1C7H A;  1TIJ A;  1AVL A;  2KF6 A;  2H0G A;  4X2H A;  2J8X B;  1TJD A;  1STD A;  4LSO A;  1FUW A;  1RNT A;  2CWV A;  4LZI A;  1N9E A;  1STF I;  2D1W A;  1MGR A;  4X2O A;  4G1M B;  1W7C A;  1ULI B;  1RGC A;  1OF5 A;  2BU4 A;  1UGH I;  2JQ5 A;  2OOV C;  4XBT A;  1PU4 A;  5TGN A;  1J2B A;  3F8H A;  2PNC A;  1NB3 I;  3SLU A;  2P09 A;  1MWU A;  1NNV A;  3KKG A;  2BMO B;  3VGN A;  3AMO B;  1N9J A;  2LQV A;  3LML A;  5AI1 A;  4N6M A;  3CXC 2;  1BRN L;  2XEP A;  3CPO A;  3WOF B;  1Q40 A;  4RZM A;  4EC6 A;  3N54 B;  2W04 A;  1HYF A;  1JJ2 2;  1UGI A;  3L0R A;  2V1L A;  1VQ5 3;  3LTA A;  4XM4 A;  4XDW A;  1BRK A;  1VQL 3;  1JRQ A;  1U8C B;  5IER A;  3CC4 3;  4LMI A;  1AVK A;  1RRH A;  3Q1C A;  1IVU A;  1BIR A;  1OGZ A;  1D6Y A;  1N8R 4;  3PS8 A;  4WP5 A;  1RTU A;  3NX0 A;  2HMM B;  3PYJ A;  1BUJ A;  5AYR B;  3CC7 3;  2C4B A;  1Z1S A;  3FF0 A;  4MMZ B;  3CME 3;  1UCI A;  3QRD A;  3J7Y d;  3SXX A;  3NQZ A;  1JB5 A;  5CF2 A;  3DGN A;  2K54 A;  1ZO2 A;  1ROA A;  2H0I A;  1BVI A;  4CCV A;  2LYX A;  2GEY A;  4AKZ A;  2AAE A;  2BIR A;  1I2G A;  1MWT A;  4WFO A;  3RDE A;  3S29 A;  1JB2 A;  1R4C A;  3EBT A;  3AMO A;  1DMN A;  4HM2 B;  1NU3 A;  3WA2 X;  3EQQ B;  3G6E 3;  2OTJ 3;  1JBR A;  5EQL A;  1TRQ A; 
#chains in the Genus database with same CATH homology
 1LOY A;  1B21 A;  1RMS A;  1X1U A;  1MGW A;  2GSP A;  1BNI A;  1X1W A;  1GMR A;  1FW7 A;  1BRJ A;  1RGH A;  1UCL A;  1GOY A;  1SAR A;  1I2E A;  1I8V A;  1B2Z A;  3A5E A;  2HOH A;  1RGE A;  4HOH A;  1LNI A;  1ZGX A;  4BU4 A;  1B2X A;  1BNE A;  1DET A;  1PYL A;  1BRS A;  1RSN A;  2KF5 A;  3D4A A;  1UCJ A;  1AQZ A;  3GSP A;  2KAA A;  1RCL A;  3D5I A;  3D5G A;  5HOH A;  1FYS A;  1AY7 A;  1I2F A;  1BOX A;  1RLS A;  1BRG A;  9RNT A;  1BSE A;  7GSP A;  1BU4 A;  5BU4 A;  1BAN A;  1B2U A;  1X1Y A;  4J5G A;  4RNT A;  3URP A;  1GOV A;  3RNT A;  1RGG A;  1LOV A;  3AHW A;  3BU4 A;  1LRA A;  1BSC A;  1FZU A;  4J5K A;  2KF3 A;  8RNT A;  1JBS A;  1YVS A;  1HZ1 A;  1FUT A;  5RNT A;  1GSP A;  1YGW A;  1LOW A;  1G02 A;  1CH0 A;  1I0X A;  3Q3F A;  1RGK A;  1RCK A;  5GSP A;  1RHL A;  1BRH A;  1RGA A;  1RGL A;  1YNV X;  2KF6 A;  1IYY A;  3DH2 A;  1RGF A;  1I3F A;  1BNG A;  5BIR A;  1RNT A;  1BNS A;  7RNT A;  1MGR A;  1RNB A;  2SAR A;  1BNR A;  1TTO A;  4GHO A;  1RGC A;  2AAD A;  2BU4 A;  1BSA A;  2RBI A;  4GSP A;  1DE3 A;  6RNT A;  1R4Y A;  1RN4 A;  1X1X A;  3WR2 A;  1BRN L;  1RN1 A;  1RDS A;  1B2M A;  1B20 A;  3WHO A;  1BSD A;  1PY3 A;  1HYF A;  1T2I A;  2F56 A;  1BNF A;  1BRK A;  1T2H A;  1B2S A;  4HAA A;  1BGS A;  3AGN A;  1UCK A;  1I0V A;  1GOU A;  1BIR A;  1A2P A;  1Q9E A;  3DGY A;  2F5W A;  3HOH A;  1FUS A;  2ZA4 A;  1RTU A;  1BUJ A;  3AGO A;  2F4Y A;  3KCH A;  2C4B A;  1GMQ A;  1UCI A;  3BIR A;  3AHS A;  1BVI A;  1I3I A;  2KF4 A;  1GMP A;  1BNJ A;  1BAO A;  1B27 A;  1BRI A;  6GSP A;  1C54 A;  2AAE A;  2BIR A;  1I2G A;  2F5M A;  3SYU A;  1TRP A;  1JBT A;  2RNT A;  1I70 A;  4BIR A;  1B3S A;  1JBR A;  1BSB A;  1TRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...