2W56B

Structure of the hypothetical protein vc0508 from vibrio cholerae vsp- ii pathogenicity island
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
131
Chain Sequence
TFTASSLPVSKKLHKLLSEQLTAHYLVFNFRDKSYSADEGGFHPVEMAICQTSTGEWSIEYITDFAYMGNYYPELERNLDFDFRVGQFFVAYRGWLPMQGSRDAKELYRLWESNFLAYVDMDAYNEIAITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VC0508
publication title Structure of the Hypothetical Protein Vc0508 from Vibrio Cholerae Vsp-II Pathogenicity Island
rcsb
source organism Vibrio cholerae
molecule tags Unknown function
total genus 33
structure length 131
sequence length 142
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10980 DUF2787 Protein of unknown function (DUF2787)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.430 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w56B00
2V1LA 2W56B 2W56A
chains in the Genus database with same CATH superfamily
1EKMA 1RNTA 1V57A 5D81A 1FUWA 1R4YA 3CCU3 1EUIC 1JRQA 5CF1A 3EQQB 1BRHA 1X1YA 3BNEA 1W02A 3DUKA 3GZRA 3GZYB 4K1VA 4R9LA 3X41A 3N8BA 5AIHA 2ML6A 1I0XA 3S29A 3SYUA 1JB2A 4HAAA 2F99A 1YI23 3NX0A 3ER7A 1Q824 5M18A 4JRFA 3X3ZA 1BIRA 5FW5A 3FH1A 4L7KA 3RGAA 5IF6A 2IMJA 1YIT3 1N5PA 3PZWA 1K8A4 4LGQA 2B1XB 3NV0A 3UNLA 4K90B 3X3XA 1LRAA 4N6V0 4DKIA 3BNCA 5DREA 1RKYA 3UB1A 1YJW3 1O7HB 4WYKA 4FCJA 1MGRA 2CHCA 1Q7Y4 1HU9A 4OK0A 3LZAA 1B2MA 2ZDJA 3LMLA 1RLSA 1ULJB 1RGCA 2QEX3 2W04A 1LOWA 1UW1A 2HMOB 1K9M4 2C4BA 3ALAA 3NHXA 3CNXA 1M9GA 2CK3H 1I2EA 4ILFA 5LC6A 1NNVA 5BVBA 1EQKA 1I0VA 3FF0A 5LC7A 2WO0A 3NV0B 3DMCA 4CCVA 1W7CA 3RNTA 2C10A 2WOFA 3URPA 2Z7AA 3WA2X 1BSCA 1A2KA 1BNEA 1I2GA 4WYKB 4X2OA 1V58A 3CC73 1JKGA 2Z76A 1BUJA 1DVDA 3WHOA 3KE7A 1GYBA 1VQP3 3OWUA 2IUKA 1TRPA 4HYZA 4IPBA 3S67A 5BU4A 2XFSA 1G02A 1O7GB 4N6UA 4HM1B 2O9UX 3EN1B 1KWIA 3Q2PA 1TIJA 3CD63 1BUQA 3UL6A 1TU5A 1RHLA 1ZO2A 3BNBA 3NBBA 3G6E3 3Q1CA 2XSHB 1D6ZA 3QK9A 4K61A 3LT9A 3U97A 3CC23 2K54A 2KAAA 1FUTA 1A67A 1JKGB 2BIRA 3KIIA 4XDVA 2INXA 5A0OB 3AMOA 3CNMA 2F5MA 1UCIA 5CF2A 3K63A 4GB5A 4OVMA 3CCQ3 3MYTA 3G16A 1GY5A 5EVHA 5CLKA 2OCTA 2ZL8A 3IPTA 4WP5A 1B2SA 1B2ZA 3ROBA 1JBTA 4N6NB 2W9QA 1BNGA 1WMNA 4BL2A 4KFFA 1DMMA 4LSOA 3CU3A 3SLUA 3K5TA 1IT7A 2CH9A 3PCSA 2SARA 5IEOA 3NBRA 1KC84 4EV2A 4R80A 3KKGA 1FYSA 1N5HA 4HBRA 2UX0A 3K0ZA 1UGHI 1ULIB 1VQN3 2IY2A 3SOYA 3JUQA 1PU4A 2P0MA 3AMOB 4MEIA 4RNZA 3LTCA 4L8OA 2OWPA 2XEPA 1OHSA 3B4PA 4N6TA 4IT7A 4KZ1A 5JPPA 1IQYA 2FXTA 1T5YA 1TTOA 1BU4A 1QVG2 2BMOB 4MMYB 1N8R4 3CPOA 2LYXA 3CCL3 4EV5A 1LQGC 2QIYA 3AGNA 3X3YA 4ZM8A 4I5QA 5BXQA 3L0RA 3GAXA 1NB5I 1W01A 1BRSA 1T2HA 3KSED 3EE1A 3G8ZA 5D82A 3F7SA 4QWTA 3NM7A 4WFOA 3DM8A 1GD3A 1RSNA 1ZGXA 3BU4A 1J2BA 5G2GA 4I4KA 4BTWA 3ZG5A 4H61A 2UGIA 2BT3A 1RGFA 1Z1SA 2BO9B 2W03A 1BSEA 1DVCA 1TRQA 3F9SA 1TFKA 1IYYA 1I3IA 2RCDA 5CXOA 6RNTA 1HZ1A 4FR9A 4EXRA 2BMQB 1IQ8A 2RSXA 3BLZA 2JDIH 3MPHA 3LYGA 1KD14 3JUPA 3EF8A 1GY6A 1VQQA 5AYRB 3CXC2 2P05A 3F8XA 3OX9A 2XH9A 2Y74A 4J9AA 4EC6A 1WMPA 3F40A 2STDA 3D3LA 1C54A 3N54B 2HOHA 1VQ73 2W9PA 4RNTA 3H3HA 4HJLB 4LEHA 1KSIA 2XR8B 3FSDA 5ELJA 1CEWI 2CC3A 1JV2B 1RGGA 5M1AA 1FW7A 3GWRA 3D4AA 3BB9A 3EHCA 3Q3FA 1U8CB 3VF1A 3LTBA 2CX0A 1B27A 4N6LA 3E99A 1E97A 1IK3A 4RBNA 2YFJB 3U1WA 3X42A 1IVVA 3JUNA 1CH0A 3EBYA 3HOHA 3KN4A 1S723 1VQ53 2L1SA 1OHPA 1ZS7A 1JZDA 1DMNA 2P0XA 3KZTA 1SARA 2H0IA 2MF7A 1AQZA 3EN8A 5IEPA 4BTYA 2Q07A 5IERA 1STFI 4HVNA 3MSOA 2CFGA 2GBWB 1QMAA 1NU3A 1VQM3 1RGKA 2UUGC 5AIFA 1BANA 1VQ83 4XM4A 1FGOA 4R1KA 2RNTA 3SEDA 5BIRA 2ZHXB 3FG3A 4L8PA 1YVBI 3IMAB 1RGLA 3FCSB 4HZBB 1RNBA 1B20A 1B2XA 4RNYA 1FA3A 2E2UA 3LT8A 1FGQA 1ZX2A 4J8TA 2HMNB 4HM6B 1BRJA 1GOYA 1W4NA 1VQL3 2BU4A 1BSAA 2XRXB 1NJI4 2BNGA 4LZIA 2Z6BA 2W0QA 1DYUA 1TP6A 1WMOA 2HMLB 3IJEB 1W2B2 1GOVA 1SIIA 3OV4A 3WA3A 4FMDA 5JPUA 2F86B 2I9WA 5AEUB 4EBGA 1ROAA 2F56A 2J8XB 1NO3A 1JJ22 1VQO3 4KT3B 4R9KA 3KSPA 5HOHA 4KFEA 1M1K4 2CFLA 3X40A 4CPKA 1WNHA 1RGHA 1BNJA 1I8VA 3JVCA 3M8CA 3S27A 5TGNA 1D6UA 4BL3A 1FGRA 4HZ9B 5IG0A 1NDOB 2GU1A 3WMDA 2W2CA 2P38A 1PYLA 1GMRA 1VZZA 4HM8B 3HK4A 2L4VA 3HX8A 2OQEC 3I0YA 1UDII 4HOHA 4OUQA 5G1KA 4K1UA 5IG4A 1TJDA 2KF6A 2OTJ3 1RGAA 1T3BA 1UCJA 3T8NA 4Q53A 2GBXB 3SVAA 3DGMA 3B4OA 1B2UA 1CQSA 1QAKA 3AHWA 1MNLA 1Q864 2KF5A 1IV7A 1EEJA 3MG2A 1RCLA 1RN4A 2XFTA 1JB5A 3D5IA 2CFKA 3NXJA 1NWWA 3CMA3 1O7MB 2B24B 4WHAA 1RN7A 3N9HA 1MGWA 3A5EA 1GY7A 1UUWB 1Y4KA 3G713 1OGZA 1VQ63 2PNCA 4AKZA 1CYVA 2YFIB 3LOYA 3VGNA 4O3VA 1ROVA 4STDA 1O7PB 2MC8A 1D6YA 1BAOA 1W6YA 1O7NB 3CCE3 3G4S3 1KQS2 2KF4A 6STDA 1VQK3 3DXOA 4RZMA 2IUJA 2GEXA 3PGBA 2GU3A 1SIHA 2CFWA 3T8UA 3FG1A 2F4YA 3CCV3 1BNFA 3NUVA 2Y73A 1PY3A 4XBTA 1BOXA 3WOFB 3DY5A 1YIJ3 2Z77A 3HIIA 2RBIA 1B3SA 3MG1A 1YJ93 3CC43 1NB3I 1Q7HA 3OWSA 5I97A 1BNIA 1YHQ3 3FZWA 4HM2B 5CK6A 3GSPA 1VQ93 3D9RA 4TX4A 1OGXA 3PYJA 7STDA 5AIIA 1BRKA 3STDA 3CCM3 1BRIA 3BIRA 2E2TA 3V99A 2K0MA 3MKIA 1IVWA 1WTHA 1X1UA 1RRHA 1OHOA 3F8HA 3H51A 1UI8A 3HZPA 1AVKA 1GMPA 3DZLA 1SPUA 4HM0B 5KP3A 1N9EA 2GXFA 1OF5A 4J5KA 3EB8A 1BNSA 3SX1A 1CYUA 1MOLA 2CWUA 2XGLA 2GSPA 3OW22 2LQVA 1OPYA 3GZXB 3Q90A 3CCJ3 1UCKA 1X1WA 1EG9B 1R4CA 2CW9A 3AGOA 3NQYA 3A76A 1N8QA 2RGQA 1TFOA 3SXXA 2ML5A 4CDLA 2YX9A 3EX9A 4NHFA 3V98A 3J7Yd 1BSDA 4LYLB 2XGNA 5EQLA 4MJDA 1FUSA 3SOAA 5KP4A 1OF5B 5RNTA 3UL5A 3LH4A 3DGNA 4J5GA 2BHMA 3LXUX 4BIRA 1V74A 1HYFA 2OQEA 1W2ZA 2W56A 1B21A 3QRDA 4JF8A 3G0KA 2BMRB 1ASKA 3LTAA 4G1MB 4BU4A 4AEQA 3DGOA 3GRDA 1LOYA 1OACA 4XBXA 1G0TA 6GSPA 1QAFA 1M1XB 1JZOA 2F5WA 1VQ43 1OUNA 2H0GA 1FGMA 2RFRA 3EJVA 4HM3B 4NPBA 3V92A 2OOVC 2F98A 1IV9A 2WGOA 1MWSA 1UUGB 3FGYA 3S28A 2FGTA 1JN5A 3NQZA 2W56B 2QA43 1GD4A 2GEYA 4U13A 1A2VA 4MMZB 1MWRA 1AV4A 4GL6A 1JBSA 3DGYA 3B8LA 1I3FA 8CHOA 1Q42A 1QVF2 2D1WA 1A90A 3T0UA 3KFQC 3HIGA 3WDGB 1JNQA 4ORLA 1FZUA 2CWVA 1MWTA 3S5CA 4XBYA 2WOHA 3GZBA 4O8SA 3MWZA 4WWUC 3CPW2 3PXMA 3LTDA 1YGWA 1JN5B 2M7OA 4KFDA 9RNTA 3MHEA 1IVXA 1IQXA 3RDEA 1K41A 3EBTA 1C7HA 4X2HA 5STDA 1BGSA 1BNRA 4AKYA 1DE3A 1BRGA 2CWTA 4HM4B 1S5AA 1JBRA 3DGLA 4FCZA 5AI1A 1LNHA 1UUVB 1LVNA 1QJGA 1RJOA 2HMJB 1EA2A 1GSPA 7RNTA 4FMAA 1LOXA 3VSYA 1BSBA 2IYJA 1OH0A 3FLJA 1RN1A 2WGQA 3D79A 2XF3A 5FGOA 5ELUA 7GSPA 8RNTA 1K28A 1BVIA 1GS3A 2P09A 2W6JH 2KRTA 3F7XA 1F8NA 3DH2A 4O02B 2CKFB 4PEJA 3WODG 1IDPA 4FMBA 3TDGA 5KP1A 1I2FA 1Q9EA 3FG4A 4IIAA 3WOEB 1E3VA 2H0HA 2KXGA 1AVLA 1HKXA 1FGTA 3EC9A 4NREA 1SJWA 3CME3 2FNQA 3F14A 3FF2A 5IENA 2HMKB 1US1A 5GSPA 4HM7B 1Q40A 1GMQA 3NBJA 1DMQA 1L5GB 3JUOA 2CIUA 1YVSA 3NM2A 3WR2A 1N9JA 2E2VA 2JQ5A 2PZVA 4GSPA 5EEOA 5JBSA 1UCLA 1LXEA 1IT8A 1GOUA 2QGUA 3KCHA 2IA7A 1RMSA 1RDSA 5AIGA 2AAEA 4MMXB 1RTUA 4CJNA 1LOVA 5DRVA 1RRLA 3ZG0A 1PFPA 2CX1A 2ZA4A 4O2HA 3B7CA 3BNDA 3I553 1TUHA 2A15A 5G1LA 1G96A 1U5OA 1RGEA 1WQLB 3D5GA 5M19A 1IU7A 2C11A 1Q40B 3MG3A 4GHOA 1A2PA 2AADA 4H3UA 3UJMA 2R4IA 1YJN3 1AR0A 2OOVA 4HM5B 1IVUA 2XSOB 1Q814 2R41A 1JB4A 3HI7A 5AYSC 3ZFZA 1I70A 1LNIA 3PS8A 4HKVB 3PCRA 2KCDA 5IW9A 4FMCA 4R4KA 5HGRA 3CCR3 1W00A 1SQWA 4FCMA 1YNVX 3RGRA 3K9MC 5IG5A 1DETA 1X1XA 2OTL3 1W6GA 1QALA 1E3RA 1STDA 1W6CA 2CFDA 2HMMB 2KF3A 3ECFA 2YFLB 3OXAA 4KVHA 1K734 2K3DA 4N6OB 4LMIA 4N3VA 4BTXA 1UGIA 1MWUA 2CG1A 1M904 1UI7A 4XB5A 1ISKA 3JUMA 2V1LA 3OWYA 4N6MA 1BRNL 2O3OA 1LQMB 1T2IA 1AY7A 3FKAA 4EW5A 1O7WB 4EYCA 3I563 1YGEA 3AHSA 4XDWA 3K7CA 2CG0A 1OCVA 2D42A 1RCKA 5D83A 3CCS3 3O8YA 2SBLA 5IG3A 1W5ZA 5AEWB
chains in the Genus database with same CATH topology
1EKMA 1FUWA 5D81A 3CCU3 1JRQA 5CF1A 3EQQB 3DUKA 3BNEA 3GZRA 1W02A 3GZYB 4K1VA 3X41A 5BXQA 3N8BA 5AIHA 2ML6A 3S29A 1JB2A 2F99A 1YI23 3NX0A 3ER7A 1Q824 4JRFA 3X3ZA 5IF6A 5FW5A 3FH1A 4L7KA 3RGAA 2IMJA 1YIT3 1N5PA 3PZWA 1K8A4 4LGQA 2B1XB 3NV0A 3UNLA 4K90B 3X3XA 4N6V0 3BNCA 5DREA 1RKYA 3UB1A 1YJW3 1O7HB 4WYKA 4FCJA 1Q7Y4 2CHCA 1HU9A 4OK0A 3LZAA 2ZDJA 3LMLA 1ULJB 2QEX3 2W04A 1UW1A 2HMOB 1K9M4 3NHXA 3ALAA 3CNXA 1M9GA 2CK3H 5LC6A 1EQKA 5BVBA 3FF0A 5LC7A 2WO0A 3NV0B 3DMCA 4CCVA 1W7CA 2C10A 2WOFA 2Z7AA 3WA2X 1A2KA 4X2OA 4WYKB 3CC73 1JKGA 2Z76A 1DVDA 3KE7A 1GYBA 1VQP3 3OWUA 2IUKA 4HYZA 4IPBA 3S67A 2XFSA 1O7GB 4N6UA 4HM1B 2O9UX 3EN1B 1KWIA 3Q2PA 1TIJA 3CD63 1BUQA 3UL6A 1TU5A 3BNBA 1ZO2A 3NBBA 3G6E3 3Q1CA 2XSHB 1D6ZA 3QK9A 4K61A 3LT9A 3U97A 3CC23 2K54A 1A67A 1JKGB 3KIIA 4XDVA 2INXA 5A0OB 3AMOA 3CNMA 5CF2A 3CCQ3 3K63A 4GB5A 4OVMA 3MYTA 3G16A 1GY5A 5EVHA 5CLKA 2OCTA 2ZL8A 3IPTA 4WP5A 3ROBA 4N6NB 2W9QA 1WMNA 4KFFA 1DMMA 4LSOA 3CU3A 3SLUA 3K5TA 1IT7A 2CH9A 3PCSA 1KC84 5IEOA 3NBRA 4EV2A 4R80A 3KKGA 1N5HA 4HBRA 2UX0A 3K0ZA 1ULIB 1VQN3 3SOYA 3JUQA 1PU4A 2P0MA 3AMOB 4MEIA 4RNZA 3LTCA 4L8OA 2OWPA 2XEPA 1OHSA 3B4PA 4N6TA 4IT7A 4KZ1A 5JPPA 1IQYA 2FXTA 1T5YA 1QVG2 2BMOB 4MMYB 1N8R4 3CPOA 2LYXA 3CCL3 4EV5A 2QIYA 3X3YA 4ZM8A 3L0RA 3GAXA 1NB5I 1W01A 3KSED 3EE1A 3G8ZA 5D82A 3F7SA 4QWTA 3NM7A 4WFOA 3DM8A 1GD3A 1J2BA 5G2GA 4I4KA 4BTWA 4H61A 2BT3A 1Z1SA 2BO9B 2W03A 1DVCA 3F9SA 1TFKA 2RCDA 5CXOA 4FR9A 4EXRA 2BMQB 1IQ8A 2RSXA 3BLZA 2JDIH 3MPHA 3LYGA 1KD14 3JUPA 3EF8A 1GY6A 5AYRB 3CXC2 2P05A 3F8XA 3OX9A 2XH9A 2Y74A 4J9AA 4EC6A 1WMPA 3F40A 2STDA 3D3LA 3N54B 1VQ73 2W9PA 3H3HA 4HJLB 4LEHA 1KSIA 2XR8B 3FSDA 5ELJA 1CEWI 2CC3A 1JV2B 3GWRA 3BB9A 3EHCA 1U8CB 3VF1A 3LTBA 4N6LA 3E99A 1E97A 1IK3A 4RBNA 2YFJB 3U1WA 3X42A 1IVVA 3JUNA 3EBYA 3KN4A 1S723 1VQ53 1OHPA 1DMNA 2P0XA 3KZTA 2MF7A 3EN8A 5IEPA 4BTYA 2Q07A 5IERA 1STFI 4HVNA 3MSOA 2CFGA 2GBWB 1QMAA 1NU3A 1VQM3 5AIFA 1VQ83 4XM4A 1FGOA 4R1KA 3SEDA 4L8PA 3FG3A 1YVBI 3IMAB 4HZBB 3FCSB 4RNYA 1FA3A 2E2UA 3LT8A 1FGQA 1ZX2A 4J8TA 2HMNB 4HM6B 1W4NA 1VQL3 1NJI4 2XRXB 2BNGA 4LZIA 2Z6BA 2W0QA 1DYUA 1TP6A 1WMOA 2HMLB 3IJEB 1W2B2 1SIIA 3OV4A 3WA3A 4FMDA 5JPUA 2F86B 2I9WA 5AEUB 4EBGA 1ROAA 1NO3A 1JJ22 1VQO3 4R9KA 3KSPA 4KFEA 1M1K4 2CFLA 3X40A 1WNHA 3M8CA 3JVCA 3S27A 5TGNA 1D6UA 1FGRA 4HZ9B 5IG0A 1NDOB 2GU1A 3WMDA 2W2CA 2P38A 1VZZA 4HM8B 3HK4A 2L4VA 3HX8A 2OQEC 3I0YA 4OUQA 5IG4A 4K1UA 2OTJ3 3T8NA 4Q53A 2GBXB 3SVAA 3DGMA 3B4OA 1CQSA 1QAKA 1Q864 1MNLA 1IV7A 3MG2A 3NXJA 2XFTA 1JB5A 2CFKA 1NWWA 3CMA3 1O7MB 2B24B 4WHAA 1RN7A 3N9HA 1VQ63 1GY7A 1UUWB 1Y4KA 3G713 1OGZA 2PNCA 4AKZA 1CYVA 2YFIB 3LOYA 3VGNA 4O3VA 1ROVA 4STDA 1O7PB 2MC8A 1D6YA 1W6YA 1O7NB 3CCE3 3G4S3 1KQS2 6STDA 1VQK3 3DXOA 4RZMA 2IUJA 2GEXA 3PGBA 2GU3A 1SIHA 2CFWA 3T8UA 3FG1A 3CCV3 3NUVA 2Y73A 4XBTA 3WOFB 3DY5A 1YIJ3 2Z77A 3HIIA 3MG1A 1YJ93 3CC43 1NB3I 3OWSA 5I97A 1YHQ3 3FZWA 4HM2B 5CK6A 1VQ93 3D9RA 4TX4A 1OGXA 3PYJA 7STDA 5AIIA 3STDA 3CCM3 2E2TA 3V99A 2K0MA 3MKIA 1IVWA 1WTHA 1RRHA 1OHOA 3F8HA 3H51A 1UI8A 3HZPA 1AVKA 3DZLA 1SPUA 4HM0B 5KP3A 1N9EA 2GXFA 1OF5A 3EB8A 3SX1A 1CYUA 1MOLA 2CWUA 2XGLA 3OW22 2LQVA 1OPYA 3GZXB 3Q90A 3CCJ3 2CW9A 3NQYA 1EG9B 1R4CA 3A76A 1N8QA 2RGQA 1TFOA 3SXXA 2ML5A 4CDLA 2YX9A 3EX9A 4NHFA 3V98A 3J7Yd 2XGNA 5EQLA 4MJDA 5KP4A 3SOAA 1OF5B 3UL5A 3LH4A 3DGNA 2BHMA 3LXUX 1V74A 2OQEA 1W2ZA 2W56A 3QRDA 4JF8A 3G0KA 2BMRB 1ASKA 3LTAA 4G1MB 4AEQA 3DGOA 3GRDA 1OACA 4XBXA 1QAFA 1M1XB 1VQ43 1OUNA 2RFRA 1FGMA 3EJVA 4HM3B 3V92A 2OOVC 2F98A 1IV9A 2WGOA 3S28A 3FGYA 2FGTA 1JN5A 3NQZA 2W56B 2QA43 1GD4A 2GEYA 4U13A 1A2VA 4MMZB 1AV4A 4GL6A 3B8LA 8CHOA 1Q42A 1QVF2 2D1WA 1A90A 3T0UA 3KFQC 3HIGA 3WDGB 1JNQA 4ORLA 2CWVA 3S5CA 4XBYA 2WOHA 3GZBA 4O8SA 3MWZA 4WWUC 3CPW2 3PXMA 3LTDA 1JN5B 2M7OA 4KFDA 3MHEA 1IVXA 1IQXA 3RDEA 1K41A 3EBTA 1C7HA 4X2HA 5STDA 4AKYA 2CWTA 4HM4B 1S5AA 3DGLA 4FCZA 5AI1A 1LNHA 1UUVB 1LVNA 1QJGA 1RJOA 2HMJB 1EA2A 4FMAA 1LOXA 3VSYA 1OH0A 3FLJA 2WGQA 2XF3A 5FGOA 5ELUA 1K28A 2W6JH 1GS3A 2P09A 3F7XA 2KRTA 4O02B 1F8NA 4PEJA 4R9LA 2CKFB 3WODG 1IDPA 4FMBA 3TDGA 5KP1A 3FG4A 4IIAA 3WOEB 1E3VA 2KXGA 1AVLA 1HKXA 1FGTA 3EC9A 4NREA 1SJWA 3CME3 2FNQA 3F14A 3FF2A 5IENA 2HMKB 1US1A 4HM7B 1Q40A 3NBJA 1DMQA 1L5GB 3JUOA 2CIUA 3NM2A 1N9JA 2E2VA 2JQ5A 2PZVA 5EEOA 5JBSA 1LXEA 1IT8A 2QGUA 2IA7A 5AIGA 4MMXB 5DRVA 1RRLA 1PFPA 4O2HA 3B7CA 3BNDA 3I553 1TUHA 2A15A 1G96A 1U5OA 1WQLB 1IU7A 2C11A 1Q40B 3MG3A 4H3UA 3UJMA 2R4IA 1YJN3 1AR0A 2OOVA 4HM5B 1IVUA 2XSOB 1Q814 1JB4A 3HI7A 5AYSC 3PS8A 4HKVB 3PCRA 2KCDA 5IW9A 4FMCA 4R4KA 5HGRA 3CCR3 1W00A 1SQWA 4FCMA 3RGRA 3K9MC 5IG5A 2OTL3 1W6GA 1QALA 1E3RA 1STDA 1W6CA 2CFDA 2HMMB 3ECFA 2YFLB 3OXAA 4KVHA 1K734 4N6OB 4LMIA 4N3VA 4BTXA 2CG1A 1M904 1UI7A 4XB5A 1ISKA 3JUMA 2V1LA 3OWYA 4N6MA 2O3OA 3FKAA 1O7WB 4EYCA 3I563 1YGEA 4XDWA 3K7CA 2CG0A 1OCVA 2D42A 3CCS3 5D83A 3O8YA 2SBLA 5IG3A 1W5ZA 5AEWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1L A;  2W56 B;  2W56 A; 
#chains in the Genus database with same CATH topology
 1EKM A;  1RNT A;  1V57 A;  5D81 A;  1FUW A;  1R4Y A;  3CCU 3;  1EUI C;  1JRQ A;  5CF1 A;  3EQQ B;  1BRH A;  1X1Y A;  3BNE A;  1W02 A;  3DUK A;  3GZR A;  3GZY B;  4K1V A;  4R9L A;  3X41 A;  3N8B A;  5AIH A;  2ML6 A;  1I0X A;  3S29 A;  3SYU A;  1JB2 A;  4HAA A;  2F99 A;  1YI2 3;  3NX0 A;  3ER7 A;  1Q82 4;  5M18 A;  4JRF A;  3X3Z A;  1BIR A;  5FW5 A;  3FH1 A;  4L7K A;  3RGA A;  5IF6 A;  2IMJ A;  1YIT 3;  1N5P A;  3PZW A;  1K8A 4;  4LGQ A;  2B1X B;  3NV0 A;  3UNL A;  4K90 B;  3X3X A;  1LRA A;  4N6V 0;  4DKI A;  3BNC A;  5DRE A;  1RKY A;  3UB1 A;  1YJW 3;  1O7H B;  4WYK A;  4FCJ A;  1MGR A;  2CHC A;  1Q7Y 4;  1HU9 A;  4OK0 A;  3LZA A;  1B2M A;  2ZDJ A;  3LML A;  1RLS A;  1ULJ B;  1RGC A;  2QEX 3;  2W04 A;  1LOW A;  1UW1 A;  2HMO B;  1K9M 4;  2C4B A;  3ALA A;  3NHX A;  3CNX A;  1M9G A;  2CK3 H;  1I2E A;  4ILF A;  5LC6 A;  1NNV A;  5BVB A;  1EQK A;  1I0V A;  3FF0 A;  5LC7 A;  2WO0 A;  3NV0 B;  3DMC A;  4CCV A;  1W7C A;  3RNT A;  2C10 A;  2WOF A;  3URP A;  2Z7A A;  3WA2 X;  1BSC A;  1A2K A;  1BNE A;  1I2G A;  4WYK B;  4X2O A;  1V58 A;  3CC7 3;  1JKG A;  2Z76 A;  1BUJ A;  1DVD A;  3WHO A;  3KE7 A;  1GYB A;  1VQP 3;  3OWU A;  2IUK A;  1TRP A;  4HYZ A;  4IPB A;  3S67 A;  5BU4 A;  2XFS A;  1G02 A;  1O7G B;  4N6U A;  4HM1 B;  2O9U X;  3EN1 B;  1KWI A;  3Q2P A;  1TIJ A;  3CD6 3;  1BUQ A;  3UL6 A;  1TU5 A;  1RHL A;  1ZO2 A;  3BNB A;  3NBB A;  3G6E 3;  3Q1C A;  2XSH B;  1D6Z A;  3QK9 A;  4K61 A;  3LT9 A;  3U97 A;  3CC2 3;  2K54 A;  2KAA A;  1FUT A;  1A67 A;  1JKG B;  2BIR A;  3KII A;  4XDV A;  2INX A;  5A0O B;  3AMO A;  3CNM A;  2F5M A;  1UCI A;  5CF2 A;  3K63 A;  4GB5 A;  4OVM A;  3CCQ 3;  3MYT A;  3G16 A;  1GY5 A;  5EVH A;  5CLK A;  2OCT A;  2ZL8 A;  3IPT A;  4WP5 A;  1B2S A;  1B2Z A;  3ROB A;  1JBT A;  4N6N B;  2W9Q A;  1BNG A;  1WMN A;  4BL2 A;  4KFF A;  1DMM A;  4LSO A;  3CU3 A;  3SLU A;  3K5T A;  1IT7 A;  2CH9 A;  3PCS A;  2SAR A;  5IEO A;  3NBR A;  1KC8 4;  4EV2 A;  4R80 A;  3KKG A;  1FYS A;  1N5H A;  4HBR A;  2UX0 A;  3K0Z A;  1UGH I;  1ULI B;  1VQN 3;  2IY2 A;  3SOY A;  3JUQ A;  1PU4 A;  2P0M A;  3AMO B;  4MEI A;  4RNZ A;  3LTC A;  4L8O A;  2OWP A;  2XEP A;  1OHS A;  3B4P A;  4N6T A;  4IT7 A;  4KZ1 A;  5JPP A;  1IQY A;  2FXT A;  1T5Y A;  1TTO A;  1BU4 A;  1QVG 2;  2BMO B;  4MMY B;  1N8R 4;  3CPO A;  2LYX A;  3CCL 3;  4EV5 A;  1LQG C;  2QIY A;  3AGN A;  3X3Y A;  4ZM8 A;  4I5Q A;  5BXQ A;  3L0R A;  3GAX A;  1NB5 I;  1W01 A;  1BRS A;  1T2H A;  3KSE D;  3EE1 A;  3G8Z A;  5D82 A;  3F7S A;  4QWT A;  3NM7 A;  4WFO A;  3DM8 A;  1GD3 A;  1RSN A;  1ZGX A;  3BU4 A;  1J2B A;  5G2G A;  4I4K A;  4BTW A;  3ZG5 A;  4H61 A;  2UGI A;  2BT3 A;  1RGF A;  1Z1S A;  2BO9 B;  2W03 A;  1BSE A;  1DVC A;  1TRQ A;  3F9S A;  1TFK A;  1IYY A;  1I3I A;  2RCD A;  5CXO A;  6RNT A;  1HZ1 A;  4FR9 A;  4EXR A;  2BMQ B;  1IQ8 A;  2RSX A;  3BLZ A;  2JDI H;  3MPH A;  3LYG A;  1KD1 4;  3JUP A;  3EF8 A;  1GY6 A;  1VQQ A;  5AYR B;  3CXC 2;  2P05 A;  3F8X A;  3OX9 A;  2XH9 A;  2Y74 A;  4J9A A;  4EC6 A;  1WMP A;  3F40 A;  2STD A;  3D3L A;  1C54 A;  3N54 B;  2HOH A;  1VQ7 3;  2W9P A;  4RNT A;  3H3H A;  4HJL B;  4LEH A;  1KSI A;  2XR8 B;  3FSD A;  5ELJ A;  1CEW I;  2CC3 A;  1JV2 B;  1RGG A;  5M1A A;  1FW7 A;  3GWR A;  3D4A A;  3BB9 A;  3EHC A;  3Q3F A;  1U8C B;  3VF1 A;  3LTB A;  2CX0 A;  1B27 A;  4N6L A;  3E99 A;  1E97 A;  1IK3 A;  4RBN A;  2YFJ B;  3U1W A;  3X42 A;  1IVV A;  3JUN A;  1CH0 A;  3EBY A;  3HOH A;  3KN4 A;  1S72 3;  1VQ5 3;  2L1S A;  1OHP A;  1ZS7 A;  1JZD A;  1DMN A;  2P0X A;  3KZT A;  1SAR A;  2H0I A;  2MF7 A;  1AQZ A;  3EN8 A;  5IEP A;  4BTY A;  2Q07 A;  5IER A;  1STF I;  4HVN A;  3MSO A;  2CFG A;  2GBW B;  1QMA A;  1NU3 A;  1VQM 3;  1RGK A;  2UUG C;  5AIF A;  1BAN A;  1VQ8 3;  4XM4 A;  1FGO A;  4R1K A;  2RNT A;  3SED A;  5BIR A;  2ZHX B;  3FG3 A;  4L8P A;  1YVB I;  3IMA B;  1RGL A;  3FCS B;  4HZB B;  1RNB A;  1B20 A;  1B2X A;  4RNY A;  1FA3 A;  2E2U A;  3LT8 A;  1FGQ A;  1ZX2 A;  4J8T A;  2HMN B;  4HM6 B;  1BRJ A;  1GOY A;  1W4N A;  1VQL 3;  2BU4 A;  1BSA A;  2XRX B;  1NJI 4;  2BNG A;  4LZI A;  2Z6B A;  2W0Q A;  1DYU A;  1TP6 A;  1WMO A;  2HML B;  3IJE B;  1W2B 2;  1GOV A;  1SII A;  3OV4 A;  3WA3 A;  4FMD A;  5JPU A;  2F86 B;  2I9W A;  5AEU B;  4EBG A;  1ROA A;  2F56 A;  2J8X B;  1NO3 A;  1JJ2 2;  1VQO 3;  4KT3 B;  4R9K A;  3KSP A;  5HOH A;  4KFE A;  1M1K 4;  2CFL A;  3X40 A;  4CPK A;  1WNH A;  1RGH A;  1BNJ A;  1I8V A;  3JVC A;  3M8C A;  3S27 A;  5TGN A;  1D6U A;  4BL3 A;  1FGR A;  4HZ9 B;  5IG0 A;  1NDO B;  2GU1 A;  3WMD A;  2W2C A;  2P38 A;  1PYL A;  1GMR A;  1VZZ A;  4HM8 B;  3HK4 A;  2L4V A;  3HX8 A;  2OQE C;  3I0Y A;  1UDI I;  4HOH A;  4OUQ A;  5G1K A;  4K1U A;  5IG4 A;  1TJD A;  2KF6 A;  2OTJ 3;  1RGA A;  1T3B A;  1UCJ A;  3T8N A;  4Q53 A;  2GBX B;  3SVA A;  3DGM A;  3B4O A;  1B2U A;  1CQS A;  1QAK A;  3AHW A;  1MNL A;  1Q86 4;  2KF5 A;  1IV7 A;  1EEJ A;  3MG2 A;  1RCL A;  1RN4 A;  2XFT A;  1JB5 A;  3D5I A;  2CFK A;  3NXJ A;  1NWW A;  3CMA 3;  1O7M B;  2B24 B;  4WHA A;  1RN7 A;  3N9H A;  1MGW A;  3A5E A;  1GY7 A;  1UUW B;  1Y4K A;  3G71 3;  1OGZ A;  1VQ6 3;  2PNC A;  4AKZ A;  1CYV A;  2YFI B;  3LOY A;  3VGN A;  4O3V A;  1ROV A;  4STD A;  1O7P B;  2MC8 A;  1D6Y A;  1BAO A;  1W6Y A;  1O7N B;  3CCE 3;  3G4S 3;  1KQS 2;  2KF4 A;  6STD A;  1VQK 3;  3DXO A;  4RZM A;  2IUJ A;  2GEX A;  3PGB A;  2GU3 A;  1SIH A;  2CFW A;  3T8U A;  3FG1 A;  2F4Y A;  3CCV 3;  1BNF A;  3NUV A;  2Y73 A;  1PY3 A;  4XBT A;  1BOX A;  3WOF B;  3DY5 A;  1YIJ 3;  2Z77 A;  3HII A;  2RBI A;  1B3S A;  3MG1 A;  1YJ9 3;  3CC4 3;  1NB3 I;  1Q7H A;  3OWS A;  5I97 A;  1BNI A;  1YHQ 3;  3FZW A;  4HM2 B;  5CK6 A;  3GSP A;  1VQ9 3;  3D9R A;  4TX4 A;  1OGX A;  3PYJ A;  7STD A;  5AII A;  1BRK A;  3STD A;  3CCM 3;  1BRI A;  3BIR A;  2E2T A;  3V99 A;  2K0M A;  3MKI A;  1IVW A;  1WTH A;  1X1U A;  1RRH A;  1OHO A;  3F8H A;  3H51 A;  1UI8 A;  3HZP A;  1AVK A;  1GMP A;  3DZL A;  1SPU A;  4HM0 B;  5KP3 A;  1N9E A;  2GXF A;  1OF5 A;  4J5K A;  3EB8 A;  1BNS A;  3SX1 A;  1CYU A;  1MOL A;  2CWU A;  2XGL A;  2GSP A;  3OW2 2;  2LQV A;  1OPY A;  3GZX B;  3Q90 A;  3CCJ 3;  1UCK A;  1X1W A;  1EG9 B;  1R4C A;  2CW9 A;  3AGO A;  3NQY A;  3A76 A;  1N8Q A;  2RGQ A;  1TFO A;  3SXX A;  2ML5 A;  4CDL A;  2YX9 A;  3EX9 A;  4NHF A;  3V98 A;  3J7Y d;  1BSD A;  4LYL B;  2XGN A;  5EQL A;  4MJD A;  1FUS A;  3SOA A;  5KP4 A;  1OF5 B;  5RNT A;  3UL5 A;  3LH4 A;  3DGN A;  4J5G A;  2BHM A;  3LXU X;  4BIR A;  1V74 A;  1HYF A;  2OQE A;  1W2Z A;  2W56 A;  1B21 A;  3QRD A;  4JF8 A;  3G0K A;  2BMR B;  1ASK A;  3LTA A;  4G1M B;  4BU4 A;  4AEQ A;  3DGO A;  3GRD A;  1LOY A;  1OAC A;  4XBX A;  1G0T A;  6GSP A;  1QAF A;  1M1X B;  1JZO A;  2F5W A;  1VQ4 3;  1OUN A;  2H0G A;  1FGM A;  2RFR A;  3EJV A;  4HM3 B;  4NPB A;  3V92 A;  2OOV C;  2F98 A;  1IV9 A;  2WGO A;  1MWS A;  1UUG B;  3FGY A;  3S28 A;  2FGT A;  1JN5 A;  3NQZ A;  2W56 B;  2QA4 3;  1GD4 A;  2GEY A;  4U13 A;  1A2V A;  4MMZ B;  1MWR A;  1AV4 A;  4GL6 A;  1JBS A;  3DGY A;  3B8L A;  1I3F A;  8CHO A;  1Q42 A;  1QVF 2;  2D1W A;  1A90 A;  3T0U A;  3KFQ C;  3HIG A;  3WDG B;  1JNQ A;  4ORL A;  1FZU A;  2CWV A;  1MWT A;  3S5C A;  4XBY A;  2WOH A;  3GZB A;  4O8S A;  3MWZ A;  4WWU C;  3CPW 2;  3PXM A;  3LTD A;  1YGW A;  1JN5 B;  2M7O A;  4KFD A;  9RNT A;  3MHE A;  1IVX A;  1IQX A;  3RDE A;  1K41 A;  3EBT A;  1C7H A;  4X2H A;  5STD A;  1BGS A;  1BNR A;  4AKY A;  1DE3 A;  1BRG A;  2CWT A;  4HM4 B;  1S5A A;  1JBR A;  3DGL A;  4FCZ A;  5AI1 A;  1LNH A;  1UUV B;  1LVN A;  1QJG A;  1RJO A;  2HMJ B;  1EA2 A;  1GSP A;  7RNT A;  4FMA A;  1LOX A;  3VSY A;  1BSB A;  2IYJ A;  1OH0 A;  3FLJ A;  1RN1 A;  2WGQ A;  3D79 A;  2XF3 A;  5FGO A;  5ELU A;  7GSP A;  8RNT A;  1K28 A;  1BVI A;  1GS3 A;  2P09 A;  2W6J H;  2KRT A;  3F7X A;  1F8N A;  3DH2 A;  4O02 B;  2CKF B;  4PEJ A;  3WOD G;  1IDP A;  4FMB A;  3TDG A;  5KP1 A;  1I2F A;  1Q9E A;  3FG4 A;  4IIA A;  3WOE B;  1E3V A;  2H0H A;  2KXG A;  1AVL A;  1HKX A;  1FGT A;  3EC9 A;  4NRE A;  1SJW A;  3CME 3;  2FNQ A;  3F14 A;  3FF2 A;  5IEN A;  2HMK B;  1US1 A;  5GSP A;  4HM7 B;  1Q40 A;  1GMQ A;  3NBJ A;  1DMQ A;  1L5G B;  3JUO A;  2CIU A;  1YVS A;  3NM2 A;  3WR2 A;  1N9J A;  2E2V A;  2JQ5 A;  2PZV A;  4GSP A;  5EEO A;  5JBS A;  1UCL A;  1LXE A;  1IT8 A;  1GOU A;  2QGU A;  3KCH A;  2IA7 A;  1RMS A;  1RDS A;  5AIG A;  2AAE A;  4MMX B;  1RTU A;  4CJN A;  1LOV A;  5DRV A;  1RRL A;  3ZG0 A;  1PFP A;  2CX1 A;  2ZA4 A;  4O2H A;  3B7C A;  3BND A;  3I55 3;  1TUH A;  2A15 A;  5G1L A;  1G96 A;  1U5O A;  1RGE A;  1WQL B;  3D5G A;  5M19 A;  1IU7 A;  2C11 A;  1Q40 B;  3MG3 A;  4GHO A;  1A2P A;  2AAD A;  4H3U A;  3UJM A;  2R4I A;  1YJN 3;  1AR0 A;  2OOV A;  4HM5 B;  1IVU A;  2XSO B;  1Q81 4;  2R41 A;  1JB4 A;  3HI7 A;  5AYS C;  3ZFZ A;  1I70 A;  1LNI A;  3PS8 A;  4HKV B;  3PCR A;  2KCD A;  5IW9 A;  4FMC A;  4R4K A;  5HGR A;  3CCR 3;  1W00 A;  1SQW A;  4FCM A;  1YNV X;  3RGR A;  3K9M C;  5IG5 A;  1DET A;  1X1X A;  2OTL 3;  1W6G A;  1QAL A;  1E3R A;  1STD A;  1W6C A;  2CFD A;  2HMM B;  2KF3 A;  3ECF A;  2YFL B;  3OXA A;  4KVH A;  1K73 4;  2K3D A;  4N6O B;  4LMI A;  4N3V A;  4BTX A;  1UGI A;  1MWU A;  2CG1 A;  1M90 4;  1UI7 A;  4XB5 A;  1ISK A;  3JUM A;  2V1L A;  3OWY A;  4N6M A;  1BRN L;  2O3O A;  1LQM B;  1T2I A;  1AY7 A;  3FKA A;  4EW5 A;  1O7W B;  4EYC A;  3I56 3;  1YGE A;  3AHS A;  4XDW A;  3K7C A;  2CG0 A;  1OCV A;  2D42 A;  1RCK A;  5D83 A;  3CCS 3;  3O8Y A;  2SBL A;  5IG3 A;  1W5Z A;  5AEW B; 
#chains in the Genus database with same CATH homology
 1EKM A;  1FUW A;  5D81 A;  3CCU 3;  1JRQ A;  5CF1 A;  3EQQ B;  3DUK A;  3BNE A;  3GZR A;  1W02 A;  3GZY B;  4K1V A;  3X41 A;  5BXQ A;  3N8B A;  5AIH A;  2ML6 A;  3S29 A;  1JB2 A;  2F99 A;  1YI2 3;  3NX0 A;  3ER7 A;  1Q82 4;  4JRF A;  3X3Z A;  5IF6 A;  5FW5 A;  3FH1 A;  4L7K A;  3RGA A;  2IMJ A;  1YIT 3;  1N5P A;  3PZW A;  1K8A 4;  4LGQ A;  2B1X B;  3NV0 A;  3UNL A;  4K90 B;  3X3X A;  4N6V 0;  3BNC A;  5DRE A;  1RKY A;  3UB1 A;  1YJW 3;  1O7H B;  4WYK A;  4FCJ A;  1Q7Y 4;  2CHC A;  1HU9 A;  4OK0 A;  3LZA A;  2ZDJ A;  3LML A;  1ULJ B;  2QEX 3;  2W04 A;  1UW1 A;  2HMO B;  1K9M 4;  3NHX A;  3ALA A;  3CNX A;  1M9G A;  2CK3 H;  5LC6 A;  1EQK A;  5BVB A;  3FF0 A;  5LC7 A;  2WO0 A;  3NV0 B;  3DMC A;  4CCV A;  1W7C A;  2C10 A;  2WOF A;  2Z7A A;  3WA2 X;  1A2K A;  4X2O A;  4WYK B;  3CC7 3;  1JKG A;  2Z76 A;  1DVD A;  3KE7 A;  1GYB A;  1VQP 3;  3OWU A;  2IUK A;  4HYZ A;  4IPB A;  3S67 A;  2XFS A;  1O7G B;  4N6U A;  4HM1 B;  2O9U X;  3EN1 B;  1KWI A;  3Q2P A;  1TIJ A;  3CD6 3;  1BUQ A;  3UL6 A;  1TU5 A;  3BNB A;  1ZO2 A;  3NBB A;  3G6E 3;  3Q1C A;  2XSH B;  1D6Z A;  3QK9 A;  4K61 A;  3LT9 A;  3U97 A;  3CC2 3;  2K54 A;  1A67 A;  1JKG B;  3KII A;  4XDV A;  2INX A;  5A0O B;  3AMO A;  3CNM A;  5CF2 A;  3CCQ 3;  3K63 A;  4GB5 A;  4OVM A;  3MYT A;  3G16 A;  1GY5 A;  5EVH A;  5CLK A;  2OCT A;  2ZL8 A;  3IPT A;  4WP5 A;  3ROB A;  4N6N B;  2W9Q A;  1WMN A;  4KFF A;  1DMM A;  4LSO A;  3CU3 A;  3SLU A;  3K5T A;  1IT7 A;  2CH9 A;  3PCS A;  1KC8 4;  5IEO A;  3NBR A;  4EV2 A;  4R80 A;  3KKG A;  1N5H A;  4HBR A;  2UX0 A;  3K0Z A;  1ULI B;  1VQN 3;  3SOY A;  3JUQ A;  1PU4 A;  2P0M A;  3AMO B;  4MEI A;  4RNZ A;  3LTC A;  4L8O A;  2OWP A;  2XEP A;  1OHS A;  3B4P A;  4N6T A;  4IT7 A;  4KZ1 A;  5JPP A;  1IQY A;  2FXT A;  1T5Y A;  1QVG 2;  2BMO B;  4MMY B;  1N8R 4;  3CPO A;  2LYX A;  3CCL 3;  4EV5 A;  2QIY A;  3X3Y A;  4ZM8 A;  3L0R A;  3GAX A;  1NB5 I;  1W01 A;  3KSE D;  3EE1 A;  3G8Z A;  5D82 A;  3F7S A;  4QWT A;  3NM7 A;  4WFO A;  3DM8 A;  1GD3 A;  1J2B A;  5G2G A;  4I4K A;  4BTW A;  4H61 A;  2BT3 A;  1Z1S A;  2BO9 B;  2W03 A;  1DVC A;  3F9S A;  1TFK A;  2RCD A;  5CXO A;  4FR9 A;  4EXR A;  2BMQ B;  1IQ8 A;  2RSX A;  3BLZ A;  2JDI H;  3MPH A;  3LYG A;  1KD1 4;  3JUP A;  3EF8 A;  1GY6 A;  5AYR B;  3CXC 2;  2P05 A;  3F8X A;  3OX9 A;  2XH9 A;  2Y74 A;  4J9A A;  4EC6 A;  1WMP A;  3F40 A;  2STD A;  3D3L A;  3N54 B;  1VQ7 3;  2W9P A;  3H3H A;  4HJL B;  4LEH A;  1KSI A;  2XR8 B;  3FSD A;  5ELJ A;  1CEW I;  2CC3 A;  1JV2 B;  3GWR A;  3BB9 A;  3EHC A;  1U8C B;  3VF1 A;  3LTB A;  4N6L A;  3E99 A;  1E97 A;  1IK3 A;  4RBN A;  2YFJ B;  3U1W A;  3X42 A;  1IVV A;  3JUN A;  3EBY A;  3KN4 A;  1S72 3;  1VQ5 3;  1OHP A;  1DMN A;  2P0X A;  3KZT A;  2MF7 A;  3EN8 A;  5IEP A;  4BTY A;  2Q07 A;  5IER A;  1STF I;  4HVN A;  3MSO A;  2CFG A;  2GBW B;  1QMA A;  1NU3 A;  1VQM 3;  5AIF A;  1VQ8 3;  4XM4 A;  1FGO A;  4R1K A;  3SED A;  4L8P A;  3FG3 A;  1YVB I;  3IMA B;  4HZB B;  3FCS B;  4RNY A;  1FA3 A;  2E2U A;  3LT8 A;  1FGQ A;  1ZX2 A;  4J8T A;  2HMN B;  4HM6 B;  1W4N A;  1VQL 3;  1NJI 4;  2XRX B;  2BNG A;  4LZI A;  2Z6B A;  2W0Q A;  1DYU A;  1TP6 A;  1WMO A;  2HML B;  3IJE B;  1W2B 2;  1SII A;  3OV4 A;  3WA3 A;  4FMD A;  5JPU A;  2F86 B;  2I9W A;  5AEU B;  4EBG A;  1ROA A;  1NO3 A;  1JJ2 2;  1VQO 3;  4R9K A;  3KSP A;  4KFE A;  1M1K 4;  2CFL A;  3X40 A;  1WNH A;  3M8C A;  3JVC A;  3S27 A;  5TGN A;  1D6U A;  1FGR A;  4HZ9 B;  5IG0 A;  1NDO B;  2GU1 A;  3WMD A;  2W2C A;  2P38 A;  1VZZ A;  4HM8 B;  3HK4 A;  2L4V A;  3HX8 A;  2OQE C;  3I0Y A;  4OUQ A;  5IG4 A;  4K1U A;  2OTJ 3;  3T8N A;  4Q53 A;  2GBX B;  3SVA A;  3DGM A;  3B4O A;  1CQS A;  1QAK A;  1Q86 4;  1MNL A;  1IV7 A;  3MG2 A;  3NXJ A;  2XFT A;  1JB5 A;  2CFK A;  1NWW A;  3CMA 3;  1O7M B;  2B24 B;  4WHA A;  1RN7 A;  3N9H A;  1VQ6 3;  1GY7 A;  1UUW B;  1Y4K A;  3G71 3;  1OGZ A;  2PNC A;  4AKZ A;  1CYV A;  2YFI B;  3LOY A;  3VGN A;  4O3V A;  1ROV A;  4STD A;  1O7P B;  2MC8 A;  1D6Y A;  1W6Y A;  1O7N B;  3CCE 3;  3G4S 3;  1KQS 2;  6STD A;  1VQK 3;  3DXO A;  4RZM A;  2IUJ A;  2GEX A;  3PGB A;  2GU3 A;  1SIH A;  2CFW A;  3T8U A;  3FG1 A;  3CCV 3;  3NUV A;  2Y73 A;  4XBT A;  3WOF B;  3DY5 A;  1YIJ 3;  2Z77 A;  3HII A;  3MG1 A;  1YJ9 3;  3CC4 3;  1NB3 I;  3OWS A;  5I97 A;  1YHQ 3;  3FZW A;  4HM2 B;  5CK6 A;  1VQ9 3;  3D9R A;  4TX4 A;  1OGX A;  3PYJ A;  7STD A;  5AII A;  3STD A;  3CCM 3;  2E2T A;  3V99 A;  2K0M A;  3MKI A;  1IVW A;  1WTH A;  1RRH A;  1OHO A;  3F8H A;  3H51 A;  1UI8 A;  3HZP A;  1AVK A;  3DZL A;  1SPU A;  4HM0 B;  5KP3 A;  1N9E A;  2GXF A;  1OF5 A;  3EB8 A;  3SX1 A;  1CYU A;  1MOL A;  2CWU A;  2XGL A;  3OW2 2;  2LQV A;  1OPY A;  3GZX B;  3Q90 A;  3CCJ 3;  2CW9 A;  3NQY A;  1EG9 B;  1R4C A;  3A76 A;  1N8Q A;  2RGQ A;  1TFO A;  3SXX A;  2ML5 A;  4CDL A;  2YX9 A;  3EX9 A;  4NHF A;  3V98 A;  3J7Y d;  2XGN A;  5EQL A;  4MJD A;  5KP4 A;  3SOA A;  1OF5 B;  3UL5 A;  3LH4 A;  3DGN A;  2BHM A;  3LXU X;  1V74 A;  2OQE A;  1W2Z A;  2W56 A;  3QRD A;  4JF8 A;  3G0K A;  2BMR B;  1ASK A;  3LTA A;  4G1M B;  4AEQ A;  3DGO A;  3GRD A;  1OAC A;  4XBX A;  1QAF A;  1M1X B;  1VQ4 3;  1OUN A;  2RFR A;  1FGM A;  3EJV A;  4HM3 B;  3V92 A;  2OOV C;  2F98 A;  1IV9 A;  2WGO A;  3S28 A;  3FGY A;  2FGT A;  1JN5 A;  3NQZ A;  2W56 B;  2QA4 3;  1GD4 A;  2GEY A;  4U13 A;  1A2V A;  4MMZ B;  1AV4 A;  4GL6 A;  3B8L A;  8CHO A;  1Q42 A;  1QVF 2;  2D1W A;  1A90 A;  3T0U A;  3KFQ C;  3HIG A;  3WDG B;  1JNQ A;  4ORL A;  2CWV A;  3S5C A;  4XBY A;  2WOH A;  3GZB A;  4O8S A;  3MWZ A;  4WWU C;  3CPW 2;  3PXM A;  3LTD A;  1JN5 B;  2M7O A;  4KFD A;  3MHE A;  1IVX A;  1IQX A;  3RDE A;  1K41 A;  3EBT A;  1C7H A;  4X2H A;  5STD A;  4AKY A;  2CWT A;  4HM4 B;  1S5A A;  3DGL A;  4FCZ A;  5AI1 A;  1LNH A;  1UUV B;  1LVN A;  1QJG A;  1RJO A;  2HMJ B;  1EA2 A;  4FMA A;  1LOX A;  3VSY A;  1OH0 A;  3FLJ A;  2WGQ A;  2XF3 A;  5FGO A;  5ELU A;  1K28 A;  2W6J H;  1GS3 A;  2P09 A;  3F7X A;  2KRT A;  4O02 B;  1F8N A;  4PEJ A;  4R9L A;  2CKF B;  3WOD G;  1IDP A;  4FMB A;  3TDG A;  5KP1 A;  3FG4 A;  4IIA A;  3WOE B;  1E3V A;  2KXG A;  1AVL A;  1HKX A;  1FGT A;  3EC9 A;  4NRE A;  1SJW A;  3CME 3;  2FNQ A;  3F14 A;  3FF2 A;  5IEN A;  2HMK B;  1US1 A;  4HM7 B;  1Q40 A;  3NBJ A;  1DMQ A;  1L5G B;  3JUO A;  2CIU A;  3NM2 A;  1N9J A;  2E2V A;  2JQ5 A;  2PZV A;  5EEO A;  5JBS A;  1LXE A;  1IT8 A;  2QGU A;  2IA7 A;  5AIG A;  4MMX B;  5DRV A;  1RRL A;  1PFP A;  4O2H A;  3B7C A;  3BND A;  3I55 3;  1TUH A;  2A15 A;  1G96 A;  1U5O A;  1WQL B;  1IU7 A;  2C11 A;  1Q40 B;  3MG3 A;  4H3U A;  3UJM A;  2R4I A;  1YJN 3;  1AR0 A;  2OOV A;  4HM5 B;  1IVU A;  2XSO B;  1Q81 4;  1JB4 A;  3HI7 A;  5AYS C;  3PS8 A;  4HKV B;  3PCR A;  2KCD A;  5IW9 A;  4FMC A;  4R4K A;  5HGR A;  3CCR 3;  1W00 A;  1SQW A;  4FCM A;  3RGR A;  3K9M C;  5IG5 A;  2OTL 3;  1W6G A;  1QAL A;  1E3R A;  1STD A;  1W6C A;  2CFD A;  2HMM B;  3ECF A;  2YFL B;  3OXA A;  4KVH A;  1K73 4;  4N6O B;  4LMI A;  4N3V A;  4BTX A;  2CG1 A;  1M90 4;  1UI7 A;  4XB5 A;  1ISK A;  3JUM A;  2V1L A;  3OWY A;  4N6M A;  2O3O A;  3FKA A;  1O7W B;  4EYC A;  3I56 3;  1YGE A;  4XDW A;  3K7C A;  2CG0 A;  1OCV A;  2D42 A;  3CCS 3;  5D83 A;  3O8Y A;  2SBL A;  5IG3 A;  1W5Z A;  5AEW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...