1X1YA

Water-mediate interaction at aprotein-protein interface
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Water-mediated interaction at a protein-protein interface
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1x1yA00
1B3SA 1BNIA 2F5MA 5GSPA 4RNTA 5RNTA 1DE3A 1PYLA 4J5GA 1BNGA 1FUSA 3WR2A 1BU4A 1GMPA 1RCKA 1BRNL 1BAOA 1GMRA 1BSAA 6GSPA 1BGSA 1BIRA 2KF4A 1I2EA 2BIRA 1RHLA 3SYUA 4BU4A 1BRKA 3D5IA 3D4AA 1TTOA 2F5WA 4GSPA 1RGHA 1BSBA 1GSPA 4HOHA 1FW7A 4BIRA 1YNVX 2KF3A 1DETA 1RGEA 7RNTA 1IYYA 1MGRA 1BSCA 1BNJA 1RCLA 1SARA 1FZUA 1MGWA 1JBRA 1BOXA 1RGGA 1T2HA 1UCKA 1BRHA 1I2FA 4GHOA 1B2XA 1BANA 1R4YA 1LNIA 1C54A 1I2GA 2AAEA 1I8VA 1GOVA 1UCIA 1G02A 1X1UA 1I0XA 3Q3FA 3AHWA 1LOYA 1YGWA 1TRPA 1X1YA 1JBSA 1RTUA 1GOUA 1RDSA 2GSPA 1BUJA 1T2IA 2KF6A 1BNSA 1A2PA 1HZ1A 1RGCA 1HYFA 1B2ZA 2SARA 2HOHA 3KCHA 4J5KA 1BNRA 4HAAA 2KAAA 3GSPA 1ZGXA 2C4BA 6RNTA 2RNTA 8RNTA 1RGAA 3URPA 2KF5A 5BIRA 1CH0A 1JBTA 1BRIA 2F56A 3RNTA 1BNFA 1RNTA 2BU4A 1B27A 1B2UA 1I0VA 1RN4A 1RMSA 1UCJA 3DGYA 1X1WA 5HOHA 1LOWA 1RGFA 3WHOA 1I3FA 1AY7A 1YVSA 1GOYA 1BRSA 1RN1A 1PY3A 1RNBA 1RSNA 1B2MA 1FUTA 1AQZA 1X1XA 1GMQA 1LOVA 1BRJA 1BSDA 2AADA 3AHSA 1BSEA 1TRQA 3D5GA 2ZA4A 1B21A 1BRGA 3AGOA 1B2SA 1UCLA 3BIRA 3HOHA 1FYSA 1RLSA 7GSPA 1BVIA 1LRAA 1B20A 3BU4A 3AGNA 1RGLA 1I70A 9RNTA 1RGKA 2RBIA 1I3IA 3A5EA 2F4YA 1BNEA 1Q9EA 3DH2A 5BU4A
chains in the Genus database with same CATH superfamily
4OVMA 2R41A 1N9JA 3K63A 4FCMA 1K9M4 1DE3A 1JB4A 1BNGA 2RCDA 4J5GA 1QALA 3J7Yd 4IT7A 2BHMA 2CX1A 3IPTA 1BU4A 3KN4A 2CWVA 3X3YA 1Q40A 3GAXA 1BSAA 5CF2A 1BGSA 1BIRA 3PYJA 3KKGA 2BIRA 3LTAA 1R4CA 1BRKA 1SQWA 4K61A 5EEOA 3KE7A 1OGXA 2GBXB 1Q7HA 2P0MA 1IT7A 3B8LA 3MSOA 4GSPA 1QMAA 5AYRB 4IIAA 2P05A 3N9HA 4HM8B 1GSPA 1US1A 1STDA 5EQLA 1YNVX 3T8NA 1DETA 1V58A 4HZ9B 2BT3A 5AIFA 1YHQ3 1Q40B 1ULJB 1FGRA 4KVHA 4N6TA 2C10A 1SARA 2QIYA 3GZBA 3HK4A 3K0ZA 4O3VA 1JBRA 1BOXA 1RGGA 1CEWI 1UCKA 2K54A 4WYKA 2B24B 1U5OA 1VQ93 3CD63 1BANA 3CXC2 3FG4A 1M9GA 3G0KA 1VQM3 4HYZA 1R4YA 1UGIA 7STDA 1C54A 3ALAA 3PZWA 2AAEA 2CK3H 3EBYA 2W56B 1JKGA 3NM2A 3Q2PA 3Q90A 3WA3A 2BMOB 3I553 4ZM8A 1I0XA 3BNCA 3Q3FA 1W4NA 1ZX2A 4FCJA 2W2CA 1Q864 1RTUA 4QWTA 3JUNA 1MWRA 4WYKB 3FG3A 4H61A 4CCVA 3DXOA 4X2HA 5DRVA 2HMKB 3DM8A 5G1KA 2CG1A 2KF6A 4RBNA 1VQ63 1HYFA 3CC23 4L8PA 2XFTA 1RRHA 1Y4KA 1DYUA 3D9RA 1JKGB 1L5GB 4HAAA 2E2UA 4ORLA 1JN5A 2R4IA 2C4BA 3DGMA 5TGNA 2CFLA 3MYTA 2CC3A 3RDEA 3H3HA 3IJEB 3D3LA 2BO9B 2F86B 4N6MA 2IMJA 4AKZA 1RNTA 4MMYB 2BNGA 2O3OA 3G8ZA 3RGAA 2CFKA 4LGQA 5FW5A 1I0VA 4WP5A 4K1VA 4WFOA 2K3DA 1UI8A 2UX0A 4HVNA 1X1WA 3K7CA 1JN5B 2WO0A 1RGFA 3MPHA 3CCS3 3V92A 1YVSA 2E2TA 1DMMA 5BXQA 1PY3A 2D42A 2XGNA 1RSNA 1PFPA 4JF8A 4EC6A 1AQZA 1X1XA 3V98A 2E2VA 3IMAB 3EN8A 1BSDA 3AHSA 5IW9A 2UUGC 1EA2A 4HM0B 2CHCA 4NREA 3NBJA 2XRXB 2ZDJA 3EHCA 2P09A 4BL3A 2WGOA 3CCR3 1KSIA 1AVLA 1A2VA 3BIRA 4N6UA 1VQ83 3JUQA 1T3BA 1RJOA 4O2HA 3G713 3BU4A 2UGIA 3AGNA 3HIGA 4XB5A 1RGLA 9RNTA 3DGNA 2F4YA 3GZXB 2AADA 4KFFA 1QJGA 3HIIA 1GD4A 1B3SA 1FGQA 2XF3A 2WOFA 1QVG2 1KC84 1BNIA 3MWZA 1UW1A 2GU3A 5GSPA 1Q814 3FZWA 2M7OA 3UJMA 1YI23 3CCM3 3VF1A 3NXJA 3I563 1YIT3 3AMOA 2OOVC 1PU4A 2IA7A 1BUQA 4L7KA 5IEPA 4WWUC 3SYUA 1OPYA 4KT3B 1IQYA 1FGTA 3LTBA 3D4AA 3T8UA 2F5WA 4I4KA 4KFDA 3CCL3 2HMLB 2Y74A 4G1MB 1MWSA 4HOHA 1FW7A 2KF3A 3FH1A 3G6E3 2RFRA 1NNVA 4IPBA 2XFSA 4TX4A 1G0TA 4MJDA 3EC9A 1MGRA 3V99A 1M1K4 1G96A 1BNJA 1O7PB 3AMOB 1FZUA 3MG2A 1Q824 2XGLA 4OUQA 3VGNA 1OH0A 1D6UA 1VQ73 2OQEA 4EV5A 3SOYA 1VQ53 3S67A 1YJW3 1U8CB 1I2GA 5M18A 5KP3A 4EW5A 1I8VA 5JPPA 3SLUA 2QEX3 1G02A 2ZHXB 3RGRA 5HGRA 2HMOB 4CJNA 1LOYA 4DKIA 1YGWA 3UL6A 2YX9A 1LOXA 4Q53A 3DUKA 1C7HA 1W2ZA 3OWUA 5AIIA 1UGHI 1VQL3 4N6V0 3F40A 8CHOA 1BNSA 1K28A 1IQ8A 1NO3A 3HI7A 1IK3A 2YFIB 1B2ZA 2FNQA 3D79A 2Q07A 2SARA 4J5KA 1GD3A 1MNLA 1ZGXA 3GSPA 3LTDA 3SOAA 5I97A 1K734 1VQK3 2KF5A 3PCRA 3X42A 5D82A 1CH0A 1GY5A 2CFGA 4HBRA 4EV2A 1YJ93 1BRIA 3H51A 3RNTA 2Z77A 1JJ22 1ASKA 1EG9B 2BU4A 1OGZA 1JRQA 1B2UA 3F9SA 3NQYA 1LQMB 1E97A 4HM4B 1UCJA 1ULIB 3BNBA 4NHFA 2IUJA 2CX0A 4LSOA 5IG0A 2O9UX 3G4S3 1MWUA 2IY2A 1RNBA 1O7NB 2L1SA 1CYVA 1STFI 3E99A 3F8XA 4CPKA 3FCSB 3K5TA 1QVF2 3LH4A 1GS3A 3KSPA 4MMXB 1BRJA 1O7GB 1BSEA 2GBWB 3D5GA 2W04A 1O7MB 1FGOA 2W03A 3WMDA 1V74A 3JUOA 5IENA 1LVNA 2I9WA 3AGOA 1NJI4 1DMNA 3PCSA 5AEWB 3HOHA 1W2B2 1F8NA 1FYSA 1LXEA 7GSPA 1AVKA 3M8CA 2L4VA 1LRAA 2ML5A 2WOHA 1OHPA 3ECFA 3PGBA 5KP1A 4N6OB 3UL5A 3F7SA 1W5ZA 2RBIA 1I3IA 3KFQC 1N5PA 3WODG 4RNZA 4HM6B 3DH2A 5BU4A 3DZLA 1IVUA 2IYJA 3UNLA 5RNTA 1PYLA 3SX1A 5KP4A 1RKYA 3LT8A 3WR2A 3NV0A 4R9KA 1GMPA 1TP6A 2OTL3 1BAOA 1GMRA 2B1XB 6GSPA 1A2KA 2KF4A 2J8XB 4O02B 3B4PA 3CCJ3 1OHOA 3FGYA 2W9QA 3QRDA 3S5CA 3NQZA 3WDGB 1RGHA 2F99A 4BTWA 1IT8A 1BSBA 1LNHA 1E3VA 3F7XA 3FG1A 2PZVA 4X2OA 4BIRA 1HU9A 1ZS7A 3NV0B 4RNYA 1NB3I 2W0QA 3BLZA 3KIIA 3UB1A 7RNTA 3OX9A 1IYYA 1IQXA 1V57A 1W6YA 1BSCA 4U13A 4KZ1A 1E3RA 1MGWA 3X3ZA 5JBSA 4LYLB 3MG3A 3S28A 3HX8A 1I2FA 1WTHA 5STDA 1TUHA 4EBGA 4BTXA 1LQGC 1DMQA 2Y73A 3DY5A 3WOEB 1GY6A 1T5YA 1WMOA 3N54B 2CWTA 5CK6A 1W6GA 4BTYA 1YIJ3 4JRFA 5LC7A 1KWIA 2XSHB 4RZMA 4EXRA 1QAFA 3HZPA 1S723 1JB5A 1UCIA 3LT9A 3F8HA 4HJLB 2XH9A 1W6CA 2D1WA 1S5AA 4J8TA 1D6YA 4R9LA 4H3UA 1X1YA 1ROAA 1OCVA 1GOUA 2RGQA 2GSPA 4HM2B 5JPUA 1IDPA 1BUJA 1TJDA 2CH9A 3NM7A 1WMPA 4CDLA 2HOHA 3JUMA 1UDII 2QGUA 3EJVA 1OUNA 4J9AA 4XBYA 8RNTA 2BMQB 2RNTA 2V1LA 3EE1A 1IVXA 1OHSA 1RGAA 2JDIH 1SPUA 3OV4A 3OWSA 4KFEA 5EVHA 1OACA 3FKAA 3URPA 1W01A 5AI1A 3LTCA 2RSXA 3PS8A 1JBTA 2HMJB 2OOVA 2OTJ3 3N8BA 2Z6BA 1FA3A 2HMNB 3MKIA 4LZIA 3F14A 4HM5B 1Z1SA 3LMLA 1RMSA 2QA43 2LQVA 4NPBA 1VQO3 3CPOA 5AIHA 1A90A 1NU3A 1CYUA 5HOHA 1LOWA 4MEIA 1SIIA 4BL2A 3Q1CA 4N3VA 2PNCA 3G16A 1GOYA 1YJN3 3FSDA 1VQN3 2STDA 3WA2X 3OW22 1MOLA 2CW9A 4AKYA 1TIJA 1FUTA 1M904 1B2MA 4LEHA 1EKMA 1GMQA 2KXGA 1LOVA 2F98A 3LOYA 4R80A 1VQ43 1YGEA 3SVAA 3JVCA 1B21A 4FMAA 2IUKA 3TDGA 2YFLB 1B2SA 2P0XA 1CQSA 2CG0A 1EUIC 5ELJA 2CIUA 3GZRA 2GEYA 5ELUA 3X41A 1N5HA 2C11A 2KRTA 4MMZB 2W56A 1I70A 1RGKA 3ZFZA 3A5EA 2LYXA 1BNEA 1Q9EA 1JZDA 4EYCA 1VQP3 3OWYA 3BNEA 2KCDA 3LYGA 1TFOA 2F5MA 1MWTA 4RNTA 5CLKA 3VSYA 5IEOA 4R4KA 2HMMB 3B7CA 3SXXA 1FUSA 5IG3A 5IF6A 1N9EA 2CFDA 2ZL8A 3STDA 1FGMA 2MF7A 1M1XB 3MG1A 1RCKA 4LMIA 1BRNL 1VQQA 2ML6A 1KD14 5D83A 4K90B 3O8YA 2CFWA 1RN7A 1I2EA 5CXOA 1NWWA 1RHLA 3EF8A 3LXUX 3LZAA 1UUVB 4BU4A 1YVBI 3D5IA 1WNHA 1ROVA 1TTOA 3DGLA 5IG5A 3B4OA 3EBTA 3CC43 3CNMA 3I0YA 3NBBA 3NUVA 2MC8A 3SEDA 2XEPA 2BMRB 1Q42A 2H0IA 4ILFA 4XBXA 1ISKA 1WQLB 1RGEA 3NBRA 3ZG0A 4OK0A 1SJWA 1RCLA 1N8R4 1K8A4 2K0MA 1IV7A 1N8QA 3CMA3 1GY7A 5AIGA 3CNXA 1DVCA 1K41A 1T2HA 1UUGB 1BRHA 1AV4A 2GU1A 4GHOA 1B2XA 4O8SA 1ZO2A 2H0GA 1FUWA 3FF0A 4R1KA 5G2GA 1EEJA 1LNIA 1TU5A 5CF1A 1W02A 4FR9A 5AYSC 3X40A 1EQKA 1AR0A 1W7CA 1GOVA 3BNDA 1OF5A 3S27A 1X1UA 3FF2A 4L8OA 2Z76A 3AHWA 1DVDA 1TRPA 4FCZA 3CCV3 3CME3 1JBSA 4AEQA 1RDSA 2FGTA 1IVVA 3K9MC 1UUWB 1RRLA 2YFJB 1JNQA 1T2IA 4HM3B 4I5QA 1A2PA 1HZ1A 1RGCA 2GXFA 2W9PA 3GZYB 3CC73 5A0OB 3KCHA 4WHAA 3BB9A 3U1WA 2OWPA 5D81A 3WOFB 1BNRA 2KAAA 1VZZA 2W6JH 1OF5B 1IVWA 3FLJA 4N6NB 4HM7B 6RNTA 1KQS2 1UI7A 3DMCA 4XM4A 1WMNA 4STDA 3ROBA 1O7HB 2F56A 2Z7AA 4FMCA 1BNFA 4XBTA 2FXTA 1B27A 5LC6A 3GWRA 1RN4A 1SIHA 2JQ5A 3PXMA 4PEJA 2CKFB 1TFKA 2INXA 3DGYA 5IG4A 3EX9A 3MHEA 3WHOA 4XDWA 4XDVA 3ER7A 3CCQ3 1AY7A 1I3FA 4HZBB 1O7WB 1BRSA 1RN1A 1W00A 1GYBA 2CWUA 3EN1B 1IV9A 2A15A 2H0HA 1JB2A 2OCTA 4GB5A 5DREA 3S29A 6STDA 1JZOA 1D6ZA 3DGOA 2GEXA 3CCE3 1J2BA 5BVBA 2OQEC 1NDOB 3KZTA 4FMBA 3U97A 3CPW2 1NB5I 3NX0A 1TRQA 5AEUB 2ZA4A 3A76A 3QK9A 5IERA 3OXAA 3GRDA 3ZG5A 3CU3A 1BRGA 1IU7A 2P38A 4HKVB 3CCU3 3KSED 5G1LA 1UCLA 2SBLA 4K1UA 2XR8B 3NHXA 4HM1B 2XSOB 4N6LA 1RLSA 3EQQB 5M19A 1Q7Y4 1BVIA 1JV2B 1B20A 1QAKA 3L0RA 1HKXA 4GL6A 5FGOA 2WGQA 3EB8A 5M1AA 3JUPA 3X3XA 4FMDA 1A67A 5BIRA 3T0UA
chains in the Genus database with same CATH topology
1B3SA 1BNIA 2F5MA 5GSPA 4RNTA 5RNTA 1DE3A 1PYLA 4J5GA 1BNGA 1FUSA 3WR2A 1BU4A 1GMPA 1RCKA 1BRNL 1BAOA 1GMRA 1BSAA 6GSPA 1BGSA 1BIRA 2KF4A 1I2EA 2BIRA 1RHLA 3SYUA 4BU4A 1BRKA 3D5IA 3D4AA 1TTOA 2F5WA 4GSPA 1RGHA 1BSBA 1GSPA 4HOHA 1FW7A 4BIRA 1YNVX 2KF3A 1DETA 1RGEA 7RNTA 1IYYA 1MGRA 1BSCA 1BNJA 1RCLA 1SARA 1FZUA 1MGWA 1JBRA 1BOXA 1RGGA 1T2HA 1UCKA 1BRHA 1I2FA 4GHOA 1B2XA 1BANA 1R4YA 1LNIA 1C54A 1I2GA 2AAEA 1I8VA 1GOVA 1UCIA 1G02A 1X1UA 1I0XA 3Q3FA 3AHWA 1LOYA 1YGWA 1TRPA 1X1YA 1JBSA 1RTUA 1GOUA 1RDSA 2GSPA 1BUJA 1T2IA 2KF6A 1BNSA 1A2PA 1HZ1A 1RGCA 1HYFA 1B2ZA 2SARA 2HOHA 3KCHA 4J5KA 1BNRA 4HAAA 2KAAA 3GSPA 1ZGXA 2C4BA 6RNTA 2RNTA 8RNTA 1RGAA 3URPA 2KF5A 5BIRA 1CH0A 1JBTA 1BRIA 2F56A 3RNTA 1BNFA 1RNTA 2BU4A 1B27A 1B2UA 1I0VA 1RN4A 1RMSA 1UCJA 3DGYA 1X1WA 5HOHA 1LOWA 1RGFA 3WHOA 1I3FA 1AY7A 1YVSA 1GOYA 1BRSA 1RN1A 1PY3A 1RNBA 1RSNA 1B2MA 1FUTA 1AQZA 1X1XA 1GMQA 1LOVA 1BRJA 1BSDA 2AADA 3AHSA 1BSEA 1TRQA 3D5GA 2ZA4A 1B21A 1BRGA 3AGOA 1B2SA 1UCLA 3BIRA 3HOHA 1FYSA 1RLSA 7GSPA 1BVIA 1LRAA 1B20A 3BU4A 3AGNA 1RGLA 1I70A 9RNTA 1RGKA 2RBIA 1I3IA 3A5EA 2F4YA 1BNEA 1Q9EA 3DH2A 5BU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3S A;  1BNI A;  2F5M A;  5GSP A;  4RNT A;  5RNT A;  1DE3 A;  1PYL A;  4J5G A;  1BNG A;  1FUS A;  3WR2 A;  1BU4 A;  1GMP A;  1RCK A;  1BRN L;  1BAO A;  1GMR A;  1BSA A;  6GSP A;  1BGS A;  1BIR A;  2KF4 A;  1I2E A;  2BIR A;  1RHL A;  3SYU A;  4BU4 A;  1BRK A;  3D5I A;  3D4A A;  1TTO A;  2F5W A;  4GSP A;  1RGH A;  1BSB A;  1GSP A;  4HOH A;  1FW7 A;  4BIR A;  1YNV X;  2KF3 A;  1DET A;  1RGE A;  7RNT A;  1IYY A;  1MGR A;  1BSC A;  1BNJ A;  1RCL A;  1SAR A;  1FZU A;  1MGW A;  1JBR A;  1BOX A;  1RGG A;  1T2H A;  1UCK A;  1BRH A;  1I2F A;  4GHO A;  1B2X A;  1BAN A;  1R4Y A;  1LNI A;  1C54 A;  1I2G A;  2AAE A;  1I8V A;  1GOV A;  1UCI A;  1G02 A;  1X1U A;  1I0X A;  3Q3F A;  3AHW A;  1LOY A;  1YGW A;  1TRP A;  1X1Y A;  1JBS A;  1RTU A;  1GOU A;  1RDS A;  2GSP A;  1BUJ A;  1T2I A;  2KF6 A;  1BNS A;  1A2P A;  1HZ1 A;  1RGC A;  1HYF A;  1B2Z A;  2SAR A;  2HOH A;  3KCH A;  4J5K A;  1BNR A;  4HAA A;  2KAA A;  3GSP A;  1ZGX A;  2C4B A;  6RNT A;  2RNT A;  8RNT A;  1RGA A;  3URP A;  2KF5 A;  5BIR A;  1CH0 A;  1JBT A;  1BRI A;  2F56 A;  3RNT A;  1BNF A;  1RNT A;  2BU4 A;  1B27 A;  1B2U A;  1I0V A;  1RN4 A;  1RMS A;  1UCJ A;  3DGY A;  1X1W A;  5HOH A;  1LOW A;  1RGF A;  3WHO A;  1I3F A;  1AY7 A;  1YVS A;  1GOY A;  1BRS A;  1RN1 A;  1PY3 A;  1RNB A;  1RSN A;  1B2M A;  1FUT A;  1AQZ A;  1X1X A;  1GMQ A;  1LOV A;  1BRJ A;  1BSD A;  2AAD A;  3AHS A;  1BSE A;  1TRQ A;  3D5G A;  2ZA4 A;  1B21 A;  1BRG A;  3AGO A;  1B2S A;  1UCL A;  3BIR A;  3HOH A;  1FYS A;  1RLS A;  7GSP A;  1BVI A;  1LRA A;  1B20 A;  3BU4 A;  3AGN A;  1RGL A;  1I70 A;  9RNT A;  1RGK A;  2RBI A;  1I3I A;  3A5E A;  2F4Y A;  1BNE A;  1Q9E A;  3DH2 A;  5BU4 A; 
#chains in the Genus database with same CATH topology
 4OVM A;  2R41 A;  1N9J A;  3K63 A;  4FCM A;  1K9M 4;  1DE3 A;  1JB4 A;  1BNG A;  2RCD A;  4J5G A;  1QAL A;  3J7Y d;  4IT7 A;  2BHM A;  2CX1 A;  3IPT A;  1BU4 A;  3KN4 A;  2CWV A;  3X3Y A;  1Q40 A;  3GAX A;  1BSA A;  5CF2 A;  1BGS A;  1BIR A;  3PYJ A;  3KKG A;  2BIR A;  3LTA A;  1R4C A;  1BRK A;  1SQW A;  4K61 A;  5EEO A;  3KE7 A;  1OGX A;  2GBX B;  1Q7H A;  2P0M A;  1IT7 A;  3B8L A;  3MSO A;  4GSP A;  1QMA A;  5AYR B;  4IIA A;  2P05 A;  3N9H A;  4HM8 B;  1GSP A;  1US1 A;  1STD A;  5EQL A;  1YNV X;  3T8N A;  1DET A;  1V58 A;  4HZ9 B;  2BT3 A;  5AIF A;  1YHQ 3;  1Q40 B;  1ULJ B;  1FGR A;  4KVH A;  4N6T A;  2C10 A;  1SAR A;  2QIY A;  3GZB A;  3HK4 A;  3K0Z A;  4O3V A;  1JBR A;  1BOX A;  1RGG A;  1CEW I;  1UCK A;  2K54 A;  4WYK A;  2B24 B;  1U5O A;  1VQ9 3;  3CD6 3;  1BAN A;  3CXC 2;  3FG4 A;  1M9G A;  3G0K A;  1VQM 3;  4HYZ A;  1R4Y A;  1UGI A;  7STD A;  1C54 A;  3ALA A;  3PZW A;  2AAE A;  2CK3 H;  3EBY A;  2W56 B;  1JKG A;  3NM2 A;  3Q2P A;  3Q90 A;  3WA3 A;  2BMO B;  3I55 3;  4ZM8 A;  1I0X A;  3BNC A;  3Q3F A;  1W4N A;  1ZX2 A;  4FCJ A;  2W2C A;  1Q86 4;  1RTU A;  4QWT A;  3JUN A;  1MWR A;  4WYK B;  3FG3 A;  4H61 A;  4CCV A;  3DXO A;  4X2H A;  5DRV A;  2HMK B;  3DM8 A;  5G1K A;  2CG1 A;  2KF6 A;  4RBN A;  1VQ6 3;  1HYF A;  3CC2 3;  4L8P A;  2XFT A;  1RRH A;  1Y4K A;  1DYU A;  3D9R A;  1JKG B;  1L5G B;  4HAA A;  2E2U A;  4ORL A;  1JN5 A;  2R4I A;  2C4B A;  3DGM A;  5TGN A;  2CFL A;  3MYT A;  2CC3 A;  3RDE A;  3H3H A;  3IJE B;  3D3L A;  2BO9 B;  2F86 B;  4N6M A;  2IMJ A;  4AKZ A;  1RNT A;  4MMY B;  2BNG A;  2O3O A;  3G8Z A;  3RGA A;  2CFK A;  4LGQ A;  5FW5 A;  1I0V A;  4WP5 A;  4K1V A;  4WFO A;  2K3D A;  1UI8 A;  2UX0 A;  4HVN A;  1X1W A;  3K7C A;  1JN5 B;  2WO0 A;  1RGF A;  3MPH A;  3CCS 3;  3V92 A;  1YVS A;  2E2T A;  1DMM A;  5BXQ A;  1PY3 A;  2D42 A;  2XGN A;  1RSN A;  1PFP A;  4JF8 A;  4EC6 A;  1AQZ A;  1X1X A;  3V98 A;  2E2V A;  3IMA B;  3EN8 A;  1BSD A;  3AHS A;  5IW9 A;  2UUG C;  1EA2 A;  4HM0 B;  2CHC A;  4NRE A;  3NBJ A;  2XRX B;  2ZDJ A;  3EHC A;  2P09 A;  4BL3 A;  2WGO A;  3CCR 3;  1KSI A;  1AVL A;  1A2V A;  3BIR A;  4N6U A;  1VQ8 3;  3JUQ A;  1T3B A;  1RJO A;  4O2H A;  3G71 3;  3BU4 A;  2UGI A;  3AGN A;  3HIG A;  4XB5 A;  1RGL A;  9RNT A;  3DGN A;  2F4Y A;  3GZX B;  2AAD A;  4KFF A;  1QJG A;  3HII A;  1GD4 A;  1B3S A;  1FGQ A;  2XF3 A;  2WOF A;  1QVG 2;  1KC8 4;  1BNI A;  3MWZ A;  1UW1 A;  2GU3 A;  5GSP A;  1Q81 4;  3FZW A;  2M7O A;  3UJM A;  1YI2 3;  3CCM 3;  3VF1 A;  3NXJ A;  3I56 3;  1YIT 3;  3AMO A;  2OOV C;  1PU4 A;  2IA7 A;  1BUQ A;  4L7K A;  5IEP A;  4WWU C;  3SYU A;  1OPY A;  4KT3 B;  1IQY A;  1FGT A;  3LTB A;  3D4A A;  3T8U A;  2F5W A;  4I4K A;  4KFD A;  3CCL 3;  2HML B;  2Y74 A;  4G1M B;  1MWS A;  4HOH A;  1FW7 A;  2KF3 A;  3FH1 A;  3G6E 3;  2RFR A;  1NNV A;  4IPB A;  2XFS A;  4TX4 A;  1G0T A;  4MJD A;  3EC9 A;  1MGR A;  3V99 A;  1M1K 4;  1G96 A;  1BNJ A;  1O7P B;  3AMO B;  1FZU A;  3MG2 A;  1Q82 4;  2XGL A;  4OUQ A;  3VGN A;  1OH0 A;  1D6U A;  1VQ7 3;  2OQE A;  4EV5 A;  3SOY A;  1VQ5 3;  3S67 A;  1YJW 3;  1U8C B;  1I2G A;  5M18 A;  5KP3 A;  4EW5 A;  1I8V A;  5JPP A;  3SLU A;  2QEX 3;  1G02 A;  2ZHX B;  3RGR A;  5HGR A;  2HMO B;  4CJN A;  1LOY A;  4DKI A;  1YGW A;  3UL6 A;  2YX9 A;  1LOX A;  4Q53 A;  3DUK A;  1C7H A;  1W2Z A;  3OWU A;  5AII A;  1UGH I;  1VQL 3;  4N6V 0;  3F40 A;  8CHO A;  1BNS A;  1K28 A;  1IQ8 A;  1NO3 A;  3HI7 A;  1IK3 A;  2YFI B;  1B2Z A;  2FNQ A;  3D79 A;  2Q07 A;  2SAR A;  4J5K A;  1GD3 A;  1MNL A;  1ZGX A;  3GSP A;  3LTD A;  3SOA A;  5I97 A;  1K73 4;  1VQK 3;  2KF5 A;  3PCR A;  3X42 A;  5D82 A;  1CH0 A;  1GY5 A;  2CFG A;  4HBR A;  4EV2 A;  1YJ9 3;  1BRI A;  3H51 A;  3RNT A;  2Z77 A;  1JJ2 2;  1ASK A;  1EG9 B;  2BU4 A;  1OGZ A;  1JRQ A;  1B2U A;  3F9S A;  3NQY A;  1LQM B;  1E97 A;  4HM4 B;  1UCJ A;  1ULI B;  3BNB A;  4NHF A;  2IUJ A;  2CX0 A;  4LSO A;  5IG0 A;  2O9U X;  3G4S 3;  1MWU A;  2IY2 A;  1RNB A;  1O7N B;  2L1S A;  1CYV A;  1STF I;  3E99 A;  3F8X A;  4CPK A;  3FCS B;  3K5T A;  1QVF 2;  3LH4 A;  1GS3 A;  3KSP A;  4MMX B;  1BRJ A;  1O7G B;  1BSE A;  2GBW B;  3D5G A;  2W04 A;  1O7M B;  1FGO A;  2W03 A;  3WMD A;  1V74 A;  3JUO A;  5IEN A;  1LVN A;  2I9W A;  3AGO A;  1NJI 4;  1DMN A;  3PCS A;  5AEW B;  3HOH A;  1W2B 2;  1F8N A;  1FYS A;  1LXE A;  7GSP A;  1AVK A;  3M8C A;  2L4V A;  1LRA A;  2ML5 A;  2WOH A;  1OHP A;  3ECF A;  3PGB A;  5KP1 A;  4N6O B;  3UL5 A;  3F7S A;  1W5Z A;  2RBI A;  1I3I A;  3KFQ C;  1N5P A;  3WOD G;  4RNZ A;  4HM6 B;  3DH2 A;  5BU4 A;  3DZL A;  1IVU A;  2IYJ A;  3UNL A;  5RNT A;  1PYL A;  3SX1 A;  5KP4 A;  1RKY A;  3LT8 A;  3WR2 A;  3NV0 A;  4R9K A;  1GMP A;  1TP6 A;  2OTL 3;  1BAO A;  1GMR A;  2B1X B;  6GSP A;  1A2K A;  2KF4 A;  2J8X B;  4O02 B;  3B4P A;  3CCJ 3;  1OHO A;  3FGY A;  2W9Q A;  3QRD A;  3S5C A;  3NQZ A;  3WDG B;  1RGH A;  2F99 A;  4BTW A;  1IT8 A;  1BSB A;  1LNH A;  1E3V A;  3F7X A;  3FG1 A;  2PZV A;  4X2O A;  4BIR A;  1HU9 A;  1ZS7 A;  3NV0 B;  4RNY A;  1NB3 I;  2W0Q A;  3BLZ A;  3KII A;  3UB1 A;  7RNT A;  3OX9 A;  1IYY A;  1IQX A;  1V57 A;  1W6Y A;  1BSC A;  4U13 A;  4KZ1 A;  1E3R A;  1MGW A;  3X3Z A;  5JBS A;  4LYL B;  3MG3 A;  3S28 A;  3HX8 A;  1I2F A;  1WTH A;  5STD A;  1TUH A;  4EBG A;  4BTX A;  1LQG C;  1DMQ A;  2Y73 A;  3DY5 A;  3WOE B;  1GY6 A;  1T5Y A;  1WMO A;  3N54 B;  2CWT A;  5CK6 A;  1W6G A;  4BTY A;  1YIJ 3;  4JRF A;  5LC7 A;  1KWI A;  2XSH B;  4RZM A;  4EXR A;  1QAF A;  3HZP A;  1S72 3;  1JB5 A;  1UCI A;  3LT9 A;  3F8H A;  4HJL B;  2XH9 A;  1W6C A;  2D1W A;  1S5A A;  4J8T A;  1D6Y A;  4R9L A;  4H3U A;  1X1Y A;  1ROA A;  1OCV A;  1GOU A;  2RGQ A;  2GSP A;  4HM2 B;  5JPU A;  1IDP A;  1BUJ A;  1TJD A;  2CH9 A;  3NM7 A;  1WMP A;  4CDL A;  2HOH A;  3JUM A;  1UDI I;  2QGU A;  3EJV A;  1OUN A;  4J9A A;  4XBY A;  8RNT A;  2BMQ B;  2RNT A;  2V1L A;  3EE1 A;  1IVX A;  1OHS A;  1RGA A;  2JDI H;  1SPU A;  3OV4 A;  3OWS A;  4KFE A;  5EVH A;  1OAC A;  3FKA A;  3URP A;  1W01 A;  5AI1 A;  3LTC A;  2RSX A;  3PS8 A;  1JBT A;  2HMJ B;  2OOV A;  2OTJ 3;  3N8B A;  2Z6B A;  1FA3 A;  2HMN B;  3MKI A;  4LZI A;  3F14 A;  4HM5 B;  1Z1S A;  3LML A;  1RMS A;  2QA4 3;  2LQV A;  4NPB A;  1VQO 3;  3CPO A;  5AIH A;  1A90 A;  1NU3 A;  1CYU A;  5HOH A;  1LOW A;  4MEI A;  1SII A;  4BL2 A;  3Q1C A;  4N3V A;  2PNC A;  3G16 A;  1GOY A;  1YJN 3;  3FSD A;  1VQN 3;  2STD A;  3WA2 X;  3OW2 2;  1MOL A;  2CW9 A;  4AKY A;  1TIJ A;  1FUT A;  1M90 4;  1B2M A;  4LEH A;  1EKM A;  1GMQ A;  2KXG A;  1LOV A;  2F98 A;  3LOY A;  4R80 A;  1VQ4 3;  1YGE A;  3SVA A;  3JVC A;  1B21 A;  4FMA A;  2IUK A;  3TDG A;  2YFL B;  1B2S A;  2P0X A;  1CQS A;  2CG0 A;  1EUI C;  5ELJ A;  2CIU A;  3GZR A;  2GEY A;  5ELU A;  3X41 A;  1N5H A;  2C11 A;  2KRT A;  4MMZ B;  2W56 A;  1I70 A;  1RGK A;  3ZFZ A;  3A5E A;  2LYX A;  1BNE A;  1Q9E A;  1JZD A;  4EYC A;  1VQP 3;  3OWY A;  3BNE A;  2KCD A;  3LYG A;  1TFO A;  2F5M A;  1MWT A;  4RNT A;  5CLK A;  3VSY A;  5IEO A;  4R4K A;  2HMM B;  3B7C A;  3SXX A;  1FUS A;  5IG3 A;  5IF6 A;  1N9E A;  2CFD A;  2ZL8 A;  3STD A;  1FGM A;  2MF7 A;  1M1X B;  3MG1 A;  1RCK A;  4LMI A;  1BRN L;  1VQQ A;  2ML6 A;  1KD1 4;  5D83 A;  4K90 B;  3O8Y A;  2CFW A;  1RN7 A;  1I2E A;  5CXO A;  1NWW A;  1RHL A;  3EF8 A;  3LXU X;  3LZA A;  1UUV B;  4BU4 A;  1YVB I;  3D5I A;  1WNH A;  1ROV A;  1TTO A;  3DGL A;  5IG5 A;  3B4O A;  3EBT A;  3CC4 3;  3CNM A;  3I0Y A;  3NBB A;  3NUV A;  2MC8 A;  3SED A;  2XEP A;  2BMR B;  1Q42 A;  2H0I A;  4ILF A;  4XBX A;  1ISK A;  1WQL B;  1RGE A;  3NBR A;  3ZG0 A;  4OK0 A;  1SJW A;  1RCL A;  1N8R 4;  1K8A 4;  2K0M A;  1IV7 A;  1N8Q A;  3CMA 3;  1GY7 A;  5AIG A;  3CNX A;  1DVC A;  1K41 A;  1T2H A;  1UUG B;  1BRH A;  1AV4 A;  2GU1 A;  4GHO A;  1B2X A;  4O8S A;  1ZO2 A;  2H0G A;  1FUW A;  3FF0 A;  4R1K A;  5G2G A;  1EEJ A;  1LNI A;  1TU5 A;  5CF1 A;  1W02 A;  4FR9 A;  5AYS C;  3X40 A;  1EQK A;  1AR0 A;  1W7C A;  1GOV A;  3BND A;  1OF5 A;  3S27 A;  1X1U A;  3FF2 A;  4L8O A;  2Z76 A;  3AHW A;  1DVD A;  1TRP A;  4FCZ A;  3CCV 3;  3CME 3;  1JBS A;  4AEQ A;  1RDS A;  2FGT A;  1IVV A;  3K9M C;  1UUW B;  1RRL A;  2YFJ B;  1JNQ A;  1T2I A;  4HM3 B;  4I5Q A;  1A2P A;  1HZ1 A;  1RGC A;  2GXF A;  2W9P A;  3GZY B;  3CC7 3;  5A0O B;  3KCH A;  4WHA A;  3BB9 A;  3U1W A;  2OWP A;  5D81 A;  3WOF B;  1BNR A;  2KAA A;  1VZZ A;  2W6J H;  1OF5 B;  1IVW A;  3FLJ A;  4N6N B;  4HM7 B;  6RNT A;  1KQS 2;  1UI7 A;  3DMC A;  4XM4 A;  1WMN A;  4STD A;  3ROB A;  1O7H B;  2F56 A;  2Z7A A;  4FMC A;  1BNF A;  4XBT A;  2FXT A;  1B27 A;  5LC6 A;  3GWR A;  1RN4 A;  1SIH A;  2JQ5 A;  3PXM A;  4PEJ A;  2CKF B;  1TFK A;  2INX A;  3DGY A;  5IG4 A;  3EX9 A;  3MHE A;  3WHO A;  4XDW A;  4XDV A;  3ER7 A;  3CCQ 3;  1AY7 A;  1I3F A;  4HZB B;  1O7W B;  1BRS A;  1RN1 A;  1W00 A;  1GYB A;  2CWU A;  3EN1 B;  1IV9 A;  2A15 A;  2H0H A;  1JB2 A;  2OCT A;  4GB5 A;  5DRE A;  3S29 A;  6STD A;  1JZO A;  1D6Z A;  3DGO A;  2GEX A;  3CCE 3;  1J2B A;  5BVB A;  2OQE C;  1NDO B;  3KZT A;  4FMB A;  3U97 A;  3CPW 2;  1NB5 I;  3NX0 A;  1TRQ A;  5AEU B;  2ZA4 A;  3A76 A;  3QK9 A;  5IER A;  3OXA A;  3GRD A;  3ZG5 A;  3CU3 A;  1BRG A;  1IU7 A;  2P38 A;  4HKV B;  3CCU 3;  3KSE D;  5G1L A;  1UCL A;  2SBL A;  4K1U A;  2XR8 B;  3NHX A;  4HM1 B;  2XSO B;  4N6L A;  1RLS A;  3EQQ B;  5M19 A;  1Q7Y 4;  1BVI A;  1JV2 B;  1B20 A;  1QAK A;  3L0R A;  1HKX A;  4GL6 A;  5FGO A;  2WGQ A;  3EB8 A;  5M1A A;  3JUP A;  3X3X A;  4FMD A;  1A67 A;  5BIR A;  3T0U A; 
#chains in the Genus database with same CATH homology
 1B3S A;  1BNI A;  2F5M A;  5GSP A;  4RNT A;  5RNT A;  1DE3 A;  1PYL A;  4J5G A;  1BNG A;  1FUS A;  3WR2 A;  1BU4 A;  1GMP A;  1RCK A;  1BRN L;  1BAO A;  1GMR A;  1BSA A;  6GSP A;  1BGS A;  1BIR A;  2KF4 A;  1I2E A;  2BIR A;  1RHL A;  3SYU A;  4BU4 A;  1BRK A;  3D5I A;  3D4A A;  1TTO A;  2F5W A;  4GSP A;  1RGH A;  1BSB A;  1GSP A;  4HOH A;  1FW7 A;  4BIR A;  1YNV X;  2KF3 A;  1DET A;  1RGE A;  7RNT A;  1IYY A;  1MGR A;  1BSC A;  1BNJ A;  1RCL A;  1SAR A;  1FZU A;  1MGW A;  1JBR A;  1BOX A;  1RGG A;  1T2H A;  1UCK A;  1BRH A;  1I2F A;  4GHO A;  1B2X A;  1BAN A;  1R4Y A;  1LNI A;  1C54 A;  1I2G A;  2AAE A;  1I8V A;  1GOV A;  1UCI A;  1G02 A;  1X1U A;  1I0X A;  3Q3F A;  3AHW A;  1LOY A;  1YGW A;  1TRP A;  1X1Y A;  1JBS A;  1RTU A;  1GOU A;  1RDS A;  2GSP A;  1BUJ A;  1T2I A;  2KF6 A;  1BNS A;  1A2P A;  1HZ1 A;  1RGC A;  1HYF A;  1B2Z A;  2SAR A;  2HOH A;  3KCH A;  4J5K A;  1BNR A;  4HAA A;  2KAA A;  3GSP A;  1ZGX A;  2C4B A;  6RNT A;  2RNT A;  8RNT A;  1RGA A;  3URP A;  2KF5 A;  5BIR A;  1CH0 A;  1JBT A;  1BRI A;  2F56 A;  3RNT A;  1BNF A;  1RNT A;  2BU4 A;  1B27 A;  1B2U A;  1I0V A;  1RN4 A;  1RMS A;  1UCJ A;  3DGY A;  1X1W A;  5HOH A;  1LOW A;  1RGF A;  3WHO A;  1I3F A;  1AY7 A;  1YVS A;  1GOY A;  1BRS A;  1RN1 A;  1PY3 A;  1RNB A;  1RSN A;  1B2M A;  1FUT A;  1AQZ A;  1X1X A;  1GMQ A;  1LOV A;  1BRJ A;  1BSD A;  2AAD A;  3AHS A;  1BSE A;  1TRQ A;  3D5G A;  2ZA4 A;  1B21 A;  1BRG A;  3AGO A;  1B2S A;  1UCL A;  3BIR A;  3HOH A;  1FYS A;  1RLS A;  7GSP A;  1BVI A;  1LRA A;  1B20 A;  3BU4 A;  3AGN A;  1RGL A;  1I70 A;  9RNT A;  1RGK A;  2RBI A;  1I3I A;  3A5E A;  2F4Y A;  1BNE A;  1Q9E A;  3DH2 A;  5BU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...