1X1YA

Water-mediate interaction at aprotein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Ribonuclease
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1yA00
2HOHA 1FYSA 1RGHA 3D4AA 2RNTA 2AAEA 2KF5A 1BUJA 1RLSA 2C4BA 1DETA 1B3SA 1B2ZA 3DGYA 1C54A 1AY7A 5BU4A 3KCHA 1RGCA 3DH2A 1BNIA 1R4YA 1UCKA 1LNIA 2AADA 4GSPA 1MGRA 5GSPA 2F56A 3Q3FA 1PYLA 4GHOA 8RNTA 5BIRA 2KF3A 1UCJA 2F5MA 1G02A 1X1UA 1PY3A 1BRJA 1MGWA 1BRIA 1BSCA 1RGAA 3BU4A 3D5GA 7GSPA 1I3FA 1X1WA 1CH0A 1BRHA 1HZ1A 1HYFA 6RNTA 1YGWA 1I0XA 1RGLA 4HAAA 4J5GA 1BRNL 1JBTA 4RNTA 2KF4A 1FW7A 3A5EA 1AQZA 1BNEA 9RNTA 1IYYA 3HOHA 1X1YA 1GSPA 3AGOA 2ZA4A 1LOVA 1RNTA 2RBIA 1T2HA 2BIRA 3D5IA 1FUSA 1FZUA 1I2FA 1SARA 5RNTA 3GSPA 1GMQA 1LOYA 1RHLA 1RGEA 1RN4A 1TTOA 1ZGXA 1GOVA 1I2EA 2F4YA 3SYUA 1BRKA 3RNTA 1BSDA 1BSEA 3AGNA 2F5WA 1BOXA 1Q9EA 1BNFA 1B27A 1B2MA 1YNVX 1LOWA 1I70A 6GSPA 1BRSA 1RCLA 1GOYA 3URPA 1RGFA 1LRAA 4BIRA 7RNTA 1TRPA 4HOHA 1BNJA 4BU4A 1DE3A 1RGKA 1RGGA 1JBRA 1BSBA 1BIRA 1B2XA 1BVIA 1JBSA 1BNRA 1B2SA 1YVSA 1I2GA 1I8VA 1RDSA 1B20A 1TRQA 3WHOA 3AHWA 5HOHA 1I0VA 1RMSA 2KAAA 1RNBA 3WR2A 1BGSA 1GMRA 2BU4A 1T2IA 1RN1A 1RSNA 1BANA 1BSAA 1FUTA 4J5KA 1BNSA 3AHSA 2SARA 1A2PA 1GMPA 1RCKA 2KF6A 1B21A 1BNGA 1UCLA 3BIRA 1BAOA 1BU4A 1BRGA 1X1XA 1UCIA 2GSPA 1GOUA 1RTUA 1B2UA 1I3IA
chains in the Genus database with same CATH superfamily
1IQYA 2CWTA 1QAFA 3EX9A 3LH4A 2BMOB 4HBRA 5CF1A 1KD14 2IYJA 1OHSA 2W2CA 1BUJA 3CC43 2C4BA 1FGMA 1Q7HA 2H0HA 3OV4A 1JN5B 2P09A 4X2HA 3I563 1QVG2 1RGCA 1R4YA 3PYJA 1UCKA 1W6CA 3FCSB 4N6TA 1VQ93 4GSPA 1MGRA 4IT7A 5GSPA 1YJN3 2STDA 3NV0B 4NHFA 5IG0A 2F56A 5IF6A 1N9JA 5BIRA 1SIHA 3CCM3 1NWWA 2Z7AA 2F5MA 4XDWA 2XFSA 4DKIA 1BRJA 3LMLA 3F7SA 1JN5A 1BRIA 4I5QA 1GY6A 4HYZA 3CCU3 1W01A 3BU4A 3D5GA 2IA7A 2K54A 3WMDA 1Z1SA 3HI7A 4LMIA 3NM2A 4MJDA 1YIT3 4JF8A 1M9GA 6RNTA 2CFLA 3NV0A 2F98A 2P0XA 3AMOA 3SOYA 2PNCA 4RNTA 1TJDA 2SBLA 5AIIA 2KCDA 4HM0B 5AEWB 4XM4A 1Q824 1CYUA 1FW7A 2CHCA 3A5EA 4BTXA 9RNTA 2YFJB 1O7NB 1SJWA 3BLZA 4MMYB 1VQL3 1GSPA 1GS3A 2YFIB 1RNTA 2RBIA 1FGRA 2BIRA 2FGTA 3FG3A 4N6LA 3D5IA 1FUSA 4IIAA 3F7XA 4K61A 1J2BA 3F9SA 2H0GA 1JNQA 5IEPA 1RHLA 4HJLB 4R9KA 1YJ93 1YGEA 2W9QA 3UL5A 2WOHA 3SYUA 3UB1A 1RRLA 3B4OA 2ZDJA 3FF0A 3V98A 1UW1A 5A0OB 1C7HA 1PU4A 1GY5A 1Q42A 2IUKA 1JKGB 1VQK3 3GZYB 1VQQA 5ELJA 4X2OA 3WODG 5JBSA 5AYRB 1OHOA 3VF1A 1I70A 3X3XA 1JB2A 1UDII 1RGFA 3B8LA 1ZO2A 3X41A 1LQMB 4G1MB 2WO0A 2GEXA 3OWSA 5D82A 4BU4A 5JPPA 1RGKA 2UGIA 3H3HA 1IT8A 4HM4B 5CXOA 5EQLA 3WOFB 1AR0A 1BVIA 3NM7A 3KIIA 1EA2A 5CK6A 4HM2B 3T0UA 1YVSA 1N8QA 1I2GA 1OUNA 3FGYA 1YI23 4R9LA 5D83A 5G2GA 4ZM8A 1RMSA 1T3BA 1KC84 1VQ63 1WTHA 4N6UA 5IERA 1QVF2 3CC73 3BNDA 2Q07A 1BSAA 1GY7A 2XRXB 1V74A 2XSHB 1ULIB 3A76A 1W00A 4FMCA 1VQM3 5CLKA 3DXOA 5DREA 1JJ22 1VQ83 2C11A 4N6OB 3I553 3D79A 1E3VA 4FCMA 3X42A 3FKAA 3FSDA 4QWTA 3K5TA 1Q40B 1OGZA 4HZ9B 1BU4A 3OX9A 1BRGA 1JB5A 1R4CA 1X1XA 3K7CA 3HZPA 1GOUA 1TUHA 1QMAA 1I3IA 2OWPA 1MWUA 4J9AA 4JRFA 2CIUA 2F86B 3VGNA 2OOVC 1IV7A 2OQEA 4HVNA 1O7WB 1N9EA 3NUVA 1Q40A 1B3SA 2D42A 3K0ZA 3D3LA 3DGYA 3PXMA 3MG1A 4KFFA 3UNLA 3FG4A 3KCHA 5BU4A 1CQSA 3S27A 2GXFA 5G1KA 3NHXA 2W56B 4R1KA 1DMMA 1ULJB 3CC23 3OW22 2KRTA 3HIGA 3PGBA 3ZG5A 1IQXA 2LQVA 3EBYA 1A67A 3G6E3 1G96A 4AEQA 1MGWA 1TU5A 3F8XA 1UUWB 7GSPA 1I3FA 1X1WA 1CH0A 2E2TA 3EF8A 3K63A 1A90A 1HZ1A 1UUGB 3JUQA 1HYFA 5KP4A 3FF2A 3Q1CA 4K1VA 3M8CA 4HAAA 1W5ZA 1G0TA 3F8HA 2RSXA 4FCZA 4FMAA 1UI8A 3RDEA 4HM1B 3X40A 1Q7Y4 3CMA3 1AQZA 1BNEA 1IYYA 4K90B 3SEDA 3SLUA 1MNLA 2CWUA 3S28A 4GL6A 3D9RA 4O3VA 5IG5A 4KFEA 1LQGC 1SQWA 1MWRA 1T2HA 2Z77A 4CPKA 2W03A 1V58A 1I2FA 1TIJA 1SARA 2QGUA 3AMOB 4L8OA 5RNTA 1GMQA 1O7MB 1LOXA 1RGEA 1W2ZA 3RGAA 5BVBA 5M19A 1U5OA 1ISKA 1ZGXA 1EUIC 5BXQA 5EVHA 3KSPA 1T5YA 2F4YA 3DY5A 3RNTA 3HX8A 3N9HA 5AIGA 2ML6A 1Y4KA 1AVKA 1CEWI 1QALA 4ILFA 3J7Yd 1BNFA 1B27A 1JZOA 1YNVX 2A15A 1KSIA 3KKGA 4MEIA 4OVMA 2CK3H 5EEOA 1B2MA 3U97A 1E97A 4I4KA 1Q864 1BRSA 3CNXA 1GOYA 3Q90A 1FA3A 2XSOB 5IG4A 1AV4A 1IVUA 1IV9A 1JB4A 2GBWB 3H51A 1NB3I 3PCRA 4LYLB 4FMBA 4MMXB 1DE3A 1YVBI 3FZWA 2R41A 2XGLA 2ML5A 2BO9B 4KVHA 5FW5A 1B2XA 3OXAA 3KE7A 4IPBA 3GAXA 1B2SA 1M904 1VQ53 1I8VA 1RDSA 4CCVA 1KWIA 3WHOA 4O02B 5HOHA 5G1LA 1I0VA 1OF5A 1NO3A 2B24B 1RNBA 2CFDA 4OK0A 3KSED 5IW9A 1K28A 1NJI4 1PFPA 3BB9A 1BUQA 1BANA 3EBTA 5FGOA 3S5CA 1VQO3 3WA3A 1RN7A 3VSYA 4EC6A 2ZHXB 2SARA 1NDOB 2W9PA 2KF6A 3FG1A 3ROBA 1WMPA 3CXC2 1K9M4 3BNEA 2P05A 3MHEA 1U8CB 2C10A 3RGRA 2QEX3 1K8A4 5AI1A 4LSOA 2CFGA 1GD3A 2HMJB 4EBGA 3KZTA 1TFOA 1RTUA 2YFLB 1OCVA 3NBJA 2OTJ3 2W0QA 4KFDA 1FYSA 1RGHA 4XDVA 4HM6B 1W2B2 2UX0A 2AAEA 1L5GB 2MF7A 1LNHA 1RLSA 4WWUC 1RKYA 1AY7A 3PZWA 1LVNA 1WQLB 4HM8B 3DH2A 1BNIA 1VZZA 3CCR3 1ZX2A 1UGIA 2AADA 3N54B 3EC9A 4LEHA 3NQZA 4EV2A 2BT3A 3BNCA 2YX9A 3GZRA 1D6UA 3CU3A 2OOVA 2KF3A 1UCJA 4EV5A 1G02A 1IDPA 1X1UA 2BMRB 3MG3A 3PS8A 4N6V0 3CCJ3 2L4VA 1RGAA 3NQYA 3I0YA 1YHQ3 1N8R4 1W02A 1DMNA 4NPBA 5M18A 1A2VA 4EYCA 4BL3A 2E2UA 1ROAA 2XF3A 1VQP3 1YGWA 1ASKA 1I0XA 4J5GA 2QA43 1DVCA 2HMNB 5HGRA 1BRNL 3DGOA 4N3VA 2GU3A 3WOEB 4RBNA 1IQ8A 3HOHA 3DM8A 4WYKB 4WP5A 1W4NA 2ZA4A 3JUNA 2XH9A 5IEOA 2I9WA 4BTWA 1QJGA 3ZG0A 3CME3 1YJW3 2HMLB 2JQ5A 1LOYA 3KN4A 2RCDA 2HMOB 3MYTA 5TGNA 1GOVA 2V1LA 3DGMA 4MMZB 1I2EA 1FGTA 4WYKA 1BRKA 4R80A 2CFKA 4O2HA 3LTCA 2XR8B 3AGNA 2F5WA 4FCJA 1Q9EA 2D1WA 3JVCA 3T8NA 3FH1A 3NX0A 1TFKA 3JUOA 6GSPA 1JV2B 3CNMA 1RCLA 3EQQB 1DMQA 1OGXA 3URPA 1LRAA 3CCE3 2MC8A 3QRDA 3EB8A 1IVVA 4HOHA 3QK9A 1K41A 1STDA 2HMKB 2P0MA 2CG0A 2J8XB 1OPYA 1UI7A 5CF2A 2K0MA 1IVXA 1O7GB 1BSBA 1GD4A 4H61A 1JBRA 2B1XB 3S29A 2L1SA 7STDA 4KT3B 3DMCA 1JRQA 2KXGA 1IT7A 3STDA 1F8NA 3ZFZA 3JUPA 3DUKA 4TX4A 5AIHA 4XBXA 4XB5A 1W6GA 3E99A 2F99A 2UUGC 2KAAA 3MPHA 4RNZA 3WA2X 1BGSA 4RNYA 3WR2A 1M1K4 1VQ43 1STFI 3SX1A 1T2IA 1RN1A 1VQN3 1B2UA 2Y73A 3IPTA 1GYBA 1RSNA 3CPOA 2CG1A 4AKYA 3EN8A 3DGLA 3L0RA 1MWSA 4H3UA 3K9MC 1D6YA 1OHPA 3KFQC 5KP1A 3GZBA 2GEYA 3AHSA 1UGHI 5D81A 1EEJA 1MOLA 3MSOA 3OWUA 5STDA 3IJEB 1OF5B 4U13A 3ER7A 1DVDA 2BHMA 3U1WA 1UCLA 3JUMA 3MKIA 3DZLA 1BAOA 1W7CA 3Q2PA 3CCL3 1HKXA 1UCIA 2GSPA 3HIIA 2CH9A 2INXA 2Z76A 4PEJA 4FR9A 4GB5A 1RRHA 4STDA 1K734 3G8ZA 3WDGB 4FMDA 1QAKA 2HOHA 2BNGA 3D4AA 2RNTA 3LT9A 2LYXA 5I97A 2KF5A 2H0IA 3GZXB 5LC7A 1N5HA 2GU1A 4OUQA 1DETA 3SXXA 1B2ZA 1M1XB 3HK4A 3DGNA 4CDLA 1C54A 2Y74A 1IU7A 2FXTA 1RJOA 3V92A 1LNIA 4KZ1A 4N6MA 2O9UX 2W6JH 1NB5I 2CFWA 3Q3FA 4GHOA 1PYLA 4R4KA 3S67A 8RNTA 4NREA 3BNBA 5IG3A 5LC6A 1PY3A 1S723 2FNQA 5AYSC 1BSCA 1EG9B 5IENA 1FUWA 2OTL3 1DYUA 2XGNA 3UJMA 4CJNA 1BRHA 1WMNA 1NU3A 1A2KA 1HU9A 1S5AA 3CCV3 4HKVB 2WGQA 1RGLA 1Q814 4RZMA 1JBTA 2CX0A 2KF4A 2CC3A 2HMMB 3LTAA 3V99A 1X1YA 3F40A 2ZL8A 3AGOA 3LTBA 2JDIH 2XFTA 1LOVA 1O7HB 2GBXB 3OWYA 1JKGA 1IK3A 2E2VA 4WHAA 1FZUA 2K3DA 2P38A 4O8SA 1D6ZA 2BMQB 2RFRA 1RN4A 3GSPA 1EQKA 3NXJA 1TP6A 1TTOA 1AVLA 3B4PA 5KP3A 5JPUA 2WGOA 5AIFA 1N5PA 3X3YA 1ZS7A 2OCTA 1O7PB 3LYGA 2M7OA 3LTDA 3O8YA 4LGQA 3CCQ3 3G16A 3X3ZA 1BSDA 4BTYA 1BSEA 4HM3B 3MWZA 1CYVA 1BOXA 2IMJA 3CD63 1V57A 4ORLA 3PCSA 2CW9A 3B7CA 4AKZA 3LT8A 4XBTA 1LOWA 3GWRA 1US1A 1YIJ3 1SPUA 1NNVA 1UUVB 2R4IA 3LXUX 3N8BA 4BIRA 1W6YA 5AEUB 4J8TA 7RNTA 3CPW2 1TRPA 4HZBB 1FGQA 4K1UA 4EW5A 4BL2A 4LZIA 1BNJA 3GRDA 2XEPA 3G0KA 3IMAB 6STDA 1RGGA 3G4S3 2Z6BA 2PZVA 1BIRA 1IVWA 3MG2A 2CKFB 4HM7B 3EHCA 3ALAA 4N6NB 2WOFA 1LXEA 3LZAA 3FLJA 8CHOA 1JBSA 1BNRA 1MWTA 1SIIA 1B20A 3ECFA 1TRQA 4L7KA 3AHWA 4XBYA 3TDGA 4Q53A 1JZDA 4EXRA 1VQ73 1ROVA 2O3OA 3EJVA 1GMRA 2RGQA 1OACA 2BU4A 2CX1A 3LOYA 4WFOA 1FUTA 1OH0A 1WNHA 3T8UA 3EN1B 1KQS2 4J5KA 1BNSA 4L8PA 2OQEC 2IY2A 1A2PA 1GMPA 1RCKA 1EKMA 4HM5B 3NBBA 1B21A 5DRVA 5ELUA 1BNGA 3UL6A 3CCS3 1E3RA 2CWVA 2W04A 1FGOA 3F14A 3NBRA 3BIRA 2QIYA 2IUJA 3SOAA 3G713 5M1AA 3SVAA 3EE1A 1WMOA 2W56A
chains in the Genus database with same CATH topology
2HOHA 1FYSA 1RGHA 3D4AA 2RNTA 2AAEA 2KF5A 1BUJA 1RLSA 2C4BA 1DETA 1B3SA 1B2ZA 3DGYA 1C54A 1AY7A 5BU4A 3KCHA 1RGCA 3DH2A 1BNIA 1R4YA 1UCKA 1LNIA 2AADA 4GSPA 1MGRA 5GSPA 2F56A 3Q3FA 1PYLA 4GHOA 8RNTA 5BIRA 2KF3A 1UCJA 2F5MA 1G02A 1X1UA 1PY3A 1BRJA 1MGWA 1BRIA 1BSCA 1RGAA 3BU4A 3D5GA 7GSPA 1I3FA 1X1WA 1CH0A 1BRHA 1HZ1A 1HYFA 6RNTA 1YGWA 1I0XA 1RGLA 4HAAA 4J5GA 1BRNL 1JBTA 4RNTA 2KF4A 1FW7A 3A5EA 1AQZA 1BNEA 9RNTA 1IYYA 3HOHA 1X1YA 1GSPA 3AGOA 2ZA4A 1LOVA 1RNTA 2RBIA 1T2HA 2BIRA 3D5IA 1FUSA 1FZUA 1I2FA 1SARA 5RNTA 3GSPA 1GMQA 1LOYA 1RHLA 1RGEA 1RN4A 1TTOA 1ZGXA 1GOVA 1I2EA 2F4YA 3SYUA 1BRKA 3RNTA 1BSDA 1BSEA 3AGNA 2F5WA 1BOXA 1Q9EA 1BNFA 1B27A 1B2MA 1YNVX 1LOWA 1I70A 6GSPA 1BRSA 1RCLA 1GOYA 3URPA 1RGFA 1LRAA 4BIRA 7RNTA 1TRPA 4HOHA 1BNJA 4BU4A 1DE3A 1RGKA 1RGGA 1JBRA 1BSBA 1BIRA 1B2XA 1BVIA 1JBSA 1BNRA 1B2SA 1YVSA 1I2GA 1I8VA 1RDSA 1B20A 1TRQA 3WHOA 3AHWA 5HOHA 1I0VA 1RMSA 2KAAA 1RNBA 3WR2A 1BGSA 1GMRA 2BU4A 1T2IA 1RN1A 1RSNA 1BANA 1BSAA 1FUTA 4J5KA 1BNSA 3AHSA 2SARA 1A2PA 1GMPA 1RCKA 2KF6A 1B21A 1BNGA 1UCLA 3BIRA 1BAOA 1BU4A 1BRGA 1X1XA 1UCIA 2GSPA 1GOUA 1RTUA 1B2UA 1I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOH A;  1FYS A;  1RGH A;  3D4A A;  2RNT A;  2AAE A;  2KF5 A;  1BUJ A;  1RLS A;  2C4B A;  1DET A;  1B3S A;  1B2Z A;  3DGY A;  1C54 A;  1AY7 A;  5BU4 A;  3KCH A;  1RGC A;  3DH2 A;  1BNI A;  1R4Y A;  1UCK A;  1LNI A;  2AAD A;  4GSP A;  1MGR A;  5GSP A;  2F56 A;  3Q3F A;  1PYL A;  4GHO A;  8RNT A;  5BIR A;  2KF3 A;  1UCJ A;  2F5M A;  1G02 A;  1X1U A;  1PY3 A;  1BRJ A;  1MGW A;  1BRI A;  1BSC A;  1RGA A;  3BU4 A;  3D5G A;  7GSP A;  1I3F A;  1X1W A;  1CH0 A;  1BRH A;  1HZ1 A;  1HYF A;  6RNT A;  1YGW A;  1I0X A;  1RGL A;  4HAA A;  4J5G A;  1BRN L;  1JBT A;  4RNT A;  2KF4 A;  1FW7 A;  3A5E A;  1AQZ A;  1BNE A;  9RNT A;  1IYY A;  3HOH A;  1X1Y A;  1GSP A;  3AGO A;  2ZA4 A;  1LOV A;  1RNT A;  2RBI A;  1T2H A;  2BIR A;  3D5I A;  1FUS A;  1FZU A;  1I2F A;  1SAR A;  5RNT A;  3GSP A;  1GMQ A;  1LOY A;  1RHL A;  1RGE A;  1RN4 A;  1TTO A;  1ZGX A;  1GOV A;  1I2E A;  2F4Y A;  3SYU A;  1BRK A;  3RNT A;  1BSD A;  1BSE A;  3AGN A;  2F5W A;  1BOX A;  1Q9E A;  1BNF A;  1B27 A;  1B2M A;  1YNV X;  1LOW A;  1I70 A;  6GSP A;  1BRS A;  1RCL A;  1GOY A;  3URP A;  1RGF A;  1LRA A;  4BIR A;  7RNT A;  1TRP A;  4HOH A;  1BNJ A;  4BU4 A;  1DE3 A;  1RGK A;  1RGG A;  1JBR A;  1BSB A;  1BIR A;  1B2X A;  1BVI A;  1JBS A;  1BNR A;  1B2S A;  1YVS A;  1I2G A;  1I8V A;  1RDS A;  1B20 A;  1TRQ A;  3WHO A;  3AHW A;  5HOH A;  1I0V A;  1RMS A;  2KAA A;  1RNB A;  3WR2 A;  1BGS A;  1GMR A;  2BU4 A;  1T2I A;  1RN1 A;  1RSN A;  1BAN A;  1BSA A;  1FUT A;  4J5K A;  1BNS A;  3AHS A;  2SAR A;  1A2P A;  1GMP A;  1RCK A;  2KF6 A;  1B21 A;  1BNG A;  1UCL A;  3BIR A;  1BAO A;  1BU4 A;  1BRG A;  1X1X A;  1UCI A;  2GSP A;  1GOU A;  1RTU A;  1B2U A;  1I3I A; 
#chains in the Genus database with same CATH topology
 1IQY A;  2CWT A;  1QAF A;  3EX9 A;  3LH4 A;  2BMO B;  4HBR A;  5CF1 A;  1KD1 4;  2IYJ A;  1OHS A;  2W2C A;  1BUJ A;  3CC4 3;  2C4B A;  1FGM A;  1Q7H A;  2H0H A;  3OV4 A;  1JN5 B;  2P09 A;  4X2H A;  3I56 3;  1QVG 2;  1RGC A;  1R4Y A;  3PYJ A;  1UCK A;  1W6C A;  3FCS B;  4N6T A;  1VQ9 3;  4GSP A;  1MGR A;  4IT7 A;  5GSP A;  1YJN 3;  2STD A;  3NV0 B;  4NHF A;  5IG0 A;  2F56 A;  5IF6 A;  1N9J A;  5BIR A;  1SIH A;  3CCM 3;  1NWW A;  2Z7A A;  2F5M A;  4XDW A;  2XFS A;  4DKI A;  1BRJ A;  3LML A;  3F7S A;  1JN5 A;  1BRI A;  4I5Q A;  1GY6 A;  4HYZ A;  3CCU 3;  1W01 A;  3BU4 A;  3D5G A;  2IA7 A;  2K54 A;  3WMD A;  1Z1S A;  3HI7 A;  4LMI A;  3NM2 A;  4MJD A;  1YIT 3;  4JF8 A;  1M9G A;  6RNT A;  2CFL A;  3NV0 A;  2F98 A;  2P0X A;  3AMO A;  3SOY A;  2PNC A;  4RNT A;  1TJD A;  2SBL A;  5AII A;  2KCD A;  4HM0 B;  5AEW B;  4XM4 A;  1Q82 4;  1CYU A;  1FW7 A;  2CHC A;  3A5E A;  4BTX A;  9RNT A;  2YFJ B;  1O7N B;  1SJW A;  3BLZ A;  4MMY B;  1VQL 3;  1GSP A;  1GS3 A;  2YFI B;  1RNT A;  2RBI A;  1FGR A;  2BIR A;  2FGT A;  3FG3 A;  4N6L A;  3D5I A;  1FUS A;  4IIA A;  3F7X A;  4K61 A;  1J2B A;  3F9S A;  2H0G A;  1JNQ A;  5IEP A;  1RHL A;  4HJL B;  4R9K A;  1YJ9 3;  1YGE A;  2W9Q A;  3UL5 A;  2WOH A;  3SYU A;  3UB1 A;  1RRL A;  3B4O A;  2ZDJ A;  3FF0 A;  3V98 A;  1UW1 A;  5A0O B;  1C7H A;  1PU4 A;  1GY5 A;  1Q42 A;  2IUK A;  1JKG B;  1VQK 3;  3GZY B;  1VQQ A;  5ELJ A;  4X2O A;  3WOD G;  5JBS A;  5AYR B;  1OHO A;  3VF1 A;  1I70 A;  3X3X A;  1JB2 A;  1UDI I;  1RGF A;  3B8L A;  1ZO2 A;  3X41 A;  1LQM B;  4G1M B;  2WO0 A;  2GEX A;  3OWS A;  5D82 A;  4BU4 A;  5JPP A;  1RGK A;  2UGI A;  3H3H A;  1IT8 A;  4HM4 B;  5CXO A;  5EQL A;  3WOF B;  1AR0 A;  1BVI A;  3NM7 A;  3KII A;  1EA2 A;  5CK6 A;  4HM2 B;  3T0U A;  1YVS A;  1N8Q A;  1I2G A;  1OUN A;  3FGY A;  1YI2 3;  4R9L A;  5D83 A;  5G2G A;  4ZM8 A;  1RMS A;  1T3B A;  1KC8 4;  1VQ6 3;  1WTH A;  4N6U A;  5IER A;  1QVF 2;  3CC7 3;  3BND A;  2Q07 A;  1BSA A;  1GY7 A;  2XRX B;  1V74 A;  2XSH B;  1ULI B;  3A76 A;  1W00 A;  4FMC A;  1VQM 3;  5CLK A;  3DXO A;  5DRE A;  1JJ2 2;  1VQ8 3;  2C11 A;  4N6O B;  3I55 3;  3D79 A;  1E3V A;  4FCM A;  3X42 A;  3FKA A;  3FSD A;  4QWT A;  3K5T A;  1Q40 B;  1OGZ A;  4HZ9 B;  1BU4 A;  3OX9 A;  1BRG A;  1JB5 A;  1R4C A;  1X1X A;  3K7C A;  3HZP A;  1GOU A;  1TUH A;  1QMA A;  1I3I A;  2OWP A;  1MWU A;  4J9A A;  4JRF A;  2CIU A;  2F86 B;  3VGN A;  2OOV C;  1IV7 A;  2OQE A;  4HVN A;  1O7W B;  1N9E A;  3NUV A;  1Q40 A;  1B3S A;  2D42 A;  3K0Z A;  3D3L A;  3DGY A;  3PXM A;  3MG1 A;  4KFF A;  3UNL A;  3FG4 A;  3KCH A;  5BU4 A;  1CQS A;  3S27 A;  2GXF A;  5G1K A;  3NHX A;  2W56 B;  4R1K A;  1DMM A;  1ULJ B;  3CC2 3;  3OW2 2;  2KRT A;  3HIG A;  3PGB A;  3ZG5 A;  1IQX A;  2LQV A;  3EBY A;  1A67 A;  3G6E 3;  1G96 A;  4AEQ A;  1MGW A;  1TU5 A;  3F8X A;  1UUW B;  7GSP A;  1I3F A;  1X1W A;  1CH0 A;  2E2T A;  3EF8 A;  3K63 A;  1A90 A;  1HZ1 A;  1UUG B;  3JUQ A;  1HYF A;  5KP4 A;  3FF2 A;  3Q1C A;  4K1V A;  3M8C A;  4HAA A;  1W5Z A;  1G0T A;  3F8H A;  2RSX A;  4FCZ A;  4FMA A;  1UI8 A;  3RDE A;  4HM1 B;  3X40 A;  1Q7Y 4;  3CMA 3;  1AQZ A;  1BNE A;  1IYY A;  4K90 B;  3SED A;  3SLU A;  1MNL A;  2CWU A;  3S28 A;  4GL6 A;  3D9R A;  4O3V A;  5IG5 A;  4KFE A;  1LQG C;  1SQW A;  1MWR A;  1T2H A;  2Z77 A;  4CPK A;  2W03 A;  1V58 A;  1I2F A;  1TIJ A;  1SAR A;  2QGU A;  3AMO B;  4L8O A;  5RNT A;  1GMQ A;  1O7M B;  1LOX A;  1RGE A;  1W2Z A;  3RGA A;  5BVB A;  5M19 A;  1U5O A;  1ISK A;  1ZGX A;  1EUI C;  5BXQ A;  5EVH A;  3KSP A;  1T5Y A;  2F4Y A;  3DY5 A;  3RNT A;  3HX8 A;  3N9H A;  5AIG A;  2ML6 A;  1Y4K A;  1AVK A;  1CEW I;  1QAL A;  4ILF A;  3J7Y d;  1BNF A;  1B27 A;  1JZO A;  1YNV X;  2A15 A;  1KSI A;  3KKG A;  4MEI A;  4OVM A;  2CK3 H;  5EEO A;  1B2M A;  3U97 A;  1E97 A;  4I4K A;  1Q86 4;  1BRS A;  3CNX A;  1GOY A;  3Q90 A;  1FA3 A;  2XSO B;  5IG4 A;  1AV4 A;  1IVU A;  1IV9 A;  1JB4 A;  2GBW B;  3H51 A;  1NB3 I;  3PCR A;  4LYL B;  4FMB A;  4MMX B;  1DE3 A;  1YVB I;  3FZW A;  2R41 A;  2XGL A;  2ML5 A;  2BO9 B;  4KVH A;  5FW5 A;  1B2X A;  3OXA A;  3KE7 A;  4IPB A;  3GAX A;  1B2S A;  1M90 4;  1VQ5 3;  1I8V A;  1RDS A;  4CCV A;  1KWI A;  3WHO A;  4O02 B;  5HOH A;  5G1L A;  1I0V A;  1OF5 A;  1NO3 A;  2B24 B;  1RNB A;  2CFD A;  4OK0 A;  3KSE D;  5IW9 A;  1K28 A;  1NJI 4;  1PFP A;  3BB9 A;  1BUQ A;  1BAN A;  3EBT A;  5FGO A;  3S5C A;  1VQO 3;  3WA3 A;  1RN7 A;  3VSY A;  4EC6 A;  2ZHX B;  2SAR A;  1NDO B;  2W9P A;  2KF6 A;  3FG1 A;  3ROB A;  1WMP A;  3CXC 2;  1K9M 4;  3BNE A;  2P05 A;  3MHE A;  1U8C B;  2C10 A;  3RGR A;  2QEX 3;  1K8A 4;  5AI1 A;  4LSO A;  2CFG A;  1GD3 A;  2HMJ B;  4EBG A;  3KZT A;  1TFO A;  1RTU A;  2YFL B;  1OCV A;  3NBJ A;  2OTJ 3;  2W0Q A;  4KFD A;  1FYS A;  1RGH A;  4XDV A;  4HM6 B;  1W2B 2;  2UX0 A;  2AAE A;  1L5G B;  2MF7 A;  1LNH A;  1RLS A;  4WWU C;  1RKY A;  1AY7 A;  3PZW A;  1LVN A;  1WQL B;  4HM8 B;  3DH2 A;  1BNI A;  1VZZ A;  3CCR 3;  1ZX2 A;  1UGI A;  2AAD A;  3N54 B;  3EC9 A;  4LEH A;  3NQZ A;  4EV2 A;  2BT3 A;  3BNC A;  2YX9 A;  3GZR A;  1D6U A;  3CU3 A;  2OOV A;  2KF3 A;  1UCJ A;  4EV5 A;  1G02 A;  1IDP A;  1X1U A;  2BMR B;  3MG3 A;  3PS8 A;  4N6V 0;  3CCJ 3;  2L4V A;  1RGA A;  3NQY A;  3I0Y A;  1YHQ 3;  1N8R 4;  1W02 A;  1DMN A;  4NPB A;  5M18 A;  1A2V A;  4EYC A;  4BL3 A;  2E2U A;  1ROA A;  2XF3 A;  1VQP 3;  1YGW A;  1ASK A;  1I0X A;  4J5G A;  2QA4 3;  1DVC A;  2HMN B;  5HGR A;  1BRN L;  3DGO A;  4N3V A;  2GU3 A;  3WOE B;  4RBN A;  1IQ8 A;  3HOH A;  3DM8 A;  4WYK B;  4WP5 A;  1W4N A;  2ZA4 A;  3JUN A;  2XH9 A;  5IEO A;  2I9W A;  4BTW A;  1QJG A;  3ZG0 A;  3CME 3;  1YJW 3;  2HML B;  2JQ5 A;  1LOY A;  3KN4 A;  2RCD A;  2HMO B;  3MYT A;  5TGN A;  1GOV A;  2V1L A;  3DGM A;  4MMZ B;  1I2E A;  1FGT A;  4WYK A;  1BRK A;  4R80 A;  2CFK A;  4O2H A;  3LTC A;  2XR8 B;  3AGN A;  2F5W A;  4FCJ A;  1Q9E A;  2D1W A;  3JVC A;  3T8N A;  3FH1 A;  3NX0 A;  1TFK A;  3JUO A;  6GSP A;  1JV2 B;  3CNM A;  1RCL A;  3EQQ B;  1DMQ A;  1OGX A;  3URP A;  1LRA A;  3CCE 3;  2MC8 A;  3QRD A;  3EB8 A;  1IVV A;  4HOH A;  3QK9 A;  1K41 A;  1STD A;  2HMK B;  2P0M A;  2CG0 A;  2J8X B;  1OPY A;  1UI7 A;  5CF2 A;  2K0M A;  1IVX A;  1O7G B;  1BSB A;  1GD4 A;  4H61 A;  1JBR A;  2B1X B;  3S29 A;  2L1S A;  7STD A;  4KT3 B;  3DMC A;  1JRQ A;  2KXG A;  1IT7 A;  3STD A;  1F8N A;  3ZFZ A;  3JUP A;  3DUK A;  4TX4 A;  5AIH A;  4XBX A;  4XB5 A;  1W6G A;  3E99 A;  2F99 A;  2UUG C;  2KAA A;  3MPH A;  4RNZ A;  3WA2 X;  1BGS A;  4RNY A;  3WR2 A;  1M1K 4;  1VQ4 3;  1STF I;  3SX1 A;  1T2I A;  1RN1 A;  1VQN 3;  1B2U A;  2Y73 A;  3IPT A;  1GYB A;  1RSN A;  3CPO A;  2CG1 A;  4AKY A;  3EN8 A;  3DGL A;  3L0R A;  1MWS A;  4H3U A;  3K9M C;  1D6Y A;  1OHP A;  3KFQ C;  5KP1 A;  3GZB A;  2GEY A;  3AHS A;  1UGH I;  5D81 A;  1EEJ A;  1MOL A;  3MSO A;  3OWU A;  5STD A;  3IJE B;  1OF5 B;  4U13 A;  3ER7 A;  1DVD A;  2BHM A;  3U1W A;  1UCL A;  3JUM A;  3MKI A;  3DZL A;  1BAO A;  1W7C A;  3Q2P A;  3CCL 3;  1HKX A;  1UCI A;  2GSP A;  3HII A;  2CH9 A;  2INX A;  2Z76 A;  4PEJ A;  4FR9 A;  4GB5 A;  1RRH A;  4STD A;  1K73 4;  3G8Z A;  3WDG B;  4FMD A;  1QAK A;  2HOH A;  2BNG A;  3D4A A;  2RNT A;  3LT9 A;  2LYX A;  5I97 A;  2KF5 A;  2H0I A;  3GZX B;  5LC7 A;  1N5H A;  2GU1 A;  4OUQ A;  1DET A;  3SXX A;  1B2Z A;  1M1X B;  3HK4 A;  3DGN A;  4CDL A;  1C54 A;  2Y74 A;  1IU7 A;  2FXT A;  1RJO A;  3V92 A;  1LNI A;  4KZ1 A;  4N6M A;  2O9U X;  2W6J H;  1NB5 I;  2CFW A;  3Q3F A;  4GHO A;  1PYL A;  4R4K A;  3S67 A;  8RNT A;  4NRE A;  3BNB A;  5IG3 A;  5LC6 A;  1PY3 A;  1S72 3;  2FNQ A;  5AYS C;  1BSC A;  1EG9 B;  5IEN A;  1FUW A;  2OTL 3;  1DYU A;  2XGN A;  3UJM A;  4CJN A;  1BRH A;  1WMN A;  1NU3 A;  1A2K A;  1HU9 A;  1S5A A;  3CCV 3;  4HKV B;  2WGQ A;  1RGL A;  1Q81 4;  4RZM A;  1JBT A;  2CX0 A;  2KF4 A;  2CC3 A;  2HMM B;  3LTA A;  3V99 A;  1X1Y A;  3F40 A;  2ZL8 A;  3AGO A;  3LTB A;  2JDI H;  2XFT A;  1LOV A;  1O7H B;  2GBX B;  3OWY A;  1JKG A;  1IK3 A;  2E2V A;  4WHA A;  1FZU A;  2K3D A;  2P38 A;  4O8S A;  1D6Z A;  2BMQ B;  2RFR A;  1RN4 A;  3GSP A;  1EQK A;  3NXJ A;  1TP6 A;  1TTO A;  1AVL A;  3B4P A;  5KP3 A;  5JPU A;  2WGO A;  5AIF A;  1N5P A;  3X3Y A;  1ZS7 A;  2OCT A;  1O7P B;  3LYG A;  2M7O A;  3LTD A;  3O8Y A;  4LGQ A;  3CCQ 3;  3G16 A;  3X3Z A;  1BSD A;  4BTY A;  1BSE A;  4HM3 B;  3MWZ A;  1CYV A;  1BOX A;  2IMJ A;  3CD6 3;  1V57 A;  4ORL A;  3PCS A;  2CW9 A;  3B7C A;  4AKZ A;  3LT8 A;  4XBT A;  1LOW A;  3GWR A;  1US1 A;  1YIJ 3;  1SPU A;  1NNV A;  1UUV B;  2R4I A;  3LXU X;  3N8B A;  4BIR A;  1W6Y A;  5AEU B;  4J8T A;  7RNT A;  3CPW 2;  1TRP A;  4HZB B;  1FGQ A;  4K1U A;  4EW5 A;  4BL2 A;  4LZI A;  1BNJ A;  3GRD A;  2XEP A;  3G0K A;  3IMA B;  6STD A;  1RGG A;  3G4S 3;  2Z6B A;  2PZV A;  1BIR A;  1IVW A;  3MG2 A;  2CKF B;  4HM7 B;  3EHC A;  3ALA A;  4N6N B;  2WOF A;  1LXE A;  3LZA A;  3FLJ A;  8CHO A;  1JBS A;  1BNR A;  1MWT A;  1SII A;  1B20 A;  3ECF A;  1TRQ A;  4L7K A;  3AHW A;  4XBY A;  3TDG A;  4Q53 A;  1JZD A;  4EXR A;  1VQ7 3;  1ROV A;  2O3O A;  3EJV A;  1GMR A;  2RGQ A;  1OAC A;  2BU4 A;  2CX1 A;  3LOY A;  4WFO A;  1FUT A;  1OH0 A;  1WNH A;  3T8U A;  3EN1 B;  1KQS 2;  4J5K A;  1BNS A;  4L8P A;  2OQE C;  2IY2 A;  1A2P A;  1GMP A;  1RCK A;  1EKM A;  4HM5 B;  3NBB A;  1B21 A;  5DRV A;  5ELU A;  1BNG A;  3UL6 A;  3CCS 3;  1E3R A;  2CWV A;  2W04 A;  1FGO A;  3F14 A;  3NBR A;  3BIR A;  2QIY A;  2IUJ A;  3SOA A;  3G71 3;  5M1A A;  3SVA A;  3EE1 A;  1WMO A;  2W56 A; 
#chains in the Genus database with same CATH homology
 2HOH A;  1FYS A;  1RGH A;  3D4A A;  2RNT A;  2AAE A;  2KF5 A;  1BUJ A;  1RLS A;  2C4B A;  1DET A;  1B3S A;  1B2Z A;  3DGY A;  1C54 A;  1AY7 A;  5BU4 A;  3KCH A;  1RGC A;  3DH2 A;  1BNI A;  1R4Y A;  1UCK A;  1LNI A;  2AAD A;  4GSP A;  1MGR A;  5GSP A;  2F56 A;  3Q3F A;  1PYL A;  4GHO A;  8RNT A;  5BIR A;  2KF3 A;  1UCJ A;  2F5M A;  1G02 A;  1X1U A;  1PY3 A;  1BRJ A;  1MGW A;  1BRI A;  1BSC A;  1RGA A;  3BU4 A;  3D5G A;  7GSP A;  1I3F A;  1X1W A;  1CH0 A;  1BRH A;  1HZ1 A;  1HYF A;  6RNT A;  1YGW A;  1I0X A;  1RGL A;  4HAA A;  4J5G A;  1BRN L;  1JBT A;  4RNT A;  2KF4 A;  1FW7 A;  3A5E A;  1AQZ A;  1BNE A;  9RNT A;  1IYY A;  3HOH A;  1X1Y A;  1GSP A;  3AGO A;  2ZA4 A;  1LOV A;  1RNT A;  2RBI A;  1T2H A;  2BIR A;  3D5I A;  1FUS A;  1FZU A;  1I2F A;  1SAR A;  5RNT A;  3GSP A;  1GMQ A;  1LOY A;  1RHL A;  1RGE A;  1RN4 A;  1TTO A;  1ZGX A;  1GOV A;  1I2E A;  2F4Y A;  3SYU A;  1BRK A;  3RNT A;  1BSD A;  1BSE A;  3AGN A;  2F5W A;  1BOX A;  1Q9E A;  1BNF A;  1B27 A;  1B2M A;  1YNV X;  1LOW A;  1I70 A;  6GSP A;  1BRS A;  1RCL A;  1GOY A;  3URP A;  1RGF A;  1LRA A;  4BIR A;  7RNT A;  1TRP A;  4HOH A;  1BNJ A;  4BU4 A;  1DE3 A;  1RGK A;  1RGG A;  1JBR A;  1BSB A;  1BIR A;  1B2X A;  1BVI A;  1JBS A;  1BNR A;  1B2S A;  1YVS A;  1I2G A;  1I8V A;  1RDS A;  1B20 A;  1TRQ A;  3WHO A;  3AHW A;  5HOH A;  1I0V A;  1RMS A;  2KAA A;  1RNB A;  3WR2 A;  1BGS A;  1GMR A;  2BU4 A;  1T2I A;  1RN1 A;  1RSN A;  1BAN A;  1BSA A;  1FUT A;  4J5K A;  1BNS A;  3AHS A;  2SAR A;  1A2P A;  1GMP A;  1RCK A;  2KF6 A;  1B21 A;  1BNG A;  1UCL A;  3BIR A;  1BAO A;  1BU4 A;  1BRG A;  1X1X A;  1UCI A;  2GSP A;  1GOU A;  1RTU A;  1B2U A;  1I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...