1X1YA

Water-mediate interaction at aprotein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1yA00
1X1UA 1B27A 2GSPA 1BRKA 1B3SA 3AGNA 3D5GA 2F56A 6RNTA 1DETA 1PYLA 1RHLA 1BNEA 1LRAA 1LOYA 2RBIA 3BIRA 4BU4A 2ZA4A 1RTUA 1BUJA 1FZUA 7GSPA 1RMSA 1I2FA 1TRQA 2F4YA 1BOXA 5RNTA 1FUTA 1BSDA 1I8VA 1BNRA 1RGAA 3KCHA 1G02A 3D5IA 1T2HA 5GSPA 1GOYA 1LNIA 1MGRA 2SARA 2KAAA 1GMQA 3URPA 1RCLA 1B2ZA 5BIRA 1GOVA 5BU4A 1A2PA 4BIRA 1FW7A 1UCIA 4HAAA 7RNTA 1RNBA 1GMPA 1B2SA 1RGKA 1BU4A 3WR2A 1YNVX 1BANA 4GSPA 1I0XA 1BRIA 1BNGA 2KF5A 1BNFA 1GMRA 8RNTA 1I0VA 1B21A 1CH0A 1RLSA 2KF4A 1RGHA 1SARA 2BIRA 3DH2A 1B20A 1DE3A 1UCLA 1BNSA 1GOUA 4HOHA 1B2XA 1YVSA 3Q3FA 1BIRA 3AHWA 2F5WA 1B2MA 1I3IA 1C54A 2AADA 1B2UA 1BSEA 1BSBA 1JBSA 3GSPA 1LOVA 6GSPA 1TRPA 1BRSA 2RNTA 1IYYA 1JBTA 5HOHA 1YGWA 2F5MA 1R4YA 1I70A 1RGFA 4RNTA 9RNTA 1RN1A 3AHSA 3D4AA 1AQZA 1RCKA 3WHOA 3RNTA 1RGEA 2BU4A 1PY3A 1RSNA 2AAEA 2C4BA 1LOWA 3HOHA 1BGSA 2HOHA 4GHOA 3SYUA 1FUSA 1FYSA 1GSPA 1BAOA 1I2EA 1BVIA 2KF6A 1X1XA 1BSCA 1JBRA 1ZGXA 1MGWA 1X1YA 1TTOA 1RGCA 1HZ1A 1BRHA 2KF3A 1I2GA 1UCJA 4J5GA 1RN4A 1BRGA 1HYFA 3DGYA 4J5KA 1BRNL 1I3FA 3A5EA 1RGGA 1RNTA 1RDSA 1BNJA 1UCKA 1X1WA 1AY7A 1BSAA 3BU4A 1RGLA 1Q9EA 1BRJA 3AGOA 1T2IA 1BNIA
chains in the Genus database with same CATH superfamily
2GSPA 1BRKA 1B3SA 2XH9A 3KIIA 4OUQA 3SXXA 2OTL3 3Q1CA 2F56A 1DETA 4HVNA 1U8CB 4FCMA 1UDII 3BIRA 2GU3A 5CXOA 1IK3A 4X2OA 2HMKB 3HX8A 3EJVA 3CCR3 1FZUA 1IV9A 7GSPA 3STDA 4K90B 1RMSA 1TRQA 2K3DA 5RNTA 1GY5A 1RRLA 4L8OA 3V92A 4GB5A 3KZTA 4XBTA 3OWUA 3DXOA 4PEJA 1IVUA 1T2HA 1WMOA 2HMJB 3NV0A 3G16A 5G2GA 3UL6A 1O7GB 1GY6A 1LNIA 2YFJB 2P09A 5CK6A 1VQM3 1MGRA 2MF7A 3WA2X 2CH9A 4MEIA 1O7MB 3CXC2 1GMQA 4FR9A 3GAXA 3LT8A 2WOHA 1JB2A 4AEQA 1NJI4 2PNCA 1A2PA 4KT3B 4N3VA 1FGMA 1UI8A 3WMDA 1RNBA 2BT3A 1UUWB 3NHXA 5DREA 1EQKA 1BU4A 1LVNA 1OGZA 1W6YA 3WR2A 3X3XA 3MG3A 2H0GA 3PYJA 4LZIA 4RNYA 3WOFB 1BNFA 3HZPA 3K63A 2IUJA 1TFOA 2IYJA 4LEHA 1N8R4 4FMBA 8RNTA 3B7CA 3Q2PA 4RZMA 2OOVA 4EW5A 3I0YA 1RGHA 3MG2A 1W2B2 2O3OA 5CLKA 3JUOA 5FW5A 4HM4B 1BNSA 4ILFA 3LTDA 4LGQA 4EV5A 4HM7B 3Q3FA 5AYRB 1OF5B 3CC73 4R9LA 1B2MA 1C54A 3ER7A 3NBBA 3T8UA 3DGMA 3G8ZA 5JPUA 1S723 3F8HA 1K734 1QMAA 3CCJ3 3DGLA 1K9M4 1VQK3 1YGWA 1I70A 9RNTA 3T0UA 3HK4A 3VSYA 2OQEA 1MWSA 1FGRA 3CCU3 1RN1A 1Z1SA 1Q40B 1IT8A 5TGNA 3EX9A 2C10A 3D4AA 3ZG0A 4XDWA 3GZXB 3RNTA 3K5TA 1RGEA 1STDA 2BU4A 2OOVC 1PY3A 1RSNA 2AAEA 2GXFA 3EBYA 2XEPA 1BGSA 1Q42A 2HOHA 3HOHA 3HIIA 3SOAA 1FUSA 4JF8A 1YGEA 4OVMA 3A76A 1BAOA 2H0HA 2KF6A 3SVAA 3CCM3 4O02B 2W9QA 4AKYA 5DRVA 1HU9A 3EHCA 1E3RA 2CFLA 1X1YA 1TTOA 1RGCA 2F98A 3X3YA 1BRHA 1JV2B 1M1XB 2ZHXB 4J5GA 1IVXA 1BRGA 4KFFA 3BNEA 3G713 2C11A 1Q814 1W2ZA 2BMOB 3DGYA 1GD4A 3FF0A 1FA3A 4XM4A 3DZLA 3E99A 4STDA 1PU4A 2WOFA 4WYKB 1OPYA 1JKGA 1V57A 4NREA 1X1WA 4EC6A 4EYCA 3RGAA 3BLZA 3BNDA 2OQEC 3B4OA 4CCVA 1GY7A 1Q9EA 3IMAB 3DGNA 1A2VA 1EKMA 2R41A 2GU1A 3AGOA 5EEOA 4EBGA 2W0QA 2W2CA 4FMAA 1GD3A 1B27A 1T3BA 1X1UA 5EVHA 4CPKA 4HM8B 1MWTA 1OCVA 6RNTA 1Q864 2W04A 1CYUA 4BTYA 1YJN3 2H0IA 1LOYA 2I9WA 2E2TA 4FMDA 2L4VA 3G6E3 2GEXA 2CFGA 4I4KA 2ZL8A 1JB5A 1DVDA 3LTBA 3GRDA 3PCRA 4KFEA 4LMIA 2CKFB 2YX9A 1AV4A 3WODG 3MKIA 1FUTA 1BSDA 4IT7A 2JQ5A 4MMZB 4Q53A 1VQQA 3D5IA 2RSXA 1ROAA 4O3VA 1CEWI 1VQ63 4RNZA 2HMOB 2CIUA 2SBLA 1GOYA 3PGBA 1YVBI 2SARA 3LZAA 3O8YA 1JRQA 2KAAA 1US1A 3H51A 3CD63 1KC84 2W03A 1UUGB 2IUKA 3G4S3 2CFDA 4BIRA 1LQMB 2F99A 1W4NA 3EBTA 5ELJA 5KP3A 7RNTA 1GMPA 2ML6A 1HKXA 1EEJA 3OWSA 3NM2A 4GL6A 1I0XA 1QJGA 3EE1A 3LH4A 3QRDA 1O7HB 4HM6B 3NUVA 3D3LA 5BVBA 1T5YA 3CC23 1TP6A 3BNCA 4HYZA 4J9AA 3MWZA 2IA7A 3U1WA 1I0VA 3NBJA 1IQYA 2Q07A 4O8SA 5KP4A 1RLSA 3V98A 3K7CA 2MC8A 1EUIC 5JPPA 3OXAA 1GOUA 1JJ22 3OWYA 7STDA 3LT9A 3F7SA 2XSHB 3ECFA 8CHOA 1STFI 4L8PA 3T8NA 4IIAA 4U13A 1B2UA 1BSEA 1BSBA 1MOLA 2E2UA 3WDGB 2BHMA 1JBSA 3AMOB 1FGTA 3K9MC 4R4KA 3UJMA 3CCS3 1G96A 4WHAA 1UI7A 1OGXA 1PFPA 3IJEB 5HOHA 1TU5A 1G0TA 4HM3B 2FNQA 1A2KA 3DMCA 3PZWA 2F5MA 4H61A 4CJNA 4DKIA 1GS3A 1RGFA 1RN7A 3QK9A 1DYUA 2CWUA 1Q824 3LTAA 1WMPA 3ALAA 1AQZA 3H3HA 3JUMA 3DGOA 3GWRA 3WHOA 4BTXA 3JUPA 1FUWA 2B1XB 3D9RA 1R4CA 2FXTA 3B4PA 2C4BA 1D6YA 4KFDA 4WYKA 1TUHA 1JN5B 3LXUX 3V99A 3RGRA 4LYLB 1VQ43 1FYSA 2XFSA 3KFQC 1GSPA 1I2EA 3SOYA 5M19A 1EA2A 1SIHA 1BSCA 3F8XA 2P0XA 3MSOA 5IERA 2CC3A 1TIJA 2PZVA 3S5CA 2OTJ3 1OH0A 1RN4A 2KXGA 1HYFA 3GZYB 1KD14 3D79A 1A67A 3EN1B 3CCV3 2CW9A 4J5KA 1VQ53 1V74A 3A5EA 2UGIA 1RDSA 2GEYA 5BXQA 1SPUA 2XSOB 1AY7A 1Q7HA 3NQZA 1RGLA 1IU7A 3CNXA 4I5QA 5I97A 1BRJA 1CQSA 3MHEA 2CG0A 4HM1B 3FG4A 4N6V0 1YHQ3 5AEWB 1BNIA 4HJLB 3SYUA 1N5HA 3AGNA 1KWIA 1W5ZA 1ZO2A 3FG1A 4HBRA 5AI1A 5IEOA 2O9UX 3D5GA 4HM5B 4X2HA 1RHLA 2CFWA 2XR8B 4R80A 4FMCA 4FCJA 3KSPA 3N54B 2ZA4A 1DVCA 3OX9A 4XBYA 1ASKA 3CU3A 5IG5A 1OHOA 3CCL3 1W6CA 3FZWA 1M9GA 3FCSB 2CG1A 2QA43 1LOXA 1QVG2 2BNGA 1BOXA 1WNHA 3ZG5A 1I8VA 1NB3I 2UX0A 2CFKA 3KCHA 1G02A 3GZRA 3MPHA 1DMMA 1AR0A 1W7CA 5AIGA 5GSPA 5IG0A 5IG4A 1VQ93 1ISKA 1SIIA 1YIJ3 1IQ8A 2D1WA 4NPBA 1QAKA 1NNVA 3LOYA 2W6JH 4WFOA 2YFIB 3URPA 5CF1A 2KRTA 2W56B 5BIRA 5BU4A 1FW7A 1CYVA 3M8CA 4N6UA 1OHPA 3NXJA 3X42A 4K1VA 1K28A 1J2BA 1RGKA 1W6GA 4QWTA 2GBWB 2Z7AA 1YNVX 1WQLB 1BRIA 4BTWA 4MMYB 2D42A 2HMLB 3FLJA 1VQL3 1GMRA 3PCSA 2P0MA 1QALA 1QAFA 3AMOA 2Z77A 1S5AA 2Z76A 4BL3A 1IDPA 5IF6A 2KF4A 3SX1A 2CK3H 3DH2A 1B20A 4XB5A 1UCLA 1B2XA 2CX1A 2IMJA 2RCDA 3NM7A 4WP5A 1YVSA 1JZDA 4HZBB 1WMNA 2F86B 1BIRA 5G1KA 3CC43 1RKYA 3AHWA 3SEDA 1IQXA 1D6UA 3X40A 2R4IA 3GSPA 1LOVA 6GSPA 1W02A 4HZ9B 1AVKA 4IPBA 3NX0A 4R1KA 1IYYA 3OW22 1OF5A 3FH1A 1R4YA 1NWWA 1ULJB 2V1LA 3ZFZA 1JB4A 4AKZA 2A15A 5D82A 1OUNA 5CF2A 1RRHA 1UW1A 4RBNA 1N9JA 2P05A 1NB5I 1RCKA 2J8XB 1FGOA 1LOWA 4TX4A 3IPTA 4HM2B 6STDA 1KQS2 2WGQA 2ZDJA 3JUQA 1KSIA 1IV7A 3TDGA 1N5PA 3CPOA 1O7WB 1X1XA 2BO9B 1Q40A 4FCZA 1ZX2A 3MYTA 3J7Yd 5ELUA 1MGWA 5LC7A 1JKGB 1I2GA 5HGRA 3PXMA 5IW9A 4MMXB 2INXA 1EG9B 3SLUA 3ROBA 2QGUA 3Q90A 2K0MA 1RGGA 1RNTA 2OWPA 1A90A 1O7NB 4LSOA 3KSED 1UCKA 4R9KA 1BSAA 2XRXB 3I553 1DMNA 2RGQA 2IY2A 2HMMB 3BNBA 3KN4A 4N6OB 3U97A 2CWTA 3X41A 1M904 3FSDA 2STDA 1FGQA 1MNLA 4HM0B 2XFTA 3CPW2 1OHSA 5M1AA 2HMNB 2ML5A 1PYLA 2QIYA 2XGNA 1U5OA 1BNEA 1LRAA 1ULIB 1E97A 4HKVB 2RBIA 4BU4A 1LNHA 3CME3 3LYGA 3CCQ3 3G0KA 1RTUA 1DMQA 3UB1A 1UGHI 2W56A 1NU3A 1BUJA 5STDA 1D6ZA 5EQLA 4XDVA 1JNQA 1I2FA 2JDIH 2QEX3 2F4YA 3EN8A 5IEPA 3WOEB 1UUVB 1BNRA 3HI7A 3EF8A 1RGAA 5KP1A 3NBRA 2Y74A 3LTCA 2FGTA 4ORLA 1N9EA 1TFKA 5AEUB 3CNMA 3VF1A 3I563 3KKGA 3N9HA 3UNLA 1UGIA 2GBXB 4L7KA 1OACA 2XF3A 3F40A 1SQWA 5LC6A 2BMRB 1RCLA 4WWUC 1B2ZA 4K61A 1GOVA 5AIIA 1N8QA 1UCIA 4HAAA 5G1LA 3FG3A 2E2VA 5A0OB 4K1UA 1VQN3 1B2SA 1IVWA 3K0ZA 3L0RA 1O7PB 2L1SA 1QVF2 2Y73A 1BANA 3NV0B 4GSPA 1BNGA 1C7HA 5FGOA 2KF5A 5M18A 1YIT3 2RFRA 2WGOA 4J8TA 4NHFA 3S29A 1VQO3 1K41A 2KCDA 1GYBA 1YJ93 5IENA 4H3UA 4EV2A 4G1MB 1B21A 3F14A 4N6MA 2OCTA 1CH0A 3LMLA 1VZZA 1SARA 1TJDA 1Q7Y4 2BIRA 2Z6BA 5JBSA 3EB8A 1DE3A 1W01A 1K8A4 1MWRA 3KE7A 5AIHA 2CX0A 4HOHA 5D83A 2CHCA 3OV4A 1Y4KA 3MG1A 3NQYA 3HIGA 1M1K4 1RJOA 2F5WA 3B8LA 1I3IA 2AADA 3PS8A 1VQ83 4N6LA 1LQGC 1TRPA 3F7XA 1YJW3 3DUKA 1BRSA 1IVVA 3VGNA 2RNTA 1JBTA 1WTHA 1NDOB 1ZS7A 1W00A 2XGLA 4RNTA 5AYSC 3JVCA 3AHSA 1L5GB 3BB9A 1MWUA 3DM8A 4O2HA 3CCE3 4XBXA 2W9PA 1F8NA 4KVHA 4BL2A 3GZBA 4GHOA 2YFLB 3DY5A 1NO3A 2K54A 5IG3A 3EC9A 3S27A 1V58A 2WO0A 1BVIA 2M7OA 2CWVA 3UL5A 4EXRA 1ZGXA 1JBRA 1VQ73 3X3ZA 1BUQA 1HZ1A 1IT7A 4ZM8A 2LQVA 2KF3A 2LYXA 3F9SA 1UCJA 3FGYA 1VQP3 4N6TA 3EQQB 1JN5A 3FF2A 5D81A 5AIFA 1JZOA 3N8BA 2UUGC 4MJDA 1YI23 1I3FA 1BRNL 4KZ1A 4OK0A 1SJWA 1ROVA 1LXEA 2BMQB 1BNJA 3BU4A 1AVLA 4JRFA 3RDEA 3S67A 3S28A 4CDLA 3CMA3 2B24B 1T2IA 3JUNA 4N6NB 1E3VA 2P38A 3WA3A 3FKAA
chains in the Genus database with same CATH topology
1X1UA 1B27A 2GSPA 1BRKA 1B3SA 3AGNA 3D5GA 2F56A 6RNTA 1DETA 1PYLA 1RHLA 1BNEA 1LRAA 1LOYA 2RBIA 3BIRA 4BU4A 2ZA4A 1RTUA 1BUJA 1FZUA 7GSPA 1RMSA 1I2FA 1TRQA 2F4YA 1BOXA 5RNTA 1FUTA 1BSDA 1I8VA 1BNRA 1RGAA 3KCHA 1G02A 3D5IA 1T2HA 5GSPA 1GOYA 1LNIA 1MGRA 2SARA 2KAAA 1GMQA 3URPA 1RCLA 1B2ZA 5BIRA 1GOVA 5BU4A 1A2PA 4BIRA 1FW7A 1UCIA 4HAAA 7RNTA 1RNBA 1GMPA 1B2SA 1RGKA 1BU4A 3WR2A 1YNVX 1BANA 4GSPA 1I0XA 1BRIA 1BNGA 2KF5A 1BNFA 1GMRA 8RNTA 1I0VA 1B21A 1CH0A 1RLSA 2KF4A 1RGHA 1SARA 2BIRA 3DH2A 1B20A 1DE3A 1UCLA 1BNSA 1GOUA 4HOHA 1B2XA 1YVSA 3Q3FA 1BIRA 3AHWA 2F5WA 1B2MA 1I3IA 1C54A 2AADA 1B2UA 1BSEA 1BSBA 1JBSA 3GSPA 1LOVA 6GSPA 1TRPA 1BRSA 2RNTA 1IYYA 1JBTA 5HOHA 1YGWA 2F5MA 1R4YA 1I70A 1RGFA 4RNTA 9RNTA 1RN1A 3AHSA 3D4AA 1AQZA 1RCKA 3WHOA 3RNTA 1RGEA 2BU4A 1PY3A 1RSNA 2AAEA 2C4BA 1LOWA 3HOHA 1BGSA 2HOHA 4GHOA 3SYUA 1FUSA 1FYSA 1GSPA 1BAOA 1I2EA 1BVIA 2KF6A 1X1XA 1BSCA 1JBRA 1ZGXA 1MGWA 1X1YA 1TTOA 1RGCA 1HZ1A 1BRHA 2KF3A 1I2GA 1UCJA 4J5GA 1RN4A 1BRGA 1HYFA 3DGYA 4J5KA 1BRNL 1I3FA 3A5EA 1RGGA 1RNTA 1RDSA 1BNJA 1UCKA 1X1WA 1AY7A 1BSAA 3BU4A 1RGLA 1Q9EA 1BRJA 3AGOA 1T2IA 1BNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1U A;  1B27 A;  2GSP A;  1BRK A;  1B3S A;  3AGN A;  3D5G A;  2F56 A;  6RNT A;  1DET A;  1PYL A;  1RHL A;  1BNE A;  1LRA A;  1LOY A;  2RBI A;  3BIR A;  4BU4 A;  2ZA4 A;  1RTU A;  1BUJ A;  1FZU A;  7GSP A;  1RMS A;  1I2F A;  1TRQ A;  2F4Y A;  1BOX A;  5RNT A;  1FUT A;  1BSD A;  1I8V A;  1BNR A;  1RGA A;  3KCH A;  1G02 A;  3D5I A;  1T2H A;  5GSP A;  1GOY A;  1LNI A;  1MGR A;  2SAR A;  2KAA A;  1GMQ A;  3URP A;  1RCL A;  1B2Z A;  5BIR A;  1GOV A;  5BU4 A;  1A2P A;  4BIR A;  1FW7 A;  1UCI A;  4HAA A;  7RNT A;  1RNB A;  1GMP A;  1B2S A;  1RGK A;  1BU4 A;  3WR2 A;  1YNV X;  1BAN A;  4GSP A;  1I0X A;  1BRI A;  1BNG A;  2KF5 A;  1BNF A;  1GMR A;  8RNT A;  1I0V A;  1B21 A;  1CH0 A;  1RLS A;  2KF4 A;  1RGH A;  1SAR A;  2BIR A;  3DH2 A;  1B20 A;  1DE3 A;  1UCL A;  1BNS A;  1GOU A;  4HOH A;  1B2X A;  1YVS A;  3Q3F A;  1BIR A;  3AHW A;  2F5W A;  1B2M A;  1I3I A;  1C54 A;  2AAD A;  1B2U A;  1BSE A;  1BSB A;  1JBS A;  3GSP A;  1LOV A;  6GSP A;  1TRP A;  1BRS A;  2RNT A;  1IYY A;  1JBT A;  5HOH A;  1YGW A;  2F5M A;  1R4Y A;  1I70 A;  1RGF A;  4RNT A;  9RNT A;  1RN1 A;  3AHS A;  3D4A A;  1AQZ A;  1RCK A;  3WHO A;  3RNT A;  1RGE A;  2BU4 A;  1PY3 A;  1RSN A;  2AAE A;  2C4B A;  1LOW A;  3HOH A;  1BGS A;  2HOH A;  4GHO A;  3SYU A;  1FUS A;  1FYS A;  1GSP A;  1BAO A;  1I2E A;  1BVI A;  2KF6 A;  1X1X A;  1BSC A;  1JBR A;  1ZGX A;  1MGW A;  1X1Y A;  1TTO A;  1RGC A;  1HZ1 A;  1BRH A;  2KF3 A;  1I2G A;  1UCJ A;  4J5G A;  1RN4 A;  1BRG A;  1HYF A;  3DGY A;  4J5K A;  1BRN L;  1I3F A;  3A5E A;  1RGG A;  1RNT A;  1RDS A;  1BNJ A;  1UCK A;  1X1W A;  1AY7 A;  1BSA A;  3BU4 A;  1RGL A;  1Q9E A;  1BRJ A;  3AGO A;  1T2I A;  1BNI A; 
#chains in the Genus database with same CATH topology
 2GSP A;  1BRK A;  1B3S A;  2XH9 A;  3KII A;  4OUQ A;  3SXX A;  2OTL 3;  3Q1C A;  2F56 A;  1DET A;  4HVN A;  1U8C B;  4FCM A;  1UDI I;  3BIR A;  2GU3 A;  5CXO A;  1IK3 A;  4X2O A;  2HMK B;  3HX8 A;  3EJV A;  3CCR 3;  1FZU A;  1IV9 A;  7GSP A;  3STD A;  4K90 B;  1RMS A;  1TRQ A;  2K3D A;  5RNT A;  1GY5 A;  1RRL A;  4L8O A;  3V92 A;  4GB5 A;  3KZT A;  4XBT A;  3OWU A;  3DXO A;  4PEJ A;  1IVU A;  1T2H A;  1WMO A;  2HMJ B;  3NV0 A;  3G16 A;  5G2G A;  3UL6 A;  1O7G B;  1GY6 A;  1LNI A;  2YFJ B;  2P09 A;  5CK6 A;  1VQM 3;  1MGR A;  2MF7 A;  3WA2 X;  2CH9 A;  4MEI A;  1O7M B;  3CXC 2;  1GMQ A;  4FR9 A;  3GAX A;  3LT8 A;  2WOH A;  1JB2 A;  4AEQ A;  1NJI 4;  2PNC A;  1A2P A;  4KT3 B;  4N3V A;  1FGM A;  1UI8 A;  3WMD A;  1RNB A;  2BT3 A;  1UUW B;  3NHX A;  5DRE A;  1EQK A;  1BU4 A;  1LVN A;  1OGZ A;  1W6Y A;  3WR2 A;  3X3X A;  3MG3 A;  2H0G A;  3PYJ A;  4LZI A;  4RNY A;  3WOF B;  1BNF A;  3HZP A;  3K63 A;  2IUJ A;  1TFO A;  2IYJ A;  4LEH A;  1N8R 4;  4FMB A;  8RNT A;  3B7C A;  3Q2P A;  4RZM A;  2OOV A;  4EW5 A;  3I0Y A;  1RGH A;  3MG2 A;  1W2B 2;  2O3O A;  5CLK A;  3JUO A;  5FW5 A;  4HM4 B;  1BNS A;  4ILF A;  3LTD A;  4LGQ A;  4EV5 A;  4HM7 B;  3Q3F A;  5AYR B;  1OF5 B;  3CC7 3;  4R9L A;  1B2M A;  1C54 A;  3ER7 A;  3NBB A;  3T8U A;  3DGM A;  3G8Z A;  5JPU A;  1S72 3;  3F8H A;  1K73 4;  1QMA A;  3CCJ 3;  3DGL A;  1K9M 4;  1VQK 3;  1YGW A;  1I70 A;  9RNT A;  3T0U A;  3HK4 A;  3VSY A;  2OQE A;  1MWS A;  1FGR A;  3CCU 3;  1RN1 A;  1Z1S A;  1Q40 B;  1IT8 A;  5TGN A;  3EX9 A;  2C10 A;  3D4A A;  3ZG0 A;  4XDW A;  3GZX B;  3RNT A;  3K5T A;  1RGE A;  1STD A;  2BU4 A;  2OOV C;  1PY3 A;  1RSN A;  2AAE A;  2GXF A;  3EBY A;  2XEP A;  1BGS A;  1Q42 A;  2HOH A;  3HOH A;  3HII A;  3SOA A;  1FUS A;  4JF8 A;  1YGE A;  4OVM A;  3A76 A;  1BAO A;  2H0H A;  2KF6 A;  3SVA A;  3CCM 3;  4O02 B;  2W9Q A;  4AKY A;  5DRV A;  1HU9 A;  3EHC A;  1E3R A;  2CFL A;  1X1Y A;  1TTO A;  1RGC A;  2F98 A;  3X3Y A;  1BRH A;  1JV2 B;  1M1X B;  2ZHX B;  4J5G A;  1IVX A;  1BRG A;  4KFF A;  3BNE A;  3G71 3;  2C11 A;  1Q81 4;  1W2Z A;  2BMO B;  3DGY A;  1GD4 A;  3FF0 A;  1FA3 A;  4XM4 A;  3DZL A;  3E99 A;  4STD A;  1PU4 A;  2WOF A;  4WYK B;  1OPY A;  1JKG A;  1V57 A;  4NRE A;  1X1W A;  4EC6 A;  4EYC A;  3RGA A;  3BLZ A;  3BND A;  2OQE C;  3B4O A;  4CCV A;  1GY7 A;  1Q9E A;  3IMA B;  3DGN A;  1A2V A;  1EKM A;  2R41 A;  2GU1 A;  3AGO A;  5EEO A;  4EBG A;  2W0Q A;  2W2C A;  4FMA A;  1GD3 A;  1B27 A;  1T3B A;  1X1U A;  5EVH A;  4CPK A;  4HM8 B;  1MWT A;  1OCV A;  6RNT A;  1Q86 4;  2W04 A;  1CYU A;  4BTY A;  1YJN 3;  2H0I A;  1LOY A;  2I9W A;  2E2T A;  4FMD A;  2L4V A;  3G6E 3;  2GEX A;  2CFG A;  4I4K A;  2ZL8 A;  1JB5 A;  1DVD A;  3LTB A;  3GRD A;  3PCR A;  4KFE A;  4LMI A;  2CKF B;  2YX9 A;  1AV4 A;  3WOD G;  3MKI A;  1FUT A;  1BSD A;  4IT7 A;  2JQ5 A;  4MMZ B;  4Q53 A;  1VQQ A;  3D5I A;  2RSX A;  1ROA A;  4O3V A;  1CEW I;  1VQ6 3;  4RNZ A;  2HMO B;  2CIU A;  2SBL A;  1GOY A;  3PGB A;  1YVB I;  2SAR A;  3LZA A;  3O8Y A;  1JRQ A;  2KAA A;  1US1 A;  3H51 A;  3CD6 3;  1KC8 4;  2W03 A;  1UUG B;  2IUK A;  3G4S 3;  2CFD A;  4BIR A;  1LQM B;  2F99 A;  1W4N A;  3EBT A;  5ELJ A;  5KP3 A;  7RNT A;  1GMP A;  2ML6 A;  1HKX A;  1EEJ A;  3OWS A;  3NM2 A;  4GL6 A;  1I0X A;  1QJG A;  3EE1 A;  3LH4 A;  3QRD A;  1O7H B;  4HM6 B;  3NUV A;  3D3L A;  5BVB A;  1T5Y A;  3CC2 3;  1TP6 A;  3BNC A;  4HYZ A;  4J9A A;  3MWZ A;  2IA7 A;  3U1W A;  1I0V A;  3NBJ A;  1IQY A;  2Q07 A;  4O8S A;  5KP4 A;  1RLS A;  3V98 A;  3K7C A;  2MC8 A;  1EUI C;  5JPP A;  3OXA A;  1GOU A;  1JJ2 2;  3OWY A;  7STD A;  3LT9 A;  3F7S A;  2XSH B;  3ECF A;  8CHO A;  1STF I;  4L8P A;  3T8N A;  4IIA A;  4U13 A;  1B2U A;  1BSE A;  1BSB A;  1MOL A;  2E2U A;  3WDG B;  2BHM A;  1JBS A;  3AMO B;  1FGT A;  3K9M C;  4R4K A;  3UJM A;  3CCS 3;  1G96 A;  4WHA A;  1UI7 A;  1OGX A;  1PFP A;  3IJE B;  5HOH A;  1TU5 A;  1G0T A;  4HM3 B;  2FNQ A;  1A2K A;  3DMC A;  3PZW A;  2F5M A;  4H61 A;  4CJN A;  4DKI A;  1GS3 A;  1RGF A;  1RN7 A;  3QK9 A;  1DYU A;  2CWU A;  1Q82 4;  3LTA A;  1WMP A;  3ALA A;  1AQZ A;  3H3H A;  3JUM A;  3DGO A;  3GWR A;  3WHO A;  4BTX A;  3JUP A;  1FUW A;  2B1X B;  3D9R A;  1R4C A;  2FXT A;  3B4P A;  2C4B A;  1D6Y A;  4KFD A;  4WYK A;  1TUH A;  1JN5 B;  3LXU X;  3V99 A;  3RGR A;  4LYL B;  1VQ4 3;  1FYS A;  2XFS A;  3KFQ C;  1GSP A;  1I2E A;  3SOY A;  5M19 A;  1EA2 A;  1SIH A;  1BSC A;  3F8X A;  2P0X A;  3MSO A;  5IER A;  2CC3 A;  1TIJ A;  2PZV A;  3S5C A;  2OTJ 3;  1OH0 A;  1RN4 A;  2KXG A;  1HYF A;  3GZY B;  1KD1 4;  3D79 A;  1A67 A;  3EN1 B;  3CCV 3;  2CW9 A;  4J5K A;  1VQ5 3;  1V74 A;  3A5E A;  2UGI A;  1RDS A;  2GEY A;  5BXQ A;  1SPU A;  2XSO B;  1AY7 A;  1Q7H A;  3NQZ A;  1RGL A;  1IU7 A;  3CNX A;  4I5Q A;  5I97 A;  1BRJ A;  1CQS A;  3MHE A;  2CG0 A;  4HM1 B;  3FG4 A;  4N6V 0;  1YHQ 3;  5AEW B;  1BNI A;  4HJL B;  3SYU A;  1N5H A;  3AGN A;  1KWI A;  1W5Z A;  1ZO2 A;  3FG1 A;  4HBR A;  5AI1 A;  5IEO A;  2O9U X;  3D5G A;  4HM5 B;  4X2H A;  1RHL A;  2CFW A;  2XR8 B;  4R80 A;  4FMC A;  4FCJ A;  3KSP A;  3N54 B;  2ZA4 A;  1DVC A;  3OX9 A;  4XBY A;  1ASK A;  3CU3 A;  5IG5 A;  1OHO A;  3CCL 3;  1W6C A;  3FZW A;  1M9G A;  3FCS B;  2CG1 A;  2QA4 3;  1LOX A;  1QVG 2;  2BNG A;  1BOX A;  1WNH A;  3ZG5 A;  1I8V A;  1NB3 I;  2UX0 A;  2CFK A;  3KCH A;  1G02 A;  3GZR A;  3MPH A;  1DMM A;  1AR0 A;  1W7C A;  5AIG A;  5GSP A;  5IG0 A;  5IG4 A;  1VQ9 3;  1ISK A;  1SII A;  1YIJ 3;  1IQ8 A;  2D1W A;  4NPB A;  1QAK A;  1NNV A;  3LOY A;  2W6J H;  4WFO A;  2YFI B;  3URP A;  5CF1 A;  2KRT A;  2W56 B;  5BIR A;  5BU4 A;  1FW7 A;  1CYV A;  3M8C A;  4N6U A;  1OHP A;  3NXJ A;  3X42 A;  4K1V A;  1K28 A;  1J2B A;  1RGK A;  1W6G A;  4QWT A;  2GBW B;  2Z7A A;  1YNV X;  1WQL B;  1BRI A;  4BTW A;  4MMY B;  2D42 A;  2HML B;  3FLJ A;  1VQL 3;  1GMR A;  3PCS A;  2P0M A;  1QAL A;  1QAF A;  3AMO A;  2Z77 A;  1S5A A;  2Z76 A;  4BL3 A;  1IDP A;  5IF6 A;  2KF4 A;  3SX1 A;  2CK3 H;  3DH2 A;  1B20 A;  4XB5 A;  1UCL A;  1B2X A;  2CX1 A;  2IMJ A;  2RCD A;  3NM7 A;  4WP5 A;  1YVS A;  1JZD A;  4HZB B;  1WMN A;  2F86 B;  1BIR A;  5G1K A;  3CC4 3;  1RKY A;  3AHW A;  3SED A;  1IQX A;  1D6U A;  3X40 A;  2R4I A;  3GSP A;  1LOV A;  6GSP A;  1W02 A;  4HZ9 B;  1AVK A;  4IPB A;  3NX0 A;  4R1K A;  1IYY A;  3OW2 2;  1OF5 A;  3FH1 A;  1R4Y A;  1NWW A;  1ULJ B;  2V1L A;  3ZFZ A;  1JB4 A;  4AKZ A;  2A15 A;  5D82 A;  1OUN A;  5CF2 A;  1RRH A;  1UW1 A;  4RBN A;  1N9J A;  2P05 A;  1NB5 I;  1RCK A;  2J8X B;  1FGO A;  1LOW A;  4TX4 A;  3IPT A;  4HM2 B;  6STD A;  1KQS 2;  2WGQ A;  2ZDJ A;  3JUQ A;  1KSI A;  1IV7 A;  3TDG A;  1N5P A;  3CPO A;  1O7W B;  1X1X A;  2BO9 B;  1Q40 A;  4FCZ A;  1ZX2 A;  3MYT A;  3J7Y d;  5ELU A;  1MGW A;  5LC7 A;  1JKG B;  1I2G A;  5HGR A;  3PXM A;  5IW9 A;  4MMX B;  2INX A;  1EG9 B;  3SLU A;  3ROB A;  2QGU A;  3Q90 A;  2K0M A;  1RGG A;  1RNT A;  2OWP A;  1A90 A;  1O7N B;  4LSO A;  3KSE D;  1UCK A;  4R9K A;  1BSA A;  2XRX B;  3I55 3;  1DMN A;  2RGQ A;  2IY2 A;  2HMM B;  3BNB A;  3KN4 A;  4N6O B;  3U97 A;  2CWT A;  3X41 A;  1M90 4;  3FSD A;  2STD A;  1FGQ A;  1MNL A;  4HM0 B;  2XFT A;  3CPW 2;  1OHS A;  5M1A A;  2HMN B;  2ML5 A;  1PYL A;  2QIY A;  2XGN A;  1U5O A;  1BNE A;  1LRA A;  1ULI B;  1E97 A;  4HKV B;  2RBI A;  4BU4 A;  1LNH A;  3CME 3;  3LYG A;  3CCQ 3;  3G0K A;  1RTU A;  1DMQ A;  3UB1 A;  1UGH I;  2W56 A;  1NU3 A;  1BUJ A;  5STD A;  1D6Z A;  5EQL A;  4XDV A;  1JNQ A;  1I2F A;  2JDI H;  2QEX 3;  2F4Y A;  3EN8 A;  5IEP A;  3WOE B;  1UUV B;  1BNR A;  3HI7 A;  3EF8 A;  1RGA A;  5KP1 A;  3NBR A;  2Y74 A;  3LTC A;  2FGT A;  4ORL A;  1N9E A;  1TFK A;  5AEU B;  3CNM A;  3VF1 A;  3I56 3;  3KKG A;  3N9H A;  3UNL A;  1UGI A;  2GBX B;  4L7K A;  1OAC A;  2XF3 A;  3F40 A;  1SQW A;  5LC6 A;  2BMR B;  1RCL A;  4WWU C;  1B2Z A;  4K61 A;  1GOV A;  5AII A;  1N8Q A;  1UCI A;  4HAA A;  5G1L A;  3FG3 A;  2E2V A;  5A0O B;  4K1U A;  1VQN 3;  1B2S A;  1IVW A;  3K0Z A;  3L0R A;  1O7P B;  2L1S A;  1QVF 2;  2Y73 A;  1BAN A;  3NV0 B;  4GSP A;  1BNG A;  1C7H A;  5FGO A;  2KF5 A;  5M18 A;  1YIT 3;  2RFR A;  2WGO A;  4J8T A;  4NHF A;  3S29 A;  1VQO 3;  1K41 A;  2KCD A;  1GYB A;  1YJ9 3;  5IEN A;  4H3U A;  4EV2 A;  4G1M B;  1B21 A;  3F14 A;  4N6M A;  2OCT A;  1CH0 A;  3LML A;  1VZZ A;  1SAR A;  1TJD A;  1Q7Y 4;  2BIR A;  2Z6B A;  5JBS A;  3EB8 A;  1DE3 A;  1W01 A;  1K8A 4;  1MWR A;  3KE7 A;  5AIH A;  2CX0 A;  4HOH A;  5D83 A;  2CHC A;  3OV4 A;  1Y4K A;  3MG1 A;  3NQY A;  3HIG A;  1M1K 4;  1RJO A;  2F5W A;  3B8L A;  1I3I A;  2AAD A;  3PS8 A;  1VQ8 3;  4N6L A;  1LQG C;  1TRP A;  3F7X A;  1YJW 3;  3DUK A;  1BRS A;  1IVV A;  3VGN A;  2RNT A;  1JBT A;  1WTH A;  1NDO B;  1ZS7 A;  1W00 A;  2XGL A;  4RNT A;  5AYS C;  3JVC A;  3AHS A;  1L5G B;  3BB9 A;  1MWU A;  3DM8 A;  4O2H A;  3CCE 3;  4XBX A;  2W9P A;  1F8N A;  4KVH A;  4BL2 A;  3GZB A;  4GHO A;  2YFL B;  3DY5 A;  1NO3 A;  2K54 A;  5IG3 A;  3EC9 A;  3S27 A;  1V58 A;  2WO0 A;  1BVI A;  2M7O A;  2CWV A;  3UL5 A;  4EXR A;  1ZGX A;  1JBR A;  1VQ7 3;  3X3Z A;  1BUQ A;  1HZ1 A;  1IT7 A;  4ZM8 A;  2LQV A;  2KF3 A;  2LYX A;  3F9S A;  1UCJ A;  3FGY A;  1VQP 3;  4N6T A;  3EQQ B;  1JN5 A;  3FF2 A;  5D81 A;  5AIF A;  1JZO A;  3N8B A;  2UUG C;  4MJD A;  1YI2 3;  1I3F A;  1BRN L;  4KZ1 A;  4OK0 A;  1SJW A;  1ROV A;  1LXE A;  2BMQ B;  1BNJ A;  3BU4 A;  1AVL A;  4JRF A;  3RDE A;  3S67 A;  3S28 A;  4CDL A;  3CMA 3;  2B24 B;  1T2I A;  3JUN A;  4N6N B;  1E3V A;  2P38 A;  3WA3 A;  3FKA A; 
#chains in the Genus database with same CATH homology
 1X1U A;  1B27 A;  2GSP A;  1BRK A;  1B3S A;  3AGN A;  3D5G A;  2F56 A;  6RNT A;  1DET A;  1PYL A;  1RHL A;  1BNE A;  1LRA A;  1LOY A;  2RBI A;  3BIR A;  4BU4 A;  2ZA4 A;  1RTU A;  1BUJ A;  1FZU A;  7GSP A;  1RMS A;  1I2F A;  1TRQ A;  2F4Y A;  1BOX A;  5RNT A;  1FUT A;  1BSD A;  1I8V A;  1BNR A;  1RGA A;  3KCH A;  1G02 A;  3D5I A;  1T2H A;  5GSP A;  1GOY A;  1LNI A;  1MGR A;  2SAR A;  2KAA A;  1GMQ A;  3URP A;  1RCL A;  1B2Z A;  5BIR A;  1GOV A;  5BU4 A;  1A2P A;  4BIR A;  1FW7 A;  1UCI A;  4HAA A;  7RNT A;  1RNB A;  1GMP A;  1B2S A;  1RGK A;  1BU4 A;  3WR2 A;  1YNV X;  1BAN A;  4GSP A;  1I0X A;  1BRI A;  1BNG A;  2KF5 A;  1BNF A;  1GMR A;  8RNT A;  1I0V A;  1B21 A;  1CH0 A;  1RLS A;  2KF4 A;  1RGH A;  1SAR A;  2BIR A;  3DH2 A;  1B20 A;  1DE3 A;  1UCL A;  1BNS A;  1GOU A;  4HOH A;  1B2X A;  1YVS A;  3Q3F A;  1BIR A;  3AHW A;  2F5W A;  1B2M A;  1I3I A;  1C54 A;  2AAD A;  1B2U A;  1BSE A;  1BSB A;  1JBS A;  3GSP A;  1LOV A;  6GSP A;  1TRP A;  1BRS A;  2RNT A;  1IYY A;  1JBT A;  5HOH A;  1YGW A;  2F5M A;  1R4Y A;  1I70 A;  1RGF A;  4RNT A;  9RNT A;  1RN1 A;  3AHS A;  3D4A A;  1AQZ A;  1RCK A;  3WHO A;  3RNT A;  1RGE A;  2BU4 A;  1PY3 A;  1RSN A;  2AAE A;  2C4B A;  1LOW A;  3HOH A;  1BGS A;  2HOH A;  4GHO A;  3SYU A;  1FUS A;  1FYS A;  1GSP A;  1BAO A;  1I2E A;  1BVI A;  2KF6 A;  1X1X A;  1BSC A;  1JBR A;  1ZGX A;  1MGW A;  1X1Y A;  1TTO A;  1RGC A;  1HZ1 A;  1BRH A;  2KF3 A;  1I2G A;  1UCJ A;  4J5G A;  1RN4 A;  1BRG A;  1HYF A;  3DGY A;  4J5K A;  1BRN L;  1I3F A;  3A5E A;  1RGG A;  1RNT A;  1RDS A;  1BNJ A;  1UCK A;  1X1W A;  1AY7 A;  1BSA A;  3BU4 A;  1RGL A;  1Q9E A;  1BRJ A;  3AGO A;  1T2I A;  1BNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...