1MGWA

Crystal structure of rnase sa3, cytotoxic microbial ribonuclease
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
ASVKAVGRVCYSALPSQAHDTLDLIDEGGPFPYSQDGVVFQNREGLLPAHSTGYYHEYTVITPGSPTRGARRIITGQQWQEDYYTADHYASFRRVDFAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa3
publication title Links X-ray Structure of Two Crystalline Forms of a Streptomycete Ribonuclease with Cytotoxic Activity
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 23
structure length 99
sequence length 99
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1mgwA00
1BNRA 2BU4A 1Q9EA 8RNTA 4RNTA 4BIRA 3GSPA 1UCKA 1AQZA 1BIRA 1I8VA 2KF4A 3WHOA 3AGNA 7GSPA 1BANA 1BNIA 1RN1A 1GMPA 2ZA4A 1GMRA 5RNTA 2SARA 1BNSA 2GSPA 1RSNA 1B2XA 1I3FA 3SYUA 1GOVA 1RGFA 1BGSA 1T2IA 1LOVA 1BNFA 1BAOA 1DETA 1RTUA 1HYFA 1TTOA 1T2HA 1FUSA 1B2MA 1X1XA 1FW7A 1PY3A 3BU4A 1CH0A 1AY7A 1RGLA 1RNTA 2F5WA 2KF5A 3KCHA 2F5MA 1BNEA 1B21A 1RHLA 2HOHA 1BRHA 1BSAA 1LNIA 1B2UA 3DH2A 3HOHA 1I0XA 1DE3A 3URPA 1B3SA 1UCJA 2BIRA 4J5KA 5BU4A 1B2SA 3RNTA 1BUJA 1RN4A 1TRPA 3DGYA 1RMSA 1BSDA 1BU4A 1LOWA 3Q3FA 1YNVX 1I70A 1RGEA 1B27A 1RNBA 2C4BA 1BSBA 2KF3A 1BSCA 1YGWA 1X1YA 1BRJA 1GSPA 1I0VA 1IYYA 1A2PA 1BNJA 2RBIA 1I2EA 3D5IA 1GOYA 3D4AA 1MGRA 1JBTA 1I2GA 2AAEA 2F56A 1RGGA 1HZ1A 1GMQA 3AGOA 1R4YA 1B2ZA 2AADA 1RLSA 1RGHA 1BRGA 1G02A 4HAAA 2KF6A 1FUTA 4GSPA 3WR2A 1LOYA 1RGCA 1TRQA 1B20A 1BVIA 1BNGA 1RGKA 1X1WA 1SARA 1BRSA 1RCKA 5GSPA 1RDSA 1BRIA 2F4YA 6GSPA 5BIRA 4GHOA 4BU4A 5HOHA 3AHWA 9RNTA 1PYLA 1FZUA 3BIRA 1BOXA 1GOUA 1X1UA 1JBRA 2KAAA 3D5GA 1BRKA 1FYSA 1MGWA 3A5EA 1UCLA 1BSEA 1YVSA 4HOHA 3AHSA 1BRNL 1LRAA 6RNTA 1RGAA 1JBSA 1ZGXA 2RNTA 4J5GA 1C54A 1RCLA 1UCIA 7RNTA 1I3IA 1I2FA
chains in the Genus database with same CATH superfamily
2HMNB 1BNRA 2FGTA 5JBSA 3EBTA 4K61A 2UGIA 4RNTA 4WFOA 1LQMB 2IUKA 3WHOA 4N6MA 3K9MC 5AEUB 1STDA 1RN1A 5M19A 3T8UA 1LVNA 1KD14 4N3VA 3SX1A 5EVHA 1R4CA 2H0GA 3TDGA 3CCS3 3MG3A 1QAKA 3UL6A 2GEYA 1JV2B 1UI8A 1LOVA 1L5GB 4R9KA 3B7CA 1DETA 1JZOA 2LQVA 2UUGC 3QK9A 4CJNA 3EF8A 4KVHA 1X1XA 1Z1SA 1PY3A 2XSOB 3MHEA 3EN1B 3WODG 1B2MA 1AY7A 4FMCA 3CCR3 1YJW3 2F5MA 1N5HA 3PCRA 1GD3A 2ZHXB 4KFFA 1BRHA 1BSAA 1LNIA 3AMOB 4NREA 1IV7A 2KXGA 3MSOA 1JB4A 3HIIA 1DE3A 3EQQB 1YJN3 1YVBI 5KP4A 1ZS7A 1YJ93 2W56B 2WO0A 1GY6A 3KSPA 1RN4A 1GYBA 2FNQA 4AKZA 2B24B 2CC3A 1BSDA 4O3VA 1OF5A 5A0OB 1BU4A 1NWWA 1FGQA 3Q3FA 4CDLA 2C4BA 5D83A 1YGWA 2JQ5A 1X1YA 4MEIA 5CLKA 4KZ1A 3GZBA 3H3HA 1A2PA 3FCSB 3LYGA 3FGYA 2OCTA 1MWTA 2RBIA 1EEJA 4HBRA 4EC6A 4HZ9B 3U1WA 2A15A 5G1LA 2WOFA 2F56A 1RGGA 1KQS2 5AIIA 1HZ1A 3AGOA 4AEQA 1TJDA 1B2ZA 2CIUA 2CH9A 3FKAA 1EQKA 1RGHA 4N6TA 1EKMA 3CNXA 1IT8A 3NQYA 2MC8A 3NM2A 3WR2A 1FGRA 4N6OB 1LOYA 1O7MB 2W6JH 1OPYA 1CQSA 3CPOA 1TRQA 3S27A 3FH1A 5FW5A 1YGEA 5AIHA 2OOVC 1O7NB 2CKFB 1BVIA 2OTJ3 3SXXA 5LC6A 3ALAA 1X1WA 4WP5A 3DXOA 2K54A 5IF6A 4HM6B 1VQQA 1BRSA 3G8ZA 1Q824 1RCKA 1CYVA 1IT7A 3EB8A 4JF8A 3G6E3 2W9PA 1VQ63 1W7CA 2CX1A 1Q40A 5HOHA 4LYLB 3IMAB 2O3OA 2GEXA 4EBGA 1A90A 5AYRB 1RRLA 3DGLA 4CCVA 3N54B 3CC23 2WGOA 3D5GA 3NUVA 1FYSA 4PEJA 3PGBA 3WA3A 7STDA 3JUNA 1OUNA 4KFEA 1BSEA 1V74A 1W6CA 4XBYA 3M8CA 3GZXB 3JVCA 1AV4A 3B4PA 4HM1B 1BRNL 3DGOA 1OHOA 1V58A 1QVF2 1RGAA 5M1AA 2R4IA 3LTBA 1RN7A 2RNTA 1W01A 2RGQA 3Q90A 1SJWA 3KIIA 4HJLB 1I2FA 1G96A 2L4VA 2ML6A 3NQZA 3SVAA 1ROAA 1IVWA 8RNTA 3D9RA 2BNGA 3K7CA 3GSPA 2LYXA 3GZRA 3LTCA 1BIRA 3GAXA 1UGIA 7GSPA 1BNIA 3BNBA 1GMPA 2ZA4A 2OTL3 3EJVA 1NU3A 1N8QA 4RNYA 1RJOA 5CF1A 1G0TA 2CW9A 2GSPA 1QAFA 1LXEA 2E2UA 2W04A 4L8PA 1B2XA 1GY7A 1OH0A 1U8CB 3SYUA 1RGFA 3CD63 4IIAA 1BGSA 3ZG0A 1TFOA 3FF2A 3OX9A 1BNFA 1UUWB 3S29A 1VQN3 1SPUA 3HI7A 5D81A 4K1VA 5JPPA 3G16A 1IU7A 1T2HA 1FW7A 4R4KA 5BVBA 5ELJA 2F5WA 1QJGA 2OQEC 1RNTA 3N8BA 1BNEA 2V1LA 1DMNA 2F86B 2B1XB 2HOHA 2IA7A 2RFRA 5IG0A 4EV5A 4I4KA 1OHSA 3DH2A 4AKYA 4HVNA 1DYUA 4HKVB 3N9HA 1MWRA 1RKYA 5I97A 2BMOB 1WTHA 4J5KA 4EXRA 1WMOA 1YI23 1B2SA 2W9QA 5CK6A 3RNTA 1VQ83 1TRPA 3DGYA 3X41A 3CCV3 3NM7A 3V98A 2E2TA 1HU9A 4BTXA 1C7HA 1NDOB 1O7GB 4XM4A 1WQLB 3BNEA 4FCJA 1MOLA 3X3XA 2P0XA 3WMDA 3NV0B 3CNMA 2BMQB 3GZYB 4LZIA 2E2VA 3SOYA 5AI1A 1OGZA 3PYJA 3JUMA 4OVMA 1E3RA 3U97A 3VGNA 3OWYA 1I2EA 4N6LA 1MGRA 1UUGB 5G2GA 3SOAA 2AAEA 3VSYA 3DGMA 4RZMA 1CEWI 1UI7A 3DUKA 1VQK3 2IMJA 1ISKA 3RGRA 6STDA 5G1KA 2HMJB 3AMOA 1JJ22 4K1UA 5EQLA 3ER7A 5KP3A 5HGRA 3ECFA 1HKXA 3CME3 1MWSA 2W56A 3CCL3 1E3VA 3K63A 2Q07A 1GD4A 1RGKA 2GBWB 1FGOA 4BL2A 1QVG2 3ROBA 1SARA 3NHXA 3S5CA 1TIJA 2CFGA 1JB2A 2ZL8A 4K90B 5GSPA 1RDSA 1US1A 3Q1CA 2W03A 1BUQA 4GL6A 1PFPA 6GSPA 2P09A 3F14A 4GHOA 5AIFA 3S28A 4BU4A 5IERA 3E99A 3DY5A 1PYLA 1UUVB 2STDA 2J8XB 4X2OA 1YIT3 1BOXA 1GOUA 1JBRA 4HM8B 4MMZB 2XEPA 5AEWB 2FXTA 1F8NA 5D82A 3S67A 1BRKA 1OHPA 4CPKA 3WOFB 1ROVA 3WOEB 5AYSC 2KRTA 1MGWA 1SIHA 2D42A 2F98A 1IQ8A 5ELUA 3DGNA 1YVSA 1JZDA 4OK0A 3PCSA 1DMMA 3HX8A 1M904 4HZBB 3IPTA 1VQL3 4O8SA 2XSHB 3NX0A 1YHQ3 1KSIA 1I3IA 3UJMA 1TUHA 2INXA 3MYTA 4HM7B 2BO9B 2BU4A 1M1XB 1Q9EA 3I553 3KFQC 3J7Yd 3G4S3 3MPHA 4LGQA 4NHFA 4EYCA 3LT9A 1AQZA 3V92A 1I8VA 3LMLA 3AGNA 2RSXA 1VQM3 3NBJA 4IPBA 1DVDA 1JNQA 1M1K4 4KT3B 3H51A 2P38A 3HK4A 5IG5A 1QALA 2XGNA 2CFWA 1GMRA 3CPW2 1UDII 3CU3A 4WHAA 1BNSA 2Z76A 1W5ZA 3OV4A 1I3FA 2ZDJA 4RNZA 1VQ93 1GOVA 1CYUA 3V99A 1VQP3 5CF2A 1K28A 1O7PB 1SQWA 3FSDA 1D6ZA 2H0IA 1K8A4 2YX9A 1AVLA 3EE1A 3CC43 1RTUA 1HYFA 1TTOA 4HM3B 1JN5B 1WMNA 3PXMA 5FGOA 1W4NA 5IEOA 3BU4A 1ULIB 1IVVA 2KF5A 3G713 5IEPA 3QRDA 8CHOA 1D6YA 2CHCA 1B2UA 2HMOB 3JUQA 1GY5A 3K0ZA 4HM4B 3HOHA 1YIJ3 4X2HA 4FCZA 3CCM3 3URPA 1Q814 2Y74A 3FG3A 3LOYA 3HIGA 4HM5B 2XF3A 2CFDA 5BU4A 3MKIA 2KCDA 3RGAA 2R41A 3FG1A 3X3YA 4EW5A 3GWRA 3BNDA 3KZTA 3NXJA 3KN4A 4XBXA 1NB5I 1YNVX 1I70A 3BNCA 3KE7A 4G1MB 1BSBA 2KF3A 3DZLA 2WGQA 3I0YA 4KFDA 1BRJA 3LXUX 1MWUA 1IYYA 2XRXB 1N9JA 1BNJA 2PNCA 1JKGB 1ULJB 3JUOA 1S5AA 2QIYA 4O2HA 1GOYA 4MMYB 2QEX3 1I2GA 4LEHA 2CWVA 5IG4A 1A67A 1Q864 1GMQA 3B4OA 1A2VA 4N6UA 2AADA 1J2BA 4R80A 1D6UA 1O7WB 1RLSA 2L1SA 1BRGA 3NBBA 1JB5A 1G02A 2CG0A 1JRQA 3F40A 3UB1A 1AR0A 4FMAA 3WDGB 2QA43 5CXOA 4GSPA 1ASKA 2CX0A 4MMXB 4ILFA 1RGCA 1EG9B 3D79A 5TGNA 1B20A 1A2KA 4L7KA 3LH4A 5BXQA 4NPBA 1LQGC 4XDWA 1T3BA 3MWZA 4HM0B 2CG1A 5JPUA 3F9SA 3CMA3 4I5QA 2IYJA 4XB5A 4LSOA 3NV0A 5BIRA 2P0MA 3JUPA 2Z7AA 2BHMA 4JRFA 9RNTA 4HYZA 2QGUA 5KP1A 1TP6A 3UNLA 1X1UA 2XFTA 2KAAA 1NNVA 3FLJA 3I563 1VQ73 3PS8A 3WA2X 2GXFA 5IW9A 1UCLA 1N9EA 3X42A 1KC84 1IVXA 3G0KA 2I9WA 4N6V0 1IV9A 1LRAA 3STDA 4R9LA 3MG2A 4QWTA 3ZFZA 1JBSA 2CWUA 2P05A 2XR8B 4J5GA 7RNTA 2YFJB 4BL3A 2GU1A 2HMKB 2O9UX 1WMPA 4BIRA 2XGLA 1K9M4 1UCKA 2OWPA 4XDVA 3X3ZA 2KF4A 2MF7A 1BANA 1QMAA 4H3UA 4EV2A 2OQEA 1OF5B 3CCU3 3CXC2 3X40A 3EX9A 2SARA 5RNTA 1RSNA 1MNLA 2XH9A 1KWIA 2C10A 1V57A 1T2IA 1EUIC 1NB3I 3ZG5A 1Q42A 3SEDA 2GBXB 1BAOA 2CFKA 3F8XA 4J8TA 2WOHA 2Z77A 3B8LA 3D3LA 4N6NB 4R1KA 1DMQA 1FUSA 2IY2A 1CH0A 1RGLA 2PZVA 3KCHA 1W6GA 1UW1A 1FUWA 4ORLA 2RCDA 1B21A 2K3DA 1RHLA 2XFSA 1E97A 3PZWA 3A76A 3IJEB 1OACA 1Y4KA 1I0XA 1VQ43 2ML5A 1FGTA 1ZO2A 1STFI 3NBRA 1LOXA 1VQO3 1B3SA 1UCJA 2BIRA 3LT8A 2GU3A 3OWUA 1IK3A 3RDEA 1K734 2W0QA 4RBNA 2HMLB 1AVKA 4FMBA 4WWUC 1N5PA 2W2CA 5DREA 3T8NA 1BUJA 4MJDA 1VQ53 1RRHA 1UGHI 5EEOA 1LNHA 1RMSA 1W2ZA 5IENA 1LOWA 3OW22 2CWTA 2BMRB 1RNBA 1RGEA 1WNHA 1IVUA 3UL5A 2K0MA 5DRVA 2D1WA 1BSCA 1DVCA 1Q40B 3CCE3 4IT7A 4O02B 1GSPA 1I0VA 3F7XA 1EA2A 2YFIB 3LZAA 3HZPA 3EHCA 3O8YA 4XBTA 3K5TA 3D5IA 3OWSA 3D4AA 4STDA 2M7OA 3CCQ3 1JN5A 1TFKA 3LTDA 5STDA 1VZZA 2HMMB 4TX4A 1JBTA 3BB9A 3EN8A 1FGMA 5IG3A 4FR9A 1R4YA 1K41A 3OXAA 4WYKB 2F99A 3L0RA 3LTAA 4OUQA 1M9GA 3CC73 1W6YA 4HAAA 2KF6A 4DKIA 4WYKA 1FUTA 2CFLA 3KSED 3EBYA 4FCMA 1SIIA 3F8HA 2BT3A 1W02A 3GRDA 1BNGA 3T0UA 1S723 2C11A 3Q2PA 4LMIA 2IUJA 1BRIA 3MG1A 4L8OA 2F4YA 1U5OA 2YFLB 3AHWA 4BTYA 3CCJ3 2OOVA 3FF0A 1TU5A 1FZUA 1Q7Y4 4GB5A 1GS3A 2Y73A 3BIRA 1IQYA 1JKGA 1NO3A 4H61A 5LC7A 1PU4A 2CK3H 1IDPA 1OGXA 2Z6BA 1W00A 5M18A 3FZWA 3VF1A 1Q7HA 2UX0A 1FA3A 1ZX2A 3FG4A 4HM2B 3EC9A 3A5EA 1N8R4 3SLUA 3DM8A 3F7SA 1OCVA 2JDIH 1O7HB 4FMDA 4HOHA 3AHSA 3BLZA 2SBLA 4U13A 4Q53A 6RNTA 1T5YA 3KKGA 5AIGA 4BTWA 2H0HA 1ZGXA 1IQXA 4J9AA 1NJI4 4ZM8A 1C54A 1RCLA 1UCIA 1B27A 3DMCA 1W2B2
chains in the Genus database with same CATH topology
1BNRA 2BU4A 1Q9EA 8RNTA 4RNTA 4BIRA 3GSPA 1UCKA 1AQZA 1BIRA 1I8VA 2KF4A 3WHOA 3AGNA 7GSPA 1BANA 1BNIA 1RN1A 1GMPA 2ZA4A 1GMRA 5RNTA 2SARA 1BNSA 2GSPA 1RSNA 1B2XA 1I3FA 3SYUA 1GOVA 1RGFA 1BGSA 1T2IA 1LOVA 1BNFA 1BAOA 1DETA 1RTUA 1HYFA 1TTOA 1T2HA 1FUSA 1B2MA 1X1XA 1FW7A 1PY3A 3BU4A 1CH0A 1AY7A 1RGLA 1RNTA 2F5WA 2KF5A 3KCHA 2F5MA 1BNEA 1B21A 1RHLA 2HOHA 1BRHA 1BSAA 1LNIA 1B2UA 3DH2A 3HOHA 1I0XA 1DE3A 3URPA 1B3SA 1UCJA 2BIRA 4J5KA 5BU4A 1B2SA 3RNTA 1BUJA 1RN4A 1TRPA 3DGYA 1RMSA 1BSDA 1BU4A 1LOWA 3Q3FA 1YNVX 1I70A 1RGEA 1B27A 1RNBA 2C4BA 1BSBA 2KF3A 1BSCA 1YGWA 1X1YA 1BRJA 1GSPA 1I0VA 1IYYA 1A2PA 1BNJA 2RBIA 1I2EA 3D5IA 1GOYA 3D4AA 1MGRA 1JBTA 1I2GA 2AAEA 2F56A 1RGGA 1HZ1A 1GMQA 3AGOA 1R4YA 1B2ZA 2AADA 1RLSA 1RGHA 1BRGA 1G02A 4HAAA 2KF6A 1FUTA 4GSPA 3WR2A 1LOYA 1RGCA 1TRQA 1B20A 1BVIA 1BNGA 1RGKA 1X1WA 1SARA 1BRSA 1RCKA 5GSPA 1RDSA 1BRIA 2F4YA 6GSPA 5BIRA 4GHOA 4BU4A 5HOHA 3AHWA 9RNTA 1PYLA 1FZUA 3BIRA 1BOXA 1GOUA 1X1UA 1JBRA 2KAAA 3D5GA 1BRKA 1FYSA 1MGWA 3A5EA 1UCLA 1BSEA 1YVSA 4HOHA 3AHSA 1BRNL 1LRAA 6RNTA 1RGAA 1JBSA 1ZGXA 2RNTA 4J5GA 1C54A 1RCLA 1UCIA 7RNTA 1I3IA 1I2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNR A;  2BU4 A;  1Q9E A;  8RNT A;  4RNT A;  4BIR A;  3GSP A;  1UCK A;  1AQZ A;  1BIR A;  1I8V A;  2KF4 A;  3WHO A;  3AGN A;  7GSP A;  1BAN A;  1BNI A;  1RN1 A;  1GMP A;  2ZA4 A;  1GMR A;  5RNT A;  2SAR A;  1BNS A;  2GSP A;  1RSN A;  1B2X A;  1I3F A;  3SYU A;  1GOV A;  1RGF A;  1BGS A;  1T2I A;  1LOV A;  1BNF A;  1BAO A;  1DET A;  1RTU A;  1HYF A;  1TTO A;  1T2H A;  1FUS A;  1B2M A;  1X1X A;  1FW7 A;  1PY3 A;  3BU4 A;  1CH0 A;  1AY7 A;  1RGL A;  1RNT A;  2F5W A;  2KF5 A;  3KCH A;  2F5M A;  1BNE A;  1B21 A;  1RHL A;  2HOH A;  1BRH A;  1BSA A;  1LNI A;  1B2U A;  3DH2 A;  3HOH A;  1I0X A;  1DE3 A;  3URP A;  1B3S A;  1UCJ A;  2BIR A;  4J5K A;  5BU4 A;  1B2S A;  3RNT A;  1BUJ A;  1RN4 A;  1TRP A;  3DGY A;  1RMS A;  1BSD A;  1BU4 A;  1LOW A;  3Q3F A;  1YNV X;  1I70 A;  1RGE A;  1B27 A;  1RNB A;  2C4B A;  1BSB A;  2KF3 A;  1BSC A;  1YGW A;  1X1Y A;  1BRJ A;  1GSP A;  1I0V A;  1IYY A;  1A2P A;  1BNJ A;  2RBI A;  1I2E A;  3D5I A;  1GOY A;  3D4A A;  1MGR A;  1JBT A;  1I2G A;  2AAE A;  2F56 A;  1RGG A;  1HZ1 A;  1GMQ A;  3AGO A;  1R4Y A;  1B2Z A;  2AAD A;  1RLS A;  1RGH A;  1BRG A;  1G02 A;  4HAA A;  2KF6 A;  1FUT A;  4GSP A;  3WR2 A;  1LOY A;  1RGC A;  1TRQ A;  1B20 A;  1BVI A;  1BNG A;  1RGK A;  1X1W A;  1SAR A;  1BRS A;  1RCK A;  5GSP A;  1RDS A;  1BRI A;  2F4Y A;  6GSP A;  5BIR A;  4GHO A;  4BU4 A;  5HOH A;  3AHW A;  9RNT A;  1PYL A;  1FZU A;  3BIR A;  1BOX A;  1GOU A;  1X1U A;  1JBR A;  2KAA A;  3D5G A;  1BRK A;  1FYS A;  1MGW A;  3A5E A;  1UCL A;  1BSE A;  1YVS A;  4HOH A;  3AHS A;  1BRN L;  1LRA A;  6RNT A;  1RGA A;  1JBS A;  1ZGX A;  2RNT A;  4J5G A;  1C54 A;  1RCL A;  1UCI A;  7RNT A;  1I3I A;  1I2F A; 
#chains in the Genus database with same CATH topology
 2HMN B;  1BNR A;  2FGT A;  5JBS A;  3EBT A;  4K61 A;  2UGI A;  4RNT A;  4WFO A;  1LQM B;  2IUK A;  3WHO A;  4N6M A;  3K9M C;  5AEU B;  1STD A;  1RN1 A;  5M19 A;  3T8U A;  1LVN A;  1KD1 4;  4N3V A;  3SX1 A;  5EVH A;  1R4C A;  2H0G A;  3TDG A;  3CCS 3;  3MG3 A;  1QAK A;  3UL6 A;  2GEY A;  1JV2 B;  1UI8 A;  1LOV A;  1L5G B;  4R9K A;  3B7C A;  1DET A;  1JZO A;  2LQV A;  2UUG C;  3QK9 A;  4CJN A;  3EF8 A;  4KVH A;  1X1X A;  1Z1S A;  1PY3 A;  2XSO B;  3MHE A;  3EN1 B;  3WOD G;  1B2M A;  1AY7 A;  4FMC A;  3CCR 3;  1YJW 3;  2F5M A;  1N5H A;  3PCR A;  1GD3 A;  2ZHX B;  4KFF A;  1BRH A;  1BSA A;  1LNI A;  3AMO B;  4NRE A;  1IV7 A;  2KXG A;  3MSO A;  1JB4 A;  3HII A;  1DE3 A;  3EQQ B;  1YJN 3;  1YVB I;  5KP4 A;  1ZS7 A;  1YJ9 3;  2W56 B;  2WO0 A;  1GY6 A;  3KSP A;  1RN4 A;  1GYB A;  2FNQ A;  4AKZ A;  2B24 B;  2CC3 A;  1BSD A;  4O3V A;  1OF5 A;  5A0O B;  1BU4 A;  1NWW A;  1FGQ A;  3Q3F A;  4CDL A;  2C4B A;  5D83 A;  1YGW A;  2JQ5 A;  1X1Y A;  4MEI A;  5CLK A;  4KZ1 A;  3GZB A;  3H3H A;  1A2P A;  3FCS B;  3LYG A;  3FGY A;  2OCT A;  1MWT A;  2RBI A;  1EEJ A;  4HBR A;  4EC6 A;  4HZ9 B;  3U1W A;  2A15 A;  5G1L A;  2WOF A;  2F56 A;  1RGG A;  1KQS 2;  5AII A;  1HZ1 A;  3AGO A;  4AEQ A;  1TJD A;  1B2Z A;  2CIU A;  2CH9 A;  3FKA A;  1EQK A;  1RGH A;  4N6T A;  1EKM A;  3CNX A;  1IT8 A;  3NQY A;  2MC8 A;  3NM2 A;  3WR2 A;  1FGR A;  4N6O B;  1LOY A;  1O7M B;  2W6J H;  1OPY A;  1CQS A;  3CPO A;  1TRQ A;  3S27 A;  3FH1 A;  5FW5 A;  1YGE A;  5AIH A;  2OOV C;  1O7N B;  2CKF B;  1BVI A;  2OTJ 3;  3SXX A;  5LC6 A;  3ALA A;  1X1W A;  4WP5 A;  3DXO A;  2K54 A;  5IF6 A;  4HM6 B;  1VQQ A;  1BRS A;  3G8Z A;  1Q82 4;  1RCK A;  1CYV A;  1IT7 A;  3EB8 A;  4JF8 A;  3G6E 3;  2W9P A;  1VQ6 3;  1W7C A;  2CX1 A;  1Q40 A;  5HOH A;  4LYL B;  3IMA B;  2O3O A;  2GEX A;  4EBG A;  1A90 A;  5AYR B;  1RRL A;  3DGL A;  4CCV A;  3N54 B;  3CC2 3;  2WGO A;  3D5G A;  3NUV A;  1FYS A;  4PEJ A;  3PGB A;  3WA3 A;  7STD A;  3JUN A;  1OUN A;  4KFE A;  1BSE A;  1V74 A;  1W6C A;  4XBY A;  3M8C A;  3GZX B;  3JVC A;  1AV4 A;  3B4P A;  4HM1 B;  1BRN L;  3DGO A;  1OHO A;  1V58 A;  1QVF 2;  1RGA A;  5M1A A;  2R4I A;  3LTB A;  1RN7 A;  2RNT A;  1W01 A;  2RGQ A;  3Q90 A;  1SJW A;  3KII A;  4HJL B;  1I2F A;  1G96 A;  2L4V A;  2ML6 A;  3NQZ A;  3SVA A;  1ROA A;  1IVW A;  8RNT A;  3D9R A;  2BNG A;  3K7C A;  3GSP A;  2LYX A;  3GZR A;  3LTC A;  1BIR A;  3GAX A;  1UGI A;  7GSP A;  1BNI A;  3BNB A;  1GMP A;  2ZA4 A;  2OTL 3;  3EJV A;  1NU3 A;  1N8Q A;  4RNY A;  1RJO A;  5CF1 A;  1G0T A;  2CW9 A;  2GSP A;  1QAF A;  1LXE A;  2E2U A;  2W04 A;  4L8P A;  1B2X A;  1GY7 A;  1OH0 A;  1U8C B;  3SYU A;  1RGF A;  3CD6 3;  4IIA A;  1BGS A;  3ZG0 A;  1TFO A;  3FF2 A;  3OX9 A;  1BNF A;  1UUW B;  3S29 A;  1VQN 3;  1SPU A;  3HI7 A;  5D81 A;  4K1V A;  5JPP A;  3G16 A;  1IU7 A;  1T2H A;  1FW7 A;  4R4K A;  5BVB A;  5ELJ A;  2F5W A;  1QJG A;  2OQE C;  1RNT A;  3N8B A;  1BNE A;  2V1L A;  1DMN A;  2F86 B;  2B1X B;  2HOH A;  2IA7 A;  2RFR A;  5IG0 A;  4EV5 A;  4I4K A;  1OHS A;  3DH2 A;  4AKY A;  4HVN A;  1DYU A;  4HKV B;  3N9H A;  1MWR A;  1RKY A;  5I97 A;  2BMO B;  1WTH A;  4J5K A;  4EXR A;  1WMO A;  1YI2 3;  1B2S A;  2W9Q A;  5CK6 A;  3RNT A;  1VQ8 3;  1TRP A;  3DGY A;  3X41 A;  3CCV 3;  3NM7 A;  3V98 A;  2E2T A;  1HU9 A;  4BTX A;  1C7H A;  1NDO B;  1O7G B;  4XM4 A;  1WQL B;  3BNE A;  4FCJ A;  1MOL A;  3X3X A;  2P0X A;  3WMD A;  3NV0 B;  3CNM A;  2BMQ B;  3GZY B;  4LZI A;  2E2V A;  3SOY A;  5AI1 A;  1OGZ A;  3PYJ A;  3JUM A;  4OVM A;  1E3R A;  3U97 A;  3VGN A;  3OWY A;  1I2E A;  4N6L A;  1MGR A;  1UUG B;  5G2G A;  3SOA A;  2AAE A;  3VSY A;  3DGM A;  4RZM A;  1CEW I;  1UI7 A;  3DUK A;  1VQK 3;  2IMJ A;  1ISK A;  3RGR A;  6STD A;  5G1K A;  2HMJ B;  3AMO A;  1JJ2 2;  4K1U A;  5EQL A;  3ER7 A;  5KP3 A;  5HGR A;  3ECF A;  1HKX A;  3CME 3;  1MWS A;  2W56 A;  3CCL 3;  1E3V A;  3K63 A;  2Q07 A;  1GD4 A;  1RGK A;  2GBW B;  1FGO A;  4BL2 A;  1QVG 2;  3ROB A;  1SAR A;  3NHX A;  3S5C A;  1TIJ A;  2CFG A;  1JB2 A;  2ZL8 A;  4K90 B;  5GSP A;  1RDS A;  1US1 A;  3Q1C A;  2W03 A;  1BUQ A;  4GL6 A;  1PFP A;  6GSP A;  2P09 A;  3F14 A;  4GHO A;  5AIF A;  3S28 A;  4BU4 A;  5IER A;  3E99 A;  3DY5 A;  1PYL A;  1UUV B;  2STD A;  2J8X B;  4X2O A;  1YIT 3;  1BOX A;  1GOU A;  1JBR A;  4HM8 B;  4MMZ B;  2XEP A;  5AEW B;  2FXT A;  1F8N A;  5D82 A;  3S67 A;  1BRK A;  1OHP A;  4CPK A;  3WOF B;  1ROV A;  3WOE B;  5AYS C;  2KRT A;  1MGW A;  1SIH A;  2D42 A;  2F98 A;  1IQ8 A;  5ELU A;  3DGN A;  1YVS A;  1JZD A;  4OK0 A;  3PCS A;  1DMM A;  3HX8 A;  1M90 4;  4HZB B;  3IPT A;  1VQL 3;  4O8S A;  2XSH B;  3NX0 A;  1YHQ 3;  1KSI A;  1I3I A;  3UJM A;  1TUH A;  2INX A;  3MYT A;  4HM7 B;  2BO9 B;  2BU4 A;  1M1X B;  1Q9E A;  3I55 3;  3KFQ C;  3J7Y d;  3G4S 3;  3MPH A;  4LGQ A;  4NHF A;  4EYC A;  3LT9 A;  1AQZ A;  3V92 A;  1I8V A;  3LML A;  3AGN A;  2RSX A;  1VQM 3;  3NBJ A;  4IPB A;  1DVD A;  1JNQ A;  1M1K 4;  4KT3 B;  3H51 A;  2P38 A;  3HK4 A;  5IG5 A;  1QAL A;  2XGN A;  2CFW A;  1GMR A;  3CPW 2;  1UDI I;  3CU3 A;  4WHA A;  1BNS A;  2Z76 A;  1W5Z A;  3OV4 A;  1I3F A;  2ZDJ A;  4RNZ A;  1VQ9 3;  1GOV A;  1CYU A;  3V99 A;  1VQP 3;  5CF2 A;  1K28 A;  1O7P B;  1SQW A;  3FSD A;  1D6Z A;  2H0I A;  1K8A 4;  2YX9 A;  1AVL A;  3EE1 A;  3CC4 3;  1RTU A;  1HYF A;  1TTO A;  4HM3 B;  1JN5 B;  1WMN A;  3PXM A;  5FGO A;  1W4N A;  5IEO A;  3BU4 A;  1ULI B;  1IVV A;  2KF5 A;  3G71 3;  5IEP A;  3QRD A;  8CHO A;  1D6Y A;  2CHC A;  1B2U A;  2HMO B;  3JUQ A;  1GY5 A;  3K0Z A;  4HM4 B;  3HOH A;  1YIJ 3;  4X2H A;  4FCZ A;  3CCM 3;  3URP A;  1Q81 4;  2Y74 A;  3FG3 A;  3LOY A;  3HIG A;  4HM5 B;  2XF3 A;  2CFD A;  5BU4 A;  3MKI A;  2KCD A;  3RGA A;  2R41 A;  3FG1 A;  3X3Y A;  4EW5 A;  3GWR A;  3BND A;  3KZT A;  3NXJ A;  3KN4 A;  4XBX A;  1NB5 I;  1YNV X;  1I70 A;  3BNC A;  3KE7 A;  4G1M B;  1BSB A;  2KF3 A;  3DZL A;  2WGQ A;  3I0Y A;  4KFD A;  1BRJ A;  3LXU X;  1MWU A;  1IYY A;  2XRX B;  1N9J A;  1BNJ A;  2PNC A;  1JKG B;  1ULJ B;  3JUO A;  1S5A A;  2QIY A;  4O2H A;  1GOY A;  4MMY B;  2QEX 3;  1I2G A;  4LEH A;  2CWV A;  5IG4 A;  1A67 A;  1Q86 4;  1GMQ A;  3B4O A;  1A2V A;  4N6U A;  2AAD A;  1J2B A;  4R80 A;  1D6U A;  1O7W B;  1RLS A;  2L1S A;  1BRG A;  3NBB A;  1JB5 A;  1G02 A;  2CG0 A;  1JRQ A;  3F40 A;  3UB1 A;  1AR0 A;  4FMA A;  3WDG B;  2QA4 3;  5CXO A;  4GSP A;  1ASK A;  2CX0 A;  4MMX B;  4ILF A;  1RGC A;  1EG9 B;  3D79 A;  5TGN A;  1B20 A;  1A2K A;  4L7K A;  3LH4 A;  5BXQ A;  4NPB A;  1LQG C;  4XDW A;  1T3B A;  3MWZ A;  4HM0 B;  2CG1 A;  5JPU A;  3F9S A;  3CMA 3;  4I5Q A;  2IYJ A;  4XB5 A;  4LSO A;  3NV0 A;  5BIR A;  2P0M A;  3JUP A;  2Z7A A;  2BHM A;  4JRF A;  9RNT A;  4HYZ A;  2QGU A;  5KP1 A;  1TP6 A;  3UNL A;  1X1U A;  2XFT A;  2KAA A;  1NNV A;  3FLJ A;  3I56 3;  1VQ7 3;  3PS8 A;  3WA2 X;  2GXF A;  5IW9 A;  1UCL A;  1N9E A;  3X42 A;  1KC8 4;  1IVX A;  3G0K A;  2I9W A;  4N6V 0;  1IV9 A;  1LRA A;  3STD A;  4R9L A;  3MG2 A;  4QWT A;  3ZFZ A;  1JBS A;  2CWU A;  2P05 A;  2XR8 B;  4J5G A;  7RNT A;  2YFJ B;  4BL3 A;  2GU1 A;  2HMK B;  2O9U X;  1WMP A;  4BIR A;  2XGL A;  1K9M 4;  1UCK A;  2OWP A;  4XDV A;  3X3Z A;  2KF4 A;  2MF7 A;  1BAN A;  1QMA A;  4H3U A;  4EV2 A;  2OQE A;  1OF5 B;  3CCU 3;  3CXC 2;  3X40 A;  3EX9 A;  2SAR A;  5RNT A;  1RSN A;  1MNL A;  2XH9 A;  1KWI A;  2C10 A;  1V57 A;  1T2I A;  1EUI C;  1NB3 I;  3ZG5 A;  1Q42 A;  3SED A;  2GBX B;  1BAO A;  2CFK A;  3F8X A;  4J8T A;  2WOH A;  2Z77 A;  3B8L A;  3D3L A;  4N6N B;  4R1K A;  1DMQ A;  1FUS A;  2IY2 A;  1CH0 A;  1RGL A;  2PZV A;  3KCH A;  1W6G A;  1UW1 A;  1FUW A;  4ORL A;  2RCD A;  1B21 A;  2K3D A;  1RHL A;  2XFS A;  1E97 A;  3PZW A;  3A76 A;  3IJE B;  1OAC A;  1Y4K A;  1I0X A;  1VQ4 3;  2ML5 A;  1FGT A;  1ZO2 A;  1STF I;  3NBR A;  1LOX A;  1VQO 3;  1B3S A;  1UCJ A;  2BIR A;  3LT8 A;  2GU3 A;  3OWU A;  1IK3 A;  3RDE A;  1K73 4;  2W0Q A;  4RBN A;  2HML B;  1AVK A;  4FMB A;  4WWU C;  1N5P A;  2W2C A;  5DRE A;  3T8N A;  1BUJ A;  4MJD A;  1VQ5 3;  1RRH A;  1UGH I;  5EEO A;  1LNH A;  1RMS A;  1W2Z A;  5IEN A;  1LOW A;  3OW2 2;  2CWT A;  2BMR B;  1RNB A;  1RGE A;  1WNH A;  1IVU A;  3UL5 A;  2K0M A;  5DRV A;  2D1W A;  1BSC A;  1DVC A;  1Q40 B;  3CCE 3;  4IT7 A;  4O02 B;  1GSP A;  1I0V A;  3F7X A;  1EA2 A;  2YFI B;  3LZA A;  3HZP A;  3EHC A;  3O8Y A;  4XBT A;  3K5T A;  3D5I A;  3OWS A;  3D4A A;  4STD A;  2M7O A;  3CCQ 3;  1JN5 A;  1TFK A;  3LTD A;  5STD A;  1VZZ A;  2HMM B;  4TX4 A;  1JBT A;  3BB9 A;  3EN8 A;  1FGM A;  5IG3 A;  4FR9 A;  1R4Y A;  1K41 A;  3OXA A;  4WYK B;  2F99 A;  3L0R A;  3LTA A;  4OUQ A;  1M9G A;  3CC7 3;  1W6Y A;  4HAA A;  2KF6 A;  4DKI A;  4WYK A;  1FUT A;  2CFL A;  3KSE D;  3EBY A;  4FCM A;  1SII A;  3F8H A;  2BT3 A;  1W02 A;  3GRD A;  1BNG A;  3T0U A;  1S72 3;  2C11 A;  3Q2P A;  4LMI A;  2IUJ A;  1BRI A;  3MG1 A;  4L8O A;  2F4Y A;  1U5O A;  2YFL B;  3AHW A;  4BTY A;  3CCJ 3;  2OOV A;  3FF0 A;  1TU5 A;  1FZU A;  1Q7Y 4;  4GB5 A;  1GS3 A;  2Y73 A;  3BIR A;  1IQY A;  1JKG A;  1NO3 A;  4H61 A;  5LC7 A;  1PU4 A;  2CK3 H;  1IDP A;  1OGX A;  2Z6B A;  1W00 A;  5M18 A;  3FZW A;  3VF1 A;  1Q7H A;  2UX0 A;  1FA3 A;  1ZX2 A;  3FG4 A;  4HM2 B;  3EC9 A;  3A5E A;  1N8R 4;  3SLU A;  3DM8 A;  3F7S A;  1OCV A;  2JDI H;  1O7H B;  4FMD A;  4HOH A;  3AHS A;  3BLZ A;  2SBL A;  4U13 A;  4Q53 A;  6RNT A;  1T5Y A;  3KKG A;  5AIG A;  4BTW A;  2H0H A;  1ZGX A;  1IQX A;  4J9A A;  1NJI 4;  4ZM8 A;  1C54 A;  1RCL A;  1UCI A;  1B27 A;  3DMC A;  1W2B 2; 
#chains in the Genus database with same CATH homology
 1BNR A;  2BU4 A;  1Q9E A;  8RNT A;  4RNT A;  4BIR A;  3GSP A;  1UCK A;  1AQZ A;  1BIR A;  1I8V A;  2KF4 A;  3WHO A;  3AGN A;  7GSP A;  1BAN A;  1BNI A;  1RN1 A;  1GMP A;  2ZA4 A;  1GMR A;  5RNT A;  2SAR A;  1BNS A;  2GSP A;  1RSN A;  1B2X A;  1I3F A;  3SYU A;  1GOV A;  1RGF A;  1BGS A;  1T2I A;  1LOV A;  1BNF A;  1BAO A;  1DET A;  1RTU A;  1HYF A;  1TTO A;  1T2H A;  1FUS A;  1B2M A;  1X1X A;  1FW7 A;  1PY3 A;  3BU4 A;  1CH0 A;  1AY7 A;  1RGL A;  1RNT A;  2F5W A;  2KF5 A;  3KCH A;  2F5M A;  1BNE A;  1B21 A;  1RHL A;  2HOH A;  1BRH A;  1BSA A;  1LNI A;  1B2U A;  3DH2 A;  3HOH A;  1I0X A;  1DE3 A;  3URP A;  1B3S A;  1UCJ A;  2BIR A;  4J5K A;  5BU4 A;  1B2S A;  3RNT A;  1BUJ A;  1RN4 A;  1TRP A;  3DGY A;  1RMS A;  1BSD A;  1BU4 A;  1LOW A;  3Q3F A;  1YNV X;  1I70 A;  1RGE A;  1B27 A;  1RNB A;  2C4B A;  1BSB A;  2KF3 A;  1BSC A;  1YGW A;  1X1Y A;  1BRJ A;  1GSP A;  1I0V A;  1IYY A;  1A2P A;  1BNJ A;  2RBI A;  1I2E A;  3D5I A;  1GOY A;  3D4A A;  1MGR A;  1JBT A;  1I2G A;  2AAE A;  2F56 A;  1RGG A;  1HZ1 A;  1GMQ A;  3AGO A;  1R4Y A;  1B2Z A;  2AAD A;  1RLS A;  1RGH A;  1BRG A;  1G02 A;  4HAA A;  2KF6 A;  1FUT A;  4GSP A;  3WR2 A;  1LOY A;  1RGC A;  1TRQ A;  1B20 A;  1BVI A;  1BNG A;  1RGK A;  1X1W A;  1SAR A;  1BRS A;  1RCK A;  5GSP A;  1RDS A;  1BRI A;  2F4Y A;  6GSP A;  5BIR A;  4GHO A;  4BU4 A;  5HOH A;  3AHW A;  9RNT A;  1PYL A;  1FZU A;  3BIR A;  1BOX A;  1GOU A;  1X1U A;  1JBR A;  2KAA A;  3D5G A;  1BRK A;  1FYS A;  1MGW A;  3A5E A;  1UCL A;  1BSE A;  1YVS A;  4HOH A;  3AHS A;  1BRN L;  1LRA A;  6RNT A;  1RGA A;  1JBS A;  1ZGX A;  2RNT A;  4J5G A;  1C54 A;  1RCL A;  1UCI A;  7RNT A;  1I3I A;  1I2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...