1X1YA

Water-mediate interaction at aprotein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
molecule keywords Ribonuclease
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1yA00
2ZA4A 1UCJA 3HOHA 1BSCA 1TRQA 2F56A 1LOVA 1RGHA 1B2XA 1I0XA 1PYLA 1LNIA 1BRHA 1BNFA 3WHOA 2KF4A 1TRPA 1GOYA 1GMRA 1G02A 1RGAA 1X1XA 1Q9EA 1BNIA 3URPA 3SYUA 2F5MA 1RDSA 5BU4A 1RGGA 1CH0A 9RNTA 1BRIA 3BIRA 3WR2A 3GSPA 1B20A 1B3SA 1HYFA 3D5GA 5HOHA 1C54A 1BANA 1RHLA 1I2FA 1UCLA 1FZUA 1ZGXA 1UCKA 3Q3FA 1BSBA 1LRAA 3KCHA 1B2SA 4GHOA 4HAAA 1MGWA 6RNTA 1BNSA 1BSAA 1I3FA 1YGWA 1RMSA 1BIRA 1BRNL 1X1UA 4J5GA 1RGLA 1AY7A 1FYSA 1RNTA 1BUJA 1BOXA 1BU4A 1A2PA 2KAAA 1T2IA 1I8VA 1AQZA 5BIRA 1GSPA 1RCLA 1FW7A 1RSNA 1UCIA 3A5EA 7GSPA 7RNTA 1B2UA 1SARA 5RNTA 5GSPA 1BRJA 2KF5A 1B21A 1YVSA 3AGOA 2BIRA 1R4YA 1BNGA 1MGRA 1BSEA 1RN1A 1RN4A 1B27A 1LOYA 1I3IA 1LOWA 1BRKA 2AAEA 4RNTA 1T2HA 4J5KA 4BU4A 3DH2A 1I2GA 1BAOA 2F5WA 1BGSA 1GMQA 1I70A 1RGEA 2GSPA 3AHSA 1RGKA 1JBTA 3DGYA 1FUSA 1BNJA 1FUTA 1BRSA 1RLSA 2KF6A 1JBSA 8RNTA 2AADA 2RBIA 1DE3A 1GOVA 1RGCA 2KF3A 6GSPA 1RNBA 1I0VA 1DETA 2HOHA 1BVIA 1PY3A 1JBRA 1I2EA 1RTUA 1B2MA 1BNEA 2BU4A 1YNVX 1RGFA 1BNRA 1B2ZA 2RNTA 3D5IA 1X1WA 1TTOA 1BSDA 1GOUA 1RCKA 4GSPA 3AHWA 2C4BA 3AGNA 1IYYA 1X1YA 2SARA 1BRGA 3D4AA 2F4YA 4BIRA 4HOHA 3BU4A 1GMPA 3RNTA 1HZ1A
chains in the Genus database with same CATH superfamily
1GY5A 2ZA4A 3FSDA 3NBRA 3UL6A 1YGEA 2W56B 3GZYB 3KSED 3QK9A 1CQSA 1LOVA 2E2TA 1EQKA 3LT8A 1K9M4 1EUIC 4KFEA 3J7Yd 3GAXA 1LNIA 1BRHA 1JZOA 3CCQ3 3FF2A 3PCRA 1IK3A 1JKGB 1GMRA 3LMLA 1UDII 2IUJA 4QWTA 3SX1A 1M1XB 1RGAA 3LZAA 3OXAA 4O3VA 5AEUB 3HZPA 3URPA 1K734 1BUQA 2WGQA 2ZDJA 1DVDA 3SOAA 3K63A 3SYUA 5BU4A 1RDSA 1RGGA 1V57A 3VGNA 1SIHA 3X42A 1K8A4 3HIIA 3Q2PA 1LQMB 3CNMA 1JN5B 1W6GA 4K61A 2P0XA 4IPBA 3B4OA 3K0ZA 3Q3FA 1BSBA 3X40A 3DGLA 4K1VA 1L5GB 2CX0A 1N9EA 2D1WA 1Q824 4OK0A 3H51A 4GHOA 4HAAA 6RNTA 1Q40B 1CYUA 3JUPA 1O7WB 3D3LA 2W9QA 2OOVA 1N9JA 3MPHA 2H0GA 5D81A 1W5ZA 1NDOB 1O7HB 1BRNL 1X1UA 2XGNA 1N5PA 1RGLA 2CFDA 1O7PB 1AY7A 3DZLA 1ROVA 3S5CA 3V98A 4ZM8A 3OWUA 5IG3A 3STDA 3GZRA 4Q53A 2W0QA 2KXGA 3CPOA 4L8PA 5STDA 1Z1SA 1US1A 4KVHA 3UJMA 1WNHA 1RCLA 4IT7A 3CCL3 2XRXB 3S27A 5HGRA 2L4VA 3G16A 3PS8A 3AMOB 5CK6A 3LTBA 3EE1A 1YJN3 3A5EA 1B2UA 3PCSA 1N8QA 3EN8A 3X41A 2BIRA 1EG9B 4FMBA 1IQXA 1BNGA 1RN4A 1MGRA 1BSEA 1OPYA 1QALA 1RN1A 3T8UA 1LOYA 3CCE3 3F8HA 3CCM3 4ILFA 2AAEA 5EQLA 7STDA 1D6YA 4STDA 3CCV3 1AVLA 4HM3B 4H3UA 1I2GA 4MJDA 1BGSA 4JF8A 4HM7B 2R4IA 1S5AA 4KFFA 4N6NB 4TX4A 3S28A 3DGYA 1IU7A 3LXUX 5IEPA 3WOEB 1W02A 1JBSA 2P09A 2CG1A 5D83A 1NB3I 1DE3A 5KP1A 1ULIB 1M904 4WYKA 1EA2A 3IJEB 2FXTA 1UI8A 1RNBA 1PFPA 1GY7A 2R41A 1IVXA 3DM8A 3VSYA 1WMPA 2UGIA 2GEYA 2M7OA 1I0VA 1TUHA 2B1XB 2CG0A 2K54A 2W9PA 2Y73A 3E99A 4HKVB 4N6TA 1JBRA 1O7NB 1ZS7A 4FCMA 1IDPA 1RTUA 1BNEA 2D42A 1YNVX 5M19A 2XSOB 2CFWA 4K1UA 3CCS3 1B2ZA 3DUKA 3I553 1Q7Y4 1WMOA 1OHPA 3MHEA 2ML6A 3ALAA 4GSPA 1WQLB 2C4BA 4HVNA 2WGOA 1IYYA 4MMXB 3U1WA 2SARA 3IPTA 1IVVA 3N9HA 4BIRA 4PEJA 5CF2A 1BSAA 3RNTA 1HZ1A 2XF3A 4MMZB 4MEIA 1M9GA 1YJW3 4HJLB 2IY2A 1BSCA 1QMAA 1W00A 3D9RA 1UUWB 1AV4A 1TRQA 1EKMA 1ZX2A 3FG4A 2F56A 4FMDA 4N6UA 1VQP3 2FNQA 1VQ53 3B8LA 5LC6A 5CXOA 1PYLA 4AKZA 3HX8A 5I97A 1STFI 5DRVA 2HMJB 3WHOA 1TRPA 5KP3A 1VQ43 2P0MA 3ER7A 3CPW2 1X1XA 1E97A 1Q9EA 3B7CA 4N6MA 3NV0B 5EVHA 3MSOA 5G2GA 2F5MA 8CHOA 1WMNA 3G6E3 1LNHA 4CPKA 2Z77A 3WR2A 5EEOA 5AYRB 4NPBA 1NWWA 2RSXA 5IEOA 4X2HA 1BANA 3X3ZA 3GWRA 2GBWB 1R4CA 2Q07A 1TFOA 1UCLA 1U8CB 5JBSA 3EB8A 2JQ5A 3EQQB 4LZIA 3IMAB 4BTXA 3KCHA 3HIGA 1B2SA 2BMRB 1DMNA 1BNSA 1I3FA 1JN5A 5TGNA 3NXJA 1YGWA 3G0KA 3PYJA 4WHAA 3NX0A 3EN1B 1VQO3 1RMSA 1SIIA 2CFLA 4XM4A 4J5GA 1RNTA 2WO0A 1BOXA 1BU4A 2RFRA 5AI1A 4HZ9B 3N54B 1T5YA 4R1KA 3EC9A 5IG0A 5IW9A 2C10A 2I9WA 1OF5B 1LOXA 4MMYB 1QVG2 2GBXB 4HM2B 1JB2A 3VF1A 4EV2A 2O3OA 1WTHA 3NQZA 7RNTA 2XGLA 5RNTA 1Q42A 1BRJA 3DGMA 1K28A 3PZWA 2OWPA 2PNCA 2V1LA 1GMPA 2W56A 1B27A 1TIJA 3N8BA 1MNLA 1I3IA 2F98A 4RNTA 1T2HA 5ELJA 1A67A 4J5KA 3NHXA 2J8XB 1JRQA 5A0OB 1OF5A 2CWVA 4EV5A 5AYSC 1VQ93 2CHCA 1VQN3 1W2ZA 4XBXA 2GSPA 1TU5A 1JBTA 3BNEA 1MWTA 2W2CA 4WP5A 1FGQA 1BRSA 2ML5A 3PXMA 3EF8A 4IIAA 1CEWI 4KFDA 1GYBA 1JV2B 2K0MA 1ROAA 3MG1A 1JZDA 3SOYA 3BLZA 4HM8B 2AADA 2RBIA 3CC73 4HM5B 1GOVA 1OUNA 1KC84 4CCVA 2JDIH 1IVWA 4CDLA 5AIHA 1V58A 3ECFA 3GRDA 1DETA 3ZFZA 2HOHA 3EX9A 1FA3A 1D6UA 1FGTA 2YFJB 4WYKB 4K90B 3JUNA 1B2MA 4LMIA 1STDA 2RNTA 3D5IA 3NUVA 4FCZA 1YJ93 1TTOA 1BSDA 1GOUA 2CK3H 3JVCA 1RCKA 3L0RA 3FLJA 2XFTA 3HK4A 2E2VA 2KCDA 1LQGC 3M8CA 1X1YA 3KIIA 5G1LA 5AEWB 3F9SA 2HMLB 1RN7A 1K41A 1E3RA 4BL3A 2BMOB 1YIJ3 3A76A 1W4NA 3CCR3 1UCJA 3HOHA 3KFQC 3KN4A 4CJNA 1YIT3 1QAFA 2UX0A 1RGHA 3CU3A 1IQYA 1I0XA 3WA3A 5CLKA 3U97A 3MG2A 2BO9B 3LT9A 2CC3A 1FUWA 2KF4A 1GS3A 1N5HA 1SPUA 4BTYA 3CME3 1TJDA 3DXOA 2YX9A 1Q864 1BNIA 1FGMA 2HMOB 3F7XA 2LYXA 5IG4A 3CMA3 3FGYA 4R80A 3OW22 4RNZA 3FG1A 5AIGA 2CWTA 1CH0A 1W6CA 1BRIA 3O8YA 4R4KA 1NNVA 3FH1A 3GSPA 1B20A 1IV7A 1HYFA 3D5GA 3PGBA 5HOHA 1C54A 1GY6A 1E3VA 4EC6A 2GXFA 1I2FA 1HU9A 5FW5A 1DVCA 3BNCA 3RDEA 2Z7AA 1FZUA 1GD3A 2GEXA 3CC43 5AIFA 1UCKA 1LRAA 2H0IA 4NHFA 3K5TA 4O8SA 2F99A 4XBYA 2YFLB 1PU4A 4WWUC 4XDWA 4HM6B 2CFKA 3F40A 5AIIA 3S29A 2ZHXB 4EXRA 3G713 2CWUA 4DKIA 1MWSA 3DMCA 1KSIA 1W6YA 1KWIA 1HKXA 2UUGC 3KSPA 3I563 4XBTA 1YI23 3CD63 2HMNB 1BIRA 1YVBI 2QIYA 2CIUA 3UNLA 1FYSA 2W04A 1BUJA 2CKFB 2Y74A 3CCJ3 1A2PA 2KAAA 2Z76A 3SVAA 1I8VA 1G0TA 3OWSA 5BIRA 1OACA 3G8ZA 4EYCA 4RNYA 5G1KA 4XDVA 1FW7A 2OOVC 4KT3B 2MC8A 1RSNA 1UCIA 1FGRA 1ISKA 7GSPA 3OV4A 1SARA 3JUMA 5GSPA 1O7GB 1B21A 1YVSA 3AGOA 1IT8A 3NV0A 3WODG 1R4YA 4ORLA 4J9AA 4FMCA 5LC7A 3SXXA 3X3YA 3EBTA 4LYLB 2IMJA 2HMKB 5IG5A 1JB4A 1BRKA 1JKGA 3NBJA 2E2UA 2O9UX 3FKAA 4BL2A 1NO3A 2XEPA 1I70A 4HM4B 1RGKA 4J8TA 4N6LA 1FUSA 1ASKA 1FUTA 2ZL8A 1AVKA 1RLSA 3F14A 1SJWA 5BVBA 4LGQA 3KZTA 1OCVA 8RNTA 5IERA 3EBYA 4U13A 1MOLA 3S67A 1UGHI 2IUKA 3T8NA 1Q40A 6GSPA 5FGOA 3K7CA 4HBRA 4O02B 4N6OB 9RNTA 1QJGA 4OVMA 3MKIA 4BTWA 1D6ZA 2Z6BA 2LQVA 3UB1A 5KP4A 5D82A 4KZ1A 2A15A 2BU4A 4I4KA 1RGFA 4L8OA 1A2VA 5ELUA 1GD4A 1BNRA 2XSHB 3JUOA 2IYJA 4RZMA 3AHWA 2CW9A 5BXQA 3NQYA 3AGNA 3HI7A 2CX1A 5DREA 3MG3A 3RGRA 3ROBA 2F4YA 1IQ8A 3LTCA 2L1SA 3LYGA 3OX9A 1FGOA 1OGXA 1C7HA 4WFOA 1A90A 5IF6A 3TDGA 2OCTA 3UL5A 4G1MB 1OHSA 1UUVB 2BHMA 3KE7A 1B2XA 1VQ83 2IA7A 2W6JH 1JJ22 1BNFA 3LH4A 1DMQA 1GOYA 1NU3A 1W01A 1G02A 3H3HA 3DY5A 1VQQA 4OUQA 1T3BA 1S723 3BB9A 4FR9A 5IENA 2WOHA 3WA2X 2QA43 2GU3A 3BIRA 4HZBB 1B3SA 3BNBA 4O2HA 2XFSA 1SQWA 4X2OA 1RHLA 1OGZA 2WOFA 2MF7A 1VQM3 1VZZA 3FZWA 1KQS2 2P05A 1LXEA 1OHOA 3NM2A 4N3VA 2BMQB 1ZGXA 2QGUA 4LEHA 1MWUA 1RRLA 1LVNA 2CH9A 1NB5I 1G96A 1O7MB 2B24B 3OWYA 4AKYA 1MGWA 2K3DA 2CFGA 3BNDA 1RKYA 3JUQA 3X3XA 5M1AA 5M18A 4HYZA 2C11A 4JRFA 2W03A 2QEX3 2RGQA 1VQ73 3ZG0A 4XB5A 1TFKA 1J2BA 5CF1A 4EW5A 2HMMB 1UI7A 2FGTA 3KKGA 1AR0A 1T2IA 1ZO2A 3SEDA 1IV9A 2KRTA 2SBLA 3WOFB 1AQZA 1GSPA 3DGNA 3CNXA 1ULJB 1TP6A 1N8R4 4L7KA 3V92A 2BT3A 4EBGA 2P38A 2YFIB 3FG3A 3ZG5A 2OTJ3 4H61A 3LTAA 2KF5A 3CXC2 3I0YA 1UW1A 1Q7HA 4LSOA 4R9KA 2BNGA 1DYUA 1IT7A 3GZXB 4GB5A 4N6V0 3WMDA 2H0HA 3CCU3 2OTL3 1LOWA 3AMOA 1QVF2 3F7SA 2OQEA 4BU4A 1W2B2 1W7CA 3DH2A 3GZBA 2F5WA 1BAOA 3EJVA 3DGOA 1M1K4 1GMQA 1RGEA 1UUGB 3RGAA 3AHSA 1Q814 1JB5A 3B4PA 3Q90A 1BNJA 4HM0B 6STDA 1CYVA 3LTDA 4R9LA 4I5QA 1IVUA 2INXA 2KF6A 3D79A 2RCDA 3NBBA 1OH0A 3MYTA 5JPUA 1RGCA 2F86B 3SLUA 2KF3A 4GL6A 1KD14 3FCSB 2XH9A 1YHQ3 1U5OA 3G4S3 5JPPA 3F8XA 1UGIA 3T0UA 1DMMA 1EEJA 4FMAA 2GU1A 3MWZA 1BVIA 1PY3A 1NJI4 1I2EA 3QRDA 1VQL3 1F8NA 1RJOA 4HM1B 1RRHA 3V99A 1MWRA 1V74A 1JNQA 2OQEC 3K9MC 1X1WA 4FCJA 3NM7A 2PZVA 4AEQA 3Q1CA 1Y4KA 3EHCA 3FF0A 1VQ63 4RBNA 1VQK3 3LOYA 3CC23 3WDGB 2XR8B 1BRGA 3D4AA 4NREA 2STDA 4HOHA 3BU4A 1A2KA 1QAKA
chains in the Genus database with same CATH topology
2ZA4A 1UCJA 3HOHA 1BSCA 1TRQA 2F56A 1LOVA 1RGHA 1B2XA 1I0XA 1PYLA 1LNIA 1BRHA 1BNFA 3WHOA 2KF4A 1TRPA 1GOYA 1GMRA 1G02A 1RGAA 1X1XA 1Q9EA 1BNIA 3URPA 3SYUA 2F5MA 1RDSA 5BU4A 1RGGA 1CH0A 9RNTA 1BRIA 3BIRA 3WR2A 3GSPA 1B20A 1B3SA 1HYFA 3D5GA 5HOHA 1C54A 1BANA 1RHLA 1I2FA 1UCLA 1FZUA 1ZGXA 1UCKA 3Q3FA 1BSBA 1LRAA 3KCHA 1B2SA 4GHOA 4HAAA 1MGWA 6RNTA 1BNSA 1BSAA 1I3FA 1YGWA 1RMSA 1BIRA 1BRNL 1X1UA 4J5GA 1RGLA 1AY7A 1FYSA 1RNTA 1BUJA 1BOXA 1BU4A 1A2PA 2KAAA 1T2IA 1I8VA 1AQZA 5BIRA 1GSPA 1RCLA 1FW7A 1RSNA 1UCIA 3A5EA 7GSPA 7RNTA 1B2UA 1SARA 5RNTA 5GSPA 1BRJA 2KF5A 1B21A 1YVSA 3AGOA 2BIRA 1R4YA 1BNGA 1MGRA 1BSEA 1RN1A 1RN4A 1B27A 1LOYA 1I3IA 1LOWA 1BRKA 2AAEA 4RNTA 1T2HA 4J5KA 4BU4A 3DH2A 1I2GA 1BAOA 2F5WA 1BGSA 1GMQA 1I70A 1RGEA 2GSPA 3AHSA 1RGKA 1JBTA 3DGYA 1FUSA 1BNJA 1FUTA 1BRSA 1RLSA 2KF6A 1JBSA 8RNTA 2AADA 2RBIA 1DE3A 1GOVA 1RGCA 2KF3A 6GSPA 1RNBA 1I0VA 1DETA 2HOHA 1BVIA 1PY3A 1JBRA 1I2EA 1RTUA 1B2MA 1BNEA 2BU4A 1YNVX 1RGFA 1BNRA 1B2ZA 2RNTA 3D5IA 1X1WA 1TTOA 1BSDA 1GOUA 1RCKA 4GSPA 3AHWA 2C4BA 3AGNA 1IYYA 1X1YA 2SARA 1BRGA 3D4AA 2F4YA 4BIRA 4HOHA 3BU4A 1GMPA 3RNTA 1HZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZA4 A;  1UCJ A;  3HOH A;  1BSC A;  1TRQ A;  2F56 A;  1LOV A;  1RGH A;  1B2X A;  1I0X A;  1PYL A;  1LNI A;  1BRH A;  1BNF A;  3WHO A;  2KF4 A;  1TRP A;  1GOY A;  1GMR A;  1G02 A;  1RGA A;  1X1X A;  1Q9E A;  1BNI A;  3URP A;  3SYU A;  2F5M A;  1RDS A;  5BU4 A;  1RGG A;  1CH0 A;  9RNT A;  1BRI A;  3BIR A;  3WR2 A;  3GSP A;  1B20 A;  1B3S A;  1HYF A;  3D5G A;  5HOH A;  1C54 A;  1BAN A;  1RHL A;  1I2F A;  1UCL A;  1FZU A;  1ZGX A;  1UCK A;  3Q3F A;  1BSB A;  1LRA A;  3KCH A;  1B2S A;  4GHO A;  4HAA A;  1MGW A;  6RNT A;  1BNS A;  1BSA A;  1I3F A;  1YGW A;  1RMS A;  1BIR A;  1BRN L;  1X1U A;  4J5G A;  1RGL A;  1AY7 A;  1FYS A;  1RNT A;  1BUJ A;  1BOX A;  1BU4 A;  1A2P A;  2KAA A;  1T2I A;  1I8V A;  1AQZ A;  5BIR A;  1GSP A;  1RCL A;  1FW7 A;  1RSN A;  1UCI A;  3A5E A;  7GSP A;  7RNT A;  1B2U A;  1SAR A;  5RNT A;  5GSP A;  1BRJ A;  2KF5 A;  1B21 A;  1YVS A;  3AGO A;  2BIR A;  1R4Y A;  1BNG A;  1MGR A;  1BSE A;  1RN1 A;  1RN4 A;  1B27 A;  1LOY A;  1I3I A;  1LOW A;  1BRK A;  2AAE A;  4RNT A;  1T2H A;  4J5K A;  4BU4 A;  3DH2 A;  1I2G A;  1BAO A;  2F5W A;  1BGS A;  1GMQ A;  1I70 A;  1RGE A;  2GSP A;  3AHS A;  1RGK A;  1JBT A;  3DGY A;  1FUS A;  1BNJ A;  1FUT A;  1BRS A;  1RLS A;  2KF6 A;  1JBS A;  8RNT A;  2AAD A;  2RBI A;  1DE3 A;  1GOV A;  1RGC A;  2KF3 A;  6GSP A;  1RNB A;  1I0V A;  1DET A;  2HOH A;  1BVI A;  1PY3 A;  1JBR A;  1I2E A;  1RTU A;  1B2M A;  1BNE A;  2BU4 A;  1YNV X;  1RGF A;  1BNR A;  1B2Z A;  2RNT A;  3D5I A;  1X1W A;  1TTO A;  1BSD A;  1GOU A;  1RCK A;  4GSP A;  3AHW A;  2C4B A;  3AGN A;  1IYY A;  1X1Y A;  2SAR A;  1BRG A;  3D4A A;  2F4Y A;  4BIR A;  4HOH A;  3BU4 A;  1GMP A;  3RNT A;  1HZ1 A; 
#chains in the Genus database with same CATH topology
 1GY5 A;  2ZA4 A;  3FSD A;  3NBR A;  3UL6 A;  1YGE A;  2W56 B;  3GZY B;  3KSE D;  3QK9 A;  1CQS A;  1LOV A;  2E2T A;  1EQK A;  3LT8 A;  1K9M 4;  1EUI C;  4KFE A;  3J7Y d;  3GAX A;  1LNI A;  1BRH A;  1JZO A;  3CCQ 3;  3FF2 A;  3PCR A;  1IK3 A;  1JKG B;  1GMR A;  3LML A;  1UDI I;  2IUJ A;  4QWT A;  3SX1 A;  1M1X B;  1RGA A;  3LZA A;  3OXA A;  4O3V A;  5AEU B;  3HZP A;  3URP A;  1K73 4;  1BUQ A;  2WGQ A;  2ZDJ A;  1DVD A;  3SOA A;  3K63 A;  3SYU A;  5BU4 A;  1RDS A;  1RGG A;  1V57 A;  3VGN A;  1SIH A;  3X42 A;  1K8A 4;  3HII A;  3Q2P A;  1LQM B;  3CNM A;  1JN5 B;  1W6G A;  4K61 A;  2P0X A;  4IPB A;  3B4O A;  3K0Z A;  3Q3F A;  1BSB A;  3X40 A;  3DGL A;  4K1V A;  1L5G B;  2CX0 A;  1N9E A;  2D1W A;  1Q82 4;  4OK0 A;  3H51 A;  4GHO A;  4HAA A;  6RNT A;  1Q40 B;  1CYU A;  3JUP A;  1O7W B;  3D3L A;  2W9Q A;  2OOV A;  1N9J A;  3MPH A;  2H0G A;  5D81 A;  1W5Z A;  1NDO B;  1O7H B;  1BRN L;  1X1U A;  2XGN A;  1N5P A;  1RGL A;  2CFD A;  1O7P B;  1AY7 A;  3DZL A;  1ROV A;  3S5C A;  3V98 A;  4ZM8 A;  3OWU A;  5IG3 A;  3STD A;  3GZR A;  4Q53 A;  2W0Q A;  2KXG A;  3CPO A;  4L8P A;  5STD A;  1Z1S A;  1US1 A;  4KVH A;  3UJM A;  1WNH A;  1RCL A;  4IT7 A;  3CCL 3;  2XRX B;  3S27 A;  5HGR A;  2L4V A;  3G16 A;  3PS8 A;  3AMO B;  5CK6 A;  3LTB A;  3EE1 A;  1YJN 3;  3A5E A;  1B2U A;  3PCS A;  1N8Q A;  3EN8 A;  3X41 A;  2BIR A;  1EG9 B;  4FMB A;  1IQX A;  1BNG A;  1RN4 A;  1MGR A;  1BSE A;  1OPY A;  1QAL A;  1RN1 A;  3T8U A;  1LOY A;  3CCE 3;  3F8H A;  3CCM 3;  4ILF A;  2AAE A;  5EQL A;  7STD A;  1D6Y A;  4STD A;  3CCV 3;  1AVL A;  4HM3 B;  4H3U A;  1I2G A;  4MJD A;  1BGS A;  4JF8 A;  4HM7 B;  2R4I A;  1S5A A;  4KFF A;  4N6N B;  4TX4 A;  3S28 A;  3DGY A;  1IU7 A;  3LXU X;  5IEP A;  3WOE B;  1W02 A;  1JBS A;  2P09 A;  2CG1 A;  5D83 A;  1NB3 I;  1DE3 A;  5KP1 A;  1ULI B;  1M90 4;  4WYK A;  1EA2 A;  3IJE B;  2FXT A;  1UI8 A;  1RNB A;  1PFP A;  1GY7 A;  2R41 A;  1IVX A;  3DM8 A;  3VSY A;  1WMP A;  2UGI A;  2GEY A;  2M7O A;  1I0V A;  1TUH A;  2B1X B;  2CG0 A;  2K54 A;  2W9P A;  2Y73 A;  3E99 A;  4HKV B;  4N6T A;  1JBR A;  1O7N B;  1ZS7 A;  4FCM A;  1IDP A;  1RTU A;  1BNE A;  2D42 A;  1YNV X;  5M19 A;  2XSO B;  2CFW A;  4K1U A;  3CCS 3;  1B2Z A;  3DUK A;  3I55 3;  1Q7Y 4;  1WMO A;  1OHP A;  3MHE A;  2ML6 A;  3ALA A;  4GSP A;  1WQL B;  2C4B A;  4HVN A;  2WGO A;  1IYY A;  4MMX B;  3U1W A;  2SAR A;  3IPT A;  1IVV A;  3N9H A;  4BIR A;  4PEJ A;  5CF2 A;  1BSA A;  3RNT A;  1HZ1 A;  2XF3 A;  4MMZ B;  4MEI A;  1M9G A;  1YJW 3;  4HJL B;  2IY2 A;  1BSC A;  1QMA A;  1W00 A;  3D9R A;  1UUW B;  1AV4 A;  1TRQ A;  1EKM A;  1ZX2 A;  3FG4 A;  2F56 A;  4FMD A;  4N6U A;  1VQP 3;  2FNQ A;  1VQ5 3;  3B8L A;  5LC6 A;  5CXO A;  1PYL A;  4AKZ A;  3HX8 A;  5I97 A;  1STF I;  5DRV A;  2HMJ B;  3WHO A;  1TRP A;  5KP3 A;  1VQ4 3;  2P0M A;  3ER7 A;  3CPW 2;  1X1X A;  1E97 A;  1Q9E A;  3B7C A;  4N6M A;  3NV0 B;  5EVH A;  3MSO A;  5G2G A;  2F5M A;  8CHO A;  1WMN A;  3G6E 3;  1LNH A;  4CPK A;  2Z77 A;  3WR2 A;  5EEO A;  5AYR B;  4NPB A;  1NWW A;  2RSX A;  5IEO A;  4X2H A;  1BAN A;  3X3Z A;  3GWR A;  2GBW B;  1R4C A;  2Q07 A;  1TFO A;  1UCL A;  1U8C B;  5JBS A;  3EB8 A;  2JQ5 A;  3EQQ B;  4LZI A;  3IMA B;  4BTX A;  3KCH A;  3HIG A;  1B2S A;  2BMR B;  1DMN A;  1BNS A;  1I3F A;  1JN5 A;  5TGN A;  3NXJ A;  1YGW A;  3G0K A;  3PYJ A;  4WHA A;  3NX0 A;  3EN1 B;  1VQO 3;  1RMS A;  1SII A;  2CFL A;  4XM4 A;  4J5G A;  1RNT A;  2WO0 A;  1BOX A;  1BU4 A;  2RFR A;  5AI1 A;  4HZ9 B;  3N54 B;  1T5Y A;  4R1K A;  3EC9 A;  5IG0 A;  5IW9 A;  2C10 A;  2I9W A;  1OF5 B;  1LOX A;  4MMY B;  1QVG 2;  2GBX B;  4HM2 B;  1JB2 A;  3VF1 A;  4EV2 A;  2O3O A;  1WTH A;  3NQZ A;  7RNT A;  2XGL A;  5RNT A;  1Q42 A;  1BRJ A;  3DGM A;  1K28 A;  3PZW A;  2OWP A;  2PNC A;  2V1L A;  1GMP A;  2W56 A;  1B27 A;  1TIJ A;  3N8B A;  1MNL A;  1I3I A;  2F98 A;  4RNT A;  1T2H A;  5ELJ A;  1A67 A;  4J5K A;  3NHX A;  2J8X B;  1JRQ A;  5A0O B;  1OF5 A;  2CWV A;  4EV5 A;  5AYS C;  1VQ9 3;  2CHC A;  1VQN 3;  1W2Z A;  4XBX A;  2GSP A;  1TU5 A;  1JBT A;  3BNE A;  1MWT A;  2W2C A;  4WP5 A;  1FGQ A;  1BRS A;  2ML5 A;  3PXM A;  3EF8 A;  4IIA A;  1CEW I;  4KFD A;  1GYB A;  1JV2 B;  2K0M A;  1ROA A;  3MG1 A;  1JZD A;  3SOY A;  3BLZ A;  4HM8 B;  2AAD A;  2RBI A;  3CC7 3;  4HM5 B;  1GOV A;  1OUN A;  1KC8 4;  4CCV A;  2JDI H;  1IVW A;  4CDL A;  5AIH A;  1V58 A;  3ECF A;  3GRD A;  1DET A;  3ZFZ A;  2HOH A;  3EX9 A;  1FA3 A;  1D6U A;  1FGT A;  2YFJ B;  4WYK B;  4K90 B;  3JUN A;  1B2M A;  4LMI A;  1STD A;  2RNT A;  3D5I A;  3NUV A;  4FCZ A;  1YJ9 3;  1TTO A;  1BSD A;  1GOU A;  2CK3 H;  3JVC A;  1RCK A;  3L0R A;  3FLJ A;  2XFT A;  3HK4 A;  2E2V A;  2KCD A;  1LQG C;  3M8C A;  1X1Y A;  3KII A;  5G1L A;  5AEW B;  3F9S A;  2HML B;  1RN7 A;  1K41 A;  1E3R A;  4BL3 A;  2BMO B;  1YIJ 3;  3A76 A;  1W4N A;  3CCR 3;  1UCJ A;  3HOH A;  3KFQ C;  3KN4 A;  4CJN A;  1YIT 3;  1QAF A;  2UX0 A;  1RGH A;  3CU3 A;  1IQY A;  1I0X A;  3WA3 A;  5CLK A;  3U97 A;  3MG2 A;  2BO9 B;  3LT9 A;  2CC3 A;  1FUW A;  2KF4 A;  1GS3 A;  1N5H A;  1SPU A;  4BTY A;  3CME 3;  1TJD A;  3DXO A;  2YX9 A;  1Q86 4;  1BNI A;  1FGM A;  2HMO B;  3F7X A;  2LYX A;  5IG4 A;  3CMA 3;  3FGY A;  4R80 A;  3OW2 2;  4RNZ A;  3FG1 A;  5AIG A;  2CWT A;  1CH0 A;  1W6C A;  1BRI A;  3O8Y A;  4R4K A;  1NNV A;  3FH1 A;  3GSP A;  1B20 A;  1IV7 A;  1HYF A;  3D5G A;  3PGB A;  5HOH A;  1C54 A;  1GY6 A;  1E3V A;  4EC6 A;  2GXF A;  1I2F A;  1HU9 A;  5FW5 A;  1DVC A;  3BNC A;  3RDE A;  2Z7A A;  1FZU A;  1GD3 A;  2GEX A;  3CC4 3;  5AIF A;  1UCK A;  1LRA A;  2H0I A;  4NHF A;  3K5T A;  4O8S A;  2F99 A;  4XBY A;  2YFL B;  1PU4 A;  4WWU C;  4XDW A;  4HM6 B;  2CFK A;  3F40 A;  5AII A;  3S29 A;  2ZHX B;  4EXR A;  3G71 3;  2CWU A;  4DKI A;  1MWS A;  3DMC A;  1KSI A;  1W6Y A;  1KWI A;  1HKX A;  2UUG C;  3KSP A;  3I56 3;  4XBT A;  1YI2 3;  3CD6 3;  2HMN B;  1BIR A;  1YVB I;  2QIY A;  2CIU A;  3UNL A;  1FYS A;  2W04 A;  1BUJ A;  2CKF B;  2Y74 A;  3CCJ 3;  1A2P A;  2KAA A;  2Z76 A;  3SVA A;  1I8V A;  1G0T A;  3OWS A;  5BIR A;  1OAC A;  3G8Z A;  4EYC A;  4RNY A;  5G1K A;  4XDV A;  1FW7 A;  2OOV C;  4KT3 B;  2MC8 A;  1RSN A;  1UCI A;  1FGR A;  1ISK A;  7GSP A;  3OV4 A;  1SAR A;  3JUM A;  5GSP A;  1O7G B;  1B21 A;  1YVS A;  3AGO A;  1IT8 A;  3NV0 A;  3WOD G;  1R4Y A;  4ORL A;  4J9A A;  4FMC A;  5LC7 A;  3SXX A;  3X3Y A;  3EBT A;  4LYL B;  2IMJ A;  2HMK B;  5IG5 A;  1JB4 A;  1BRK A;  1JKG A;  3NBJ A;  2E2U A;  2O9U X;  3FKA A;  4BL2 A;  1NO3 A;  2XEP A;  1I70 A;  4HM4 B;  1RGK A;  4J8T A;  4N6L A;  1FUS A;  1ASK A;  1FUT A;  2ZL8 A;  1AVK A;  1RLS A;  3F14 A;  1SJW A;  5BVB A;  4LGQ A;  3KZT A;  1OCV A;  8RNT A;  5IER A;  3EBY A;  4U13 A;  1MOL A;  3S67 A;  1UGH I;  2IUK A;  3T8N A;  1Q40 A;  6GSP A;  5FGO A;  3K7C A;  4HBR A;  4O02 B;  4N6O B;  9RNT A;  1QJG A;  4OVM A;  3MKI A;  4BTW A;  1D6Z A;  2Z6B A;  2LQV A;  3UB1 A;  5KP4 A;  5D82 A;  4KZ1 A;  2A15 A;  2BU4 A;  4I4K A;  1RGF A;  4L8O A;  1A2V A;  5ELU A;  1GD4 A;  1BNR A;  2XSH B;  3JUO A;  2IYJ A;  4RZM A;  3AHW A;  2CW9 A;  5BXQ A;  3NQY A;  3AGN A;  3HI7 A;  2CX1 A;  5DRE A;  3MG3 A;  3RGR A;  3ROB A;  2F4Y A;  1IQ8 A;  3LTC A;  2L1S A;  3LYG A;  3OX9 A;  1FGO A;  1OGX A;  1C7H A;  4WFO A;  1A90 A;  5IF6 A;  3TDG A;  2OCT A;  3UL5 A;  4G1M B;  1OHS A;  1UUV B;  2BHM A;  3KE7 A;  1B2X A;  1VQ8 3;  2IA7 A;  2W6J H;  1JJ2 2;  1BNF A;  3LH4 A;  1DMQ A;  1GOY A;  1NU3 A;  1W01 A;  1G02 A;  3H3H A;  3DY5 A;  1VQQ A;  4OUQ A;  1T3B A;  1S72 3;  3BB9 A;  4FR9 A;  5IEN A;  2WOH A;  3WA2 X;  2QA4 3;  2GU3 A;  3BIR A;  4HZB B;  1B3S A;  3BNB A;  4O2H A;  2XFS A;  1SQW A;  4X2O A;  1RHL A;  1OGZ A;  2WOF A;  2MF7 A;  1VQM 3;  1VZZ A;  3FZW A;  1KQS 2;  2P05 A;  1LXE A;  1OHO A;  3NM2 A;  4N3V A;  2BMQ B;  1ZGX A;  2QGU A;  4LEH A;  1MWU A;  1RRL A;  1LVN A;  2CH9 A;  1NB5 I;  1G96 A;  1O7M B;  2B24 B;  3OWY A;  4AKY A;  1MGW A;  2K3D A;  2CFG A;  3BND A;  1RKY A;  3JUQ A;  3X3X A;  5M1A A;  5M18 A;  4HYZ A;  2C11 A;  4JRF A;  2W03 A;  2QEX 3;  2RGQ A;  1VQ7 3;  3ZG0 A;  4XB5 A;  1TFK A;  1J2B A;  5CF1 A;  4EW5 A;  2HMM B;  1UI7 A;  2FGT A;  3KKG A;  1AR0 A;  1T2I A;  1ZO2 A;  3SED A;  1IV9 A;  2KRT A;  2SBL A;  3WOF B;  1AQZ A;  1GSP A;  3DGN A;  3CNX A;  1ULJ B;  1TP6 A;  1N8R 4;  4L7K A;  3V92 A;  2BT3 A;  4EBG A;  2P38 A;  2YFI B;  3FG3 A;  3ZG5 A;  2OTJ 3;  4H61 A;  3LTA A;  2KF5 A;  3CXC 2;  3I0Y A;  1UW1 A;  1Q7H A;  4LSO A;  4R9K A;  2BNG A;  1DYU A;  1IT7 A;  3GZX B;  4GB5 A;  4N6V 0;  3WMD A;  2H0H A;  3CCU 3;  2OTL 3;  1LOW A;  3AMO A;  1QVF 2;  3F7S A;  2OQE A;  4BU4 A;  1W2B 2;  1W7C A;  3DH2 A;  3GZB A;  2F5W A;  1BAO A;  3EJV A;  3DGO A;  1M1K 4;  1GMQ A;  1RGE A;  1UUG B;  3RGA A;  3AHS A;  1Q81 4;  1JB5 A;  3B4P A;  3Q90 A;  1BNJ A;  4HM0 B;  6STD A;  1CYV A;  3LTD A;  4R9L A;  4I5Q A;  1IVU A;  2INX A;  2KF6 A;  3D79 A;  2RCD A;  3NBB A;  1OH0 A;  3MYT A;  5JPU A;  1RGC A;  2F86 B;  3SLU A;  2KF3 A;  4GL6 A;  1KD1 4;  3FCS B;  2XH9 A;  1YHQ 3;  1U5O A;  3G4S 3;  5JPP A;  3F8X A;  1UGI A;  3T0U A;  1DMM A;  1EEJ A;  4FMA A;  2GU1 A;  3MWZ A;  1BVI A;  1PY3 A;  1NJI 4;  1I2E A;  3QRD A;  1VQL 3;  1F8N A;  1RJO A;  4HM1 B;  1RRH A;  3V99 A;  1MWR A;  1V74 A;  1JNQ A;  2OQE C;  3K9M C;  1X1W A;  4FCJ A;  3NM7 A;  2PZV A;  4AEQ A;  3Q1C A;  1Y4K A;  3EHC A;  3FF0 A;  1VQ6 3;  4RBN A;  1VQK 3;  3LOY A;  3CC2 3;  3WDG B;  2XR8 B;  1BRG A;  3D4A A;  4NRE A;  2STD A;  4HOH A;  3BU4 A;  1A2K A;  1QAK A; 
#chains in the Genus database with same CATH homology
 2ZA4 A;  1UCJ A;  3HOH A;  1BSC A;  1TRQ A;  2F56 A;  1LOV A;  1RGH A;  1B2X A;  1I0X A;  1PYL A;  1LNI A;  1BRH A;  1BNF A;  3WHO A;  2KF4 A;  1TRP A;  1GOY A;  1GMR A;  1G02 A;  1RGA A;  1X1X A;  1Q9E A;  1BNI A;  3URP A;  3SYU A;  2F5M A;  1RDS A;  5BU4 A;  1RGG A;  1CH0 A;  9RNT A;  1BRI A;  3BIR A;  3WR2 A;  3GSP A;  1B20 A;  1B3S A;  1HYF A;  3D5G A;  5HOH A;  1C54 A;  1BAN A;  1RHL A;  1I2F A;  1UCL A;  1FZU A;  1ZGX A;  1UCK A;  3Q3F A;  1BSB A;  1LRA A;  3KCH A;  1B2S A;  4GHO A;  4HAA A;  1MGW A;  6RNT A;  1BNS A;  1BSA A;  1I3F A;  1YGW A;  1RMS A;  1BIR A;  1BRN L;  1X1U A;  4J5G A;  1RGL A;  1AY7 A;  1FYS A;  1RNT A;  1BUJ A;  1BOX A;  1BU4 A;  1A2P A;  2KAA A;  1T2I A;  1I8V A;  1AQZ A;  5BIR A;  1GSP A;  1RCL A;  1FW7 A;  1RSN A;  1UCI A;  3A5E A;  7GSP A;  7RNT A;  1B2U A;  1SAR A;  5RNT A;  5GSP A;  1BRJ A;  2KF5 A;  1B21 A;  1YVS A;  3AGO A;  2BIR A;  1R4Y A;  1BNG A;  1MGR A;  1BSE A;  1RN1 A;  1RN4 A;  1B27 A;  1LOY A;  1I3I A;  1LOW A;  1BRK A;  2AAE A;  4RNT A;  1T2H A;  4J5K A;  4BU4 A;  3DH2 A;  1I2G A;  1BAO A;  2F5W A;  1BGS A;  1GMQ A;  1I70 A;  1RGE A;  2GSP A;  3AHS A;  1RGK A;  1JBT A;  3DGY A;  1FUS A;  1BNJ A;  1FUT A;  1BRS A;  1RLS A;  2KF6 A;  1JBS A;  8RNT A;  2AAD A;  2RBI A;  1DE3 A;  1GOV A;  1RGC A;  2KF3 A;  6GSP A;  1RNB A;  1I0V A;  1DET A;  2HOH A;  1BVI A;  1PY3 A;  1JBR A;  1I2E A;  1RTU A;  1B2M A;  1BNE A;  2BU4 A;  1YNV X;  1RGF A;  1BNR A;  1B2Z A;  2RNT A;  3D5I A;  1X1W A;  1TTO A;  1BSD A;  1GOU A;  1RCK A;  4GSP A;  3AHW A;  2C4B A;  3AGN A;  1IYY A;  1X1Y A;  2SAR A;  1BRG A;  3D4A A;  2F4Y A;  4BIR A;  4HOH A;  3BU4 A;  1GMP A;  3RNT A;  1HZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...