2W56B

Structure of the hypothetical protein vc0508 from vibrio cholerae vsp- ii pathogenicity island
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
131
Chain Sequence
TFTASSLPVSKKLHKLLSEQLTAHYLVFNFRDKSYSADEGGFHPVEMAICQTSTGEWSIEYITDFAYMGNYYPELERNLDFDFRVGQFFVAYRGWLPMQGSRDAKELYRLWESNFLAYVDMDAYNEIAITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Hypothetical Protein Vc0508 from Vibrio Cholerae Vsp-II Pathogenicity Island
rcsb
source organism Vibrio cholerae
molecule tags Unknown function
molecule keywords VC0508
total genus 33
structure length 131
sequence length 142
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10980 DUF2787 Protein of unknown function (DUF2787)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.430 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w56B00
2W56A 2W56B 2V1LA
chains in the Genus database with same CATH superfamily
1ZS7A 3EE1A 1VQ63 5A0OB 3MG2A 1UCKA 3L0RA 4MMZB 3DGYA 1W4NA 5LC7A 3S27A 3T0UA 1SJWA 1GY6A 5ELUA 3G713 1Q9EA 3Q3FA 3A5EA 4MMYB 1VQN3 1PFPA 4HZBB 1BIRA 4K61A 1CH0A 1E97A 3Q2PA 5AI1A 1K9M4 2BT3A 1MWTA 1T5YA 3FG3A 3SVAA 1EG9B 1SIIA 3CPW2 1YIJ3 7RNTA 4XM4A 3JVCA 1DMNA 1W5ZA 1JB4A 1BRKA 2RNTA 1MGRA 1TU5A 1EQKA 4LZIA 3V98A 3OX9A 4G1MB 1WNHA 3WR2A 5IENA 1ZGXA 4L8OA 1E3RA 2OQEC 2P0XA 2CX0A 1ASKA 2P0MA 3KE7A 3S29A 2XSHB 1S723 1BRIA 3CCQ3 1OHOA 1VQK3 1K28A 3BLZA 1GY5A 1Z1SA 2F56A 1BRGA 3MG3A 1BNSA 3LXUX 2WGOA 1SIHA 3B7CA 3X40A 1BNGA 1AV4A 4HM1B 3JUPA 3F7SA 4O02B 2Z77A 1FUSA 2IY2A 5G2GA 3CC73 4JRFA 4LYLB 1J2BA 3HX8A 1A2VA 1BAOA 2YFIB 5EVHA 3DGLA 1CQSA 1YVBI 2XR8B 1T3BA 2M7OA 2F86B 3KSED 4ZM8A 2ZL8A 1N9JA 3X3YA 8CHOA 2OTL3 2HMOB 2XF3A 3EN8A 4J9AA 3CCE3 2MC8A 8RNTA 3NM7A 1ROAA 1YGEA 2BU4A 3ER7A 1W00A 1I8VA 1IK3A 4LEHA 2WGQA 1EA2A 3D4AA 4GHOA 4EC6A 1K734 1PU4A 4RNYA 4AKZA 1LOYA 1FGRA 1JKGA 2CHCA 5BIRA 1OPYA 5AEUB 1RNBA 3D5GA 3SOYA 2Z76A 1UDII 1KD14 1AY7A 1VQ83 2OCTA 1C54A 5AIGA 1V58A 1RLSA 3WHOA 2B1XB 3LH4A 5BXQA 4RNZA 1I2EA 3B8LA 3RGAA 3VSYA 1OHPA 4GL6A 1ROVA 4HM0B 3WDGB 4FCMA 1GSPA 1TFKA 2CH9A 6GSPA 2IA7A 1RRHA 3QRDA 3ALAA 1B2ZA 1R4CA 1IVUA 3NQZA 5ELJA 3CCJ3 3F40A 5G1LA 1X1WA 1JV2B 4KFEA 5BU4A 3SXXA 5IG0A 2H0IA 2XFSA 2RBIA 3LYGA 4R80A 1RKYA 1BNIA 3RDEA 1HZ1A 2E2TA 1Q814 2AAEA 3EBTA 4QWTA 2ZDJA 1YJN3 1A2PA 1VQO3 2IYJA 1BRSA 1BANA 4TX4A 4XDWA 4CPKA 4N6TA 1IT7A 1NNVA 3VGNA 2XRXB 1RN7A 3AGOA 3DY5A 3WA2X 1UUVB 1RGCA 4XBTA 4CDLA 3CXC2 2UGIA 4ILFA 1N9EA 1YGWA 2IUJA 2XGLA 5CK6A 1TJDA 3CNMA 3HIGA 1GY7A 4NPBA 1BRNL 3B4PA 1IQXA 3UJMA 3LTAA 2P09A 3MPHA 1A67A 4XDVA 3ZFZA 1PY3A 3KKGA 1KQS2 3S28A 1RMSA 2Y73A 1IT8A 4ORLA 5AEWB 1B2XA 3PGBA 1VQ43 3K63A 2F99A 3X3ZA 5AYRB 3SOAA 3LT8A 2QA43 2W9PA 3SX1A 1KC84 4EV5A 1X1XA 1LVNA 3JUQA 3Q90A 2BNGA 6STDA 6RNTA 1UCLA 1DVDA 1JB2A 1JB5A 3KN4A 2SBLA 1B2MA 5TGNA 2W56A 3UNLA 1UGIA 1N5PA 4HYZA 4DKIA 5CF1A 1O7NB 2KF6A 2Z6BA 1AR0A 1S5AA 1G96A 3A76A 3GZYB 2P38A 1LOWA 3E99A 2K3DA 3BNCA 1A2KA 4GB5A 1FUTA 5JBSA 1G0TA 3NV0B 5CF2A 1X1UA 1LXEA 4R4KA 1OHSA 3X42A 2K0MA 4FMCA 4L8PA 3ZG5A 1EKMA 4WYKA 2E2UA 1FYSA 1OF5A 3K5TA 3MHEA 4MJDA 4EYCA 5M1AA 1QAKA 2INXA 4IT7A 1M1K4 3D5IA 3DGMA 2ML6A 2W2CA 1BNFA 1RRLA 2P05A 2W56B 2W03A 1JZDA 1ZX2A 3AHWA 1ULJB 3BNDA 2GBXB 4BTWA 2KCDA 4N3VA 4EW5A 2QEX3 1SPUA 1OH0A 2CG0A 4HM8B 1I0VA 1UI7A 2C10A 1G02A 4HM5B 3CD63 1JBRA 1KSIA 3CNXA 3UL5A 3NBBA 1YI23 5D82A 4RBNA 1DE3A 1W6YA 3FCSB 2BMOB 2CFWA 2YFLB 3GZRA 1STFI 1D6YA 3CC43 1I3IA 3LZAA 2L1SA 4XBYA 5D83A 3M8CA 3X41A 1N8QA 1B2UA 1RJOA 2J8XB 1VQQA 1BSCA 3NHXA 3G16A 3D79A 1X1YA 4HZ9B 5AIHA 1VQM3 2BMQB 2UX0A 1OCVA 2YFJB 1JN5B 1HU9A 3G8ZA 3CCR3 1VQ73 1M1XB 3NXJA 4BL2A 1T2HA 3GWRA 5CXOA 3V99A 1O7MB 3FG1A 1VQ53 3NUVA 4FMBA 3FF2A 3MSOA 3OXAA 5G1KA 4EBGA 1NU3A 1RDSA 3D9RA 1L5GB 2R4IA 1Q824 5STDA 4AKYA 3J7Yd 3HZPA 4XB5A 2W6JH 1LRAA 1TTOA 1UUWB 1TFOA 3CCM3 3JUNA 5IG3A 2RCDA 4KT3B 3ROBA 4HOHA 1RHLA 4L7KA 3EQQB 3IJEB 2HMJB 1QALA 4J5GA 2STDA 2CK3H 1I2GA 2B24B 1Q40B 3F8HA 5M18A 4K1VA 2OOVC 4K1UA 1Q864 1FW7A 1WTHA 3DGOA 1FGTA 3DUKA 3EF8A 3BU4A 3Q1CA 1B20A 4KVHA 2QGUA 2QIYA 1QAFA 1Y4KA 1Q7HA 3HOHA 3EBYA 3U97A 4EV2A 1BNRA 2W9QA 5IERA 1NB3I 2CKFB 4H3UA 3PCSA 3U1WA 1IYYA 1QJGA 2KRTA 3I0YA 4AEQA 1FUWA 3GRDA 4GSPA 1RNTA 2JQ5A 2JDIH 3CPOA 4FCZA 3FGYA 4NHFA 3DXOA 9RNTA 1UCIA 2RSXA 1B27A 2HMLB 4N6LA 3V92A 1STDA 1RGEA 1NDOB 1ZO2A 2KXGA 1MGWA 3EHCA 4H61A 3PCRA 3N9HA 1LNIA 2Y74A 3F8XA 5HGRA 2CWVA 1Q42A 2CWUA 4MMXB 5AYSC 3OW22 1DETA 4R9KA 3NQYA 5HOHA 1M9GA 3NM2A 4BTXA 1RCKA 4I4KA 4HJLB 2R41A 3CCV3 4N6UA 5BVBA 3F9SA 1JKGB 4U13A 1FA3A 2XH9A 3ECFA 3H51A 2GEYA 2CFDA 4J8TA 3EC9A 2A15A 3DM8A 1SQWA 2F4YA 4J5KA 2C11A 1O7PB 4R9LA 2PZVA 1I2FA 3LTDA 2GU1A 1NJI4 1WMNA 2MF7A 1RTUA 3PYJA 1YNVX 1BU4A 3OWUA 2WOFA 1UGHI 1OF5B 1I70A 4HBRA 3STDA 1RN1A 1DVCA 3WA3A 3UL6A 3G4S3 1NWWA 1ULIB 3SLUA 3FSDA 1VQP3 5EQLA 3JUOA 1AVLA 4X2HA 4X2OA 2BMRB 4N6V0 1DYUA 1U5OA 3MKIA 5AIIA 3NX0A 1OACA 1WMOA 2OWPA 3DGNA 1M904 1LNHA 3KZTA 5IEOA 1NB5I 1KWIA 1WQLB 3BNBA 2OTJ3 2HMKB 1T2IA 2FGTA 4MEIA 2Z7AA 4LMIA 1O7WB 4O8SA 4IIAA 3EN1B 2V1LA 1TP6A 2WOHA 3OV4A 3CCS3 1RN4A 1SARA 3KCHA 1UCJA 4LSOA 3LMLA 1IVWA 1RGHA 2CFKA 4FR9A 1BNJA 3N8BA 4FCJA 4BU4A 2O3OA 1OGXA 2AADA 2YX9A 3F7XA 1TIJA 4Q53A 3UB1A 3FF0A 3TDGA 4O3VA 1CYUA 1JBSA 4RNTA 3JUMA 3CC23 1DMMA 2OOVA 3CCL3 1YJ93 3WOFB 1FZUA 2H0GA 2ML5A 1B21A 1MWUA 1V57A 1W02A 2LQVA 3PXMA 4KZ1A 1R4YA 1JZOA 1VQL3 2F98A 2BO9B 1W2B2 1BRJA 7GSPA 2F5WA 2KF4A 3FLJA 3GAXA 4HM7B 2CG1A 1VZZA 1JNQA 3HK4A 1CYVA 3WOEB 1C7HA 1LOVA 2CC3A 3URPA 1F8NA 3G6E3 1ISKA 3VF1A 1FGOA 3CCU3 1GMPA 1IV9A 1GMQA 3WMDA 4LGQA 1OUNA 1UW1A 2E2VA 2GEXA 3RGRA 3FKAA 2RGQA 5GSPA 1O7HB 5DREA 4BIRA 3KFQC 2SARA 1V74A 3NBJA 4FMDA 4CJNA 3IMAB 3KIIA 1YJW3 1BSDA 1IVVA 1K41A 2D1WA 2XGNA 3LOYA 2ZHXB 3GSPA 5DRVA 1TRQA 2CIUA 1N5HA 2D42A 3MYTA 3WODG 4BL3A 1W6CA 5M19A 1Q7Y4 1QVG2 3BNEA 1GOUA 5EEOA 1BGSA 1WMPA 2IMJA 5I97A 1US1A 3OWYA 4NREA 4HM6B 2CFGA 4CCVA 2L4VA 3AHSA 1BVIA 3NV0A 1YIT3 3FG4A 4WHAA 1GS3A 3AMOA 1BOXA 1GD4A 1RGFA 1UUGB 2XFTA 3F14A 3FH1A 4WYKB 4EXRA 5IF6A 1RGGA 4O2HA 1U8CB 3K7CA 4FMAA 3S67A 3PZWA 1LOXA 2HMNB 3T8UA 1UI8A 1MWRA 1EEJA 3KSPA 4XBXA 3MWZA 4OUQA 5IG4A 4BTYA 1TUHA 2UUGC 1RGAA 2K54A 4N6OB 3AGNA 3DH2A 4PEJA 1LQMB 3HI7A 1I3FA 2OQEA 3B4OA 1TRPA 1IVXA 1IDPA 4RZMA 1A90A 2WO0A 1GOYA 5IW9A 3ZG0A 3K0ZA 5LC6A 1YVSA 3S5CA 5KP1A 1VQ93 1EUIC 1IV7A 1QMAA 3AMOB 3X3XA 1MWSA 3SYUA 1BSEA 3LT9A 2H0HA 2O9UX 3CME3 1CEWI 1OGZA 3D3LA 3DMCA 1DMQA 2BHMA 5JPUA 3EJVA 2KAAA 2PNCA 2CW9A 1RGKA 1O7GB 2GBWB 3G0KA 4N6NB 2GXFA 1D6ZA 4HAAA 1RSNA 4HM3B 3SEDA 3I563 3GZBA 1I0XA 2KF3A 1GD3A 1W01A 2CWTA 3LTBA 3NBRA 4JF8A 5FW5A 1B2SA 5IG5A 1K8A4 3RNTA 2RFRA 4STDA 3QK9A 1W7CA 2W0QA 4OK0A 1YHQ3 3HIIA 1IU7A 1FGMA 1RCLA 3FZWA 1JRQA 3I553 5KP3A 2HMMB 1AQZA 3OWSA 3O8YA 2IUKA 3K9MC 3LTCA 4K90B 1JN5A 4HM2B 5RNTA 1NO3A 3IPTA 1E3VA 3EB8A 1BSBA 3DZLA 3EX9A 4KFFA 4HVNA 4N6MA 5CLKA 3GZXB 5IEPA 1MOLA 1JBTA 1HKXA 4OVMA 2W04A 1B3SA 1BNEA 1Q40A 1W6GA 4KFDA 2GSPA 1BRHA 1GMRA 1W2ZA 4HM4B 4IPBA 1PYLA 5FGOA 4R1KA 5AIFA 1MNLA 4HKVB 1LQGC 2Q07A 2I9WA 3BIRA 1HYFA 3MG1A 1JJ22 3CU3A 1GOVA 2F5MA 3T8NA 1BUJA 2FXTA 2HOHA 4WP5A 2XEPA 3BB9A 1IQYA 2CFLA 7STDA 3PS8A 5KP4A 1D6UA 2LYXA 2CX1A 2KF5A 1GYBA 1IQ8A 1BSAA 1FGQA 3N54B 1BUQA 1RGLA 4WWUC 5D81A 3CMA3 2FNQA 4WFOA 2BIRA 2GU3A 2XSOB 1N8R4 3H3HA 4I5QA 5JPPA 1QVF2 2ZA4A 1AVKA 2C4BA
chains in the Genus database with same CATH topology
3EE1A 1VQ63 5A0OB 3MG2A 3L0RA 4MMZB 1W4NA 5LC7A 3S27A 3T0UA 1SJWA 1GY6A 5ELUA 3G713 4MMYB 1VQN3 1PFPA 4HZBB 4K61A 1E97A 3Q2PA 5AI1A 1K9M4 2BT3A 1T5YA 3FG3A 3SVAA 1EG9B 1SIIA 3CPW2 1YIJ3 4XM4A 3JVCA 1DMNA 1W5ZA 1JB4A 1TU5A 1EQKA 4LZIA 3V98A 3OX9A 4G1MB 1WNHA 5IENA 4L8OA 1E3RA 2OQEC 2P0XA 1ASKA 2P0MA 3KE7A 3S29A 2XSHB 1S723 3CCQ3 1OHOA 1VQK3 1K28A 3BLZA 1GY5A 1Z1SA 3MG3A 3LXUX 2WGOA 1SIHA 3B7CA 3X40A 1AV4A 4HM1B 3JUPA 3F7SA 4O02B 2Z77A 5G2GA 3CC73 4JRFA 1J2BA 3HX8A 1A2VA 2YFIB 5EVHA 3DGLA 1CQSA 1YVBI 2XR8B 2M7OA 2F86B 3KSED 4ZM8A 2ZL8A 1N9JA 3X3YA 8CHOA 2OTL3 2HMOB 2XF3A 3EN8A 4J9AA 3CCE3 2MC8A 3NM7A 1ROAA 1YGEA 3ER7A 1W00A 1IK3A 4LEHA 2WGQA 1EA2A 4EC6A 1K734 1PU4A 4RNYA 4AKZA 1FGRA 1JKGA 2CHCA 1OPYA 5AEUB 3SOYA 2Z76A 1KD14 1VQ83 2OCTA 5AIGA 2B1XB 3LH4A 5BXQA 4RNZA 3B8LA 3RGAA 3VSYA 1OHPA 4GL6A 1ROVA 4HM0B 3WDGB 4FCMA 1TFKA 2CH9A 2IA7A 1RRHA 3QRDA 3ALAA 1R4CA 1IVUA 3NQZA 5ELJA 3CCJ3 3F40A 4KFEA 1JV2B 3SXXA 5IG0A 2XFSA 3LYGA 4R80A 1RKYA 3RDEA 2E2TA 1Q814 3EBTA 4QWTA 2ZDJA 1YJN3 1VQO3 4TX4A 4XDWA 4N6TA 1IT7A 3VGNA 2XRXB 1RN7A 3DY5A 3WA2X 1UUVB 4CDLA 4XBTA 3CXC2 2IUJA 1N9EA 2XGLA 5CK6A 3CNMA 3HIGA 1GY7A 3B4PA 1IQXA 3UJMA 3LTAA 2P09A 3MPHA 1A67A 4XDVA 1KQS2 3KKGA 3S28A 1VQ43 2Y73A 1IT8A 4ORLA 5AEWB 3PGBA 3K63A 2F99A 3X3ZA 5AYRB 3SOAA 2QA43 2W9PA 3SX1A 1KC84 4EV5A 1LVNA 3JUQA 3Q90A 2BNGA 6STDA 1DVDA 1JB2A 1JB5A 3KN4A 2SBLA 5TGNA 2W56A 3UNLA 1N5PA 4HYZA 5CF1A 1O7NB 2Z6BA 1AR0A 1S5AA 1G96A 3A76A 3GZYB 2P38A 3E99A 3BNCA 1A2KA 4GB5A 5JBSA 3NV0B 5CF2A 1LXEA 4R4KA 1OHSA 3X42A 2K0MA 4FMCA 4L8PA 1EKMA 4WYKA 2E2UA 3K5TA 1OF5A 3MHEA 4MJDA 4EYCA 1QAKA 2INXA 4IT7A 1M1K4 3DGMA 2ML6A 2W2CA 1RRLA 2P05A 2W03A 2W56B 1ZX2A 1ULJB 3BNDA 2GBXB 4BTWA 2KCDA 4N3VA 2QEX3 1SPUA 1OH0A 2CG0A 4HM8B 1UI7A 2C10A 4HM5B 3CD63 1KSIA 3CNXA 3UL5A 3NBBA 1YI23 5D82A 4RBNA 1W6YA 3FCSB 2BMOB 2CFWA 2YFLB 3GZRA 1STFI 1D6YA 3CC43 3LZAA 4XBYA 5D83A 3M8CA 3X41A 1N8QA 1RJOA 3NHXA 3G16A 4HZ9B 5AIHA 1VQM3 2BMQB 2UX0A 1OCVA 2YFJB 1JN5B 1HU9A 3G8ZA 3CCR3 1VQ73 1M1XB 3NXJA 3GWRA 5CXOA 3V99A 1O7MB 3FG1A 1VQ53 3NUVA 4FMBA 3FF2A 3MSOA 3OXAA 4EBGA 1NU3A 1L5GB 3D9RA 2R4IA 1Q824 5STDA 4AKYA 3J7Yd 3HZPA 4XB5A 2W6JH 1UUWB 1TFOA 3CCM3 3JUNA 5IG3A 2RCDA 3ROBA 4L7KA 3EQQB 3IJEB 2HMJB 1QALA 2STDA 2CK3H 2B24B 1Q40B 3F8HA 4K1VA 2OOVC 4K1UA 1Q864 1WTHA 3DGOA 1FGTA 3DUKA 3EF8A 3Q1CA 4KVHA 2QGUA 2QIYA 1QAFA 1Y4KA 4EV2A 3EBYA 3U97A 2W9QA 5IERA 1NB3I 2CKFB 4H3UA 3PCSA 3U1WA 1QJGA 2KRTA 3I0YA 4AEQA 1FUWA 3GRDA 2JQ5A 2JDIH 3CPOA 4FCZA 3FGYA 4NHFA 3DXOA 2RSXA 2HMLB 4N6LA 3V92A 1STDA 1NDOB 1ZO2A 2KXGA 3EHCA 4H61A 3PCRA 3N9HA 2Y74A 3F8XA 5HGRA 2CWVA 1Q42A 2CWUA 4MMXB 5AYSC 3OW22 4R9KA 3NQYA 1M9GA 3NM2A 4BTXA 4I4KA 4HJLB 3CCV3 4N6UA 5BVBA 3F9SA 1JKGB 4U13A 1FA3A 2XH9A 3ECFA 3H51A 2GEYA 2CFDA 4J8TA 3EC9A 2A15A 3DM8A 1SQWA 2C11A 1O7PB 4R9LA 2PZVA 3LTDA 2GU1A 1NJI4 1WMNA 2MF7A 3PYJA 3OWUA 2WOFA 1OF5B 4HBRA 3STDA 1DVCA 3WA3A 3UL6A 3G4S3 1NWWA 1ULIB 3SLUA 3FSDA 1VQP3 5EQLA 3JUOA 1AVLA 4X2HA 4X2OA 2BMRB 4N6V0 1DYUA 1U5OA 3MKIA 5AIIA 3NX0A 1OACA 1WMOA 2OWPA 3DGNA 1M904 1LNHA 3KZTA 5IEOA 1NB5I 1KWIA 1WQLB 3BNBA 2OTJ3 2HMKB 2FGTA 4MEIA 2Z7AA 4LMIA 1O7WB 4O8SA 4IIAA 3EN1B 2V1LA 1TP6A 2WOHA 3OV4A 3CCS3 4LSOA 3LMLA 1IVWA 2CFKA 4FR9A 3N8BA 4FCJA 2O3OA 1OGXA 2YX9A 3F7XA 1TIJA 4Q53A 3UB1A 3FF0A 3TDGA 4O3VA 1CYUA 3JUMA 3CC23 1DMMA 2OOVA 3CCL3 1YJ93 3WOFB 3PXMA 2ML5A 2LQVA 1W02A 4KZ1A 1VQL3 2F98A 2BO9B 1W2B2 3FLJA 3GAXA 4HM7B 2CG1A 1VZZA 1JNQA 3HK4A 1CYVA 3WOEB 1C7HA 2CC3A 3G6E3 1ISKA 1F8NA 3VF1A 1FGOA 3CCU3 1IV9A 3WMDA 4LGQA 1OUNA 1UW1A 2E2VA 2GEXA 3RGRA 3FKAA 2RGQA 1O7HB 5DREA 3KFQC 1V74A 3NBJA 4FMDA 3IMAB 3KIIA 1YJW3 1IVVA 1K41A 2D1WA 2XGNA 3LOYA 5DRVA 2CIUA 3MYTA 1N5HA 2D42A 3WODG 1Q7Y4 1W6CA 1QVG2 3BNEA 5EEOA 5I97A 1WMPA 2IMJA 1US1A 3OWYA 4NREA 4HM6B 2CFGA 4CCVA 2L4VA 3NV0A 1YIT3 3FG4A 4WHAA 1GS3A 3AMOA 1GD4A 4EXRA 2XFTA 3F14A 3FH1A 4WYKB 5IF6A 4O2HA 1U8CB 3K7CA 4FMAA 3S67A 3PZWA 1LOXA 2HMNB 3T8UA 1UI8A 3KSPA 4XBXA 3MWZA 4OUQA 5IG4A 4BTYA 1TUHA 2K54A 4N6OB 4PEJA 3HI7A 2OQEA 3B4OA 1IVXA 1IDPA 4RZMA 1A90A 2WO0A 5IW9A 1VQ93 3K0ZA 5LC6A 3S5CA 5KP1A 3AMOB 1IV7A 1QMAA 3X3XA 3LT9A 2O9UX 3CME3 1CEWI 3DMCA 1OGZA 3D3LA 1DMQA 2BHMA 5JPUA 3EJVA 2PNCA 2CW9A 2GBWB 1O7GB 3G0KA 4N6NB 2GXFA 1D6ZA 4HM3B 3SEDA 3I563 3GZBA 3LTBA 1GD3A 1W01A 2CWTA 3NBRA 5FW5A 4JF8A 5IG5A 1K8A4 2RFRA 4STDA 3QK9A 1W7CA 2W0QA 4OK0A 1YHQ3 3HIIA 1IU7A 1FGMA 3FZWA 1JRQA 3I553 5KP3A 2HMMB 3OWSA 3O8YA 2IUKA 3K9MC 3LTCA 4K90B 1JN5A 4HM2B 1NO3A 3IPTA 1E3VA 3EB8A 3DZLA 3EX9A 4KFFA 4HVNA 4N6MA 5CLKA 3GZXB 5IEPA 1MOLA 1HKXA 4OVMA 2W04A 1Q40A 1W6GA 4KFDA 1W2ZA 4HM4B 4IPBA 5FGOA 4R1KA 5AIFA 1MNLA 4HKVB 2Q07A 2I9WA 3MG1A 1JJ22 3CU3A 3T8NA 2FXTA 4WP5A 2XEPA 3BB9A 1IQYA 2CFLA 7STDA 3PS8A 5KP4A 1D6UA 2LYXA 1GYBA 1IQ8A 1FGQA 3N54B 1BUQA 4WWUC 5D81A 3CMA3 2FNQA 4WFOA 2XSOB 2GU3A 1N8R4 3H3HA 5JPPA 1QVF2 1AVKA 3LT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W56 A;  2W56 B;  2V1L A; 
#chains in the Genus database with same CATH topology
 1ZS7 A;  3EE1 A;  1VQ6 3;  5A0O B;  3MG2 A;  1UCK A;  3L0R A;  4MMZ B;  3DGY A;  1W4N A;  5LC7 A;  3S27 A;  3T0U A;  1SJW A;  1GY6 A;  5ELU A;  3G71 3;  1Q9E A;  3Q3F A;  3A5E A;  4MMY B;  1VQN 3;  1PFP A;  4HZB B;  1BIR A;  4K61 A;  1CH0 A;  1E97 A;  3Q2P A;  5AI1 A;  1K9M 4;  2BT3 A;  1MWT A;  1T5Y A;  3FG3 A;  3SVA A;  1EG9 B;  1SII A;  3CPW 2;  1YIJ 3;  7RNT A;  4XM4 A;  3JVC A;  1DMN A;  1W5Z A;  1JB4 A;  1BRK A;  2RNT A;  1MGR A;  1TU5 A;  1EQK A;  4LZI A;  3V98 A;  3OX9 A;  4G1M B;  1WNH A;  3WR2 A;  5IEN A;  1ZGX A;  4L8O A;  1E3R A;  2OQE C;  2P0X A;  2CX0 A;  1ASK A;  2P0M A;  3KE7 A;  3S29 A;  2XSH B;  1S72 3;  1BRI A;  3CCQ 3;  1OHO A;  1VQK 3;  1K28 A;  3BLZ A;  1GY5 A;  1Z1S A;  2F56 A;  1BRG A;  3MG3 A;  1BNS A;  3LXU X;  2WGO A;  1SIH A;  3B7C A;  3X40 A;  1BNG A;  1AV4 A;  4HM1 B;  3JUP A;  3F7S A;  4O02 B;  2Z77 A;  1FUS A;  2IY2 A;  5G2G A;  3CC7 3;  4JRF A;  4LYL B;  1J2B A;  3HX8 A;  1A2V A;  1BAO A;  2YFI B;  5EVH A;  3DGL A;  1CQS A;  1YVB I;  2XR8 B;  1T3B A;  2M7O A;  2F86 B;  3KSE D;  4ZM8 A;  2ZL8 A;  1N9J A;  3X3Y A;  8CHO A;  2OTL 3;  2HMO B;  2XF3 A;  3EN8 A;  4J9A A;  3CCE 3;  2MC8 A;  8RNT A;  3NM7 A;  1ROA A;  1YGE A;  2BU4 A;  3ER7 A;  1W00 A;  1I8V A;  1IK3 A;  4LEH A;  2WGQ A;  1EA2 A;  3D4A A;  4GHO A;  4EC6 A;  1K73 4;  1PU4 A;  4RNY A;  4AKZ A;  1LOY A;  1FGR A;  1JKG A;  2CHC A;  5BIR A;  1OPY A;  5AEU B;  1RNB A;  3D5G A;  3SOY A;  2Z76 A;  1UDI I;  1KD1 4;  1AY7 A;  1VQ8 3;  2OCT A;  1C54 A;  5AIG A;  1V58 A;  1RLS A;  3WHO A;  2B1X B;  3LH4 A;  5BXQ A;  4RNZ A;  1I2E A;  3B8L A;  3RGA A;  3VSY A;  1OHP A;  4GL6 A;  1ROV A;  4HM0 B;  3WDG B;  4FCM A;  1GSP A;  1TFK A;  2CH9 A;  6GSP A;  2IA7 A;  1RRH A;  3QRD A;  3ALA A;  1B2Z A;  1R4C A;  1IVU A;  3NQZ A;  5ELJ A;  3CCJ 3;  3F40 A;  5G1L A;  1X1W A;  1JV2 B;  4KFE A;  5BU4 A;  3SXX A;  5IG0 A;  2H0I A;  2XFS A;  2RBI A;  3LYG A;  4R80 A;  1RKY A;  1BNI A;  3RDE A;  1HZ1 A;  2E2T A;  1Q81 4;  2AAE A;  3EBT A;  4QWT A;  2ZDJ A;  1YJN 3;  1A2P A;  1VQO 3;  2IYJ A;  1BRS A;  1BAN A;  4TX4 A;  4XDW A;  4CPK A;  4N6T A;  1IT7 A;  1NNV A;  3VGN A;  2XRX B;  1RN7 A;  3AGO A;  3DY5 A;  3WA2 X;  1UUV B;  1RGC A;  4XBT A;  4CDL A;  3CXC 2;  2UGI A;  4ILF A;  1N9E A;  1YGW A;  2IUJ A;  2XGL A;  5CK6 A;  1TJD A;  3CNM A;  3HIG A;  1GY7 A;  4NPB A;  1BRN L;  3B4P A;  1IQX A;  3UJM A;  3LTA A;  2P09 A;  3MPH A;  1A67 A;  4XDV A;  3ZFZ A;  1PY3 A;  3KKG A;  1KQS 2;  3S28 A;  1RMS A;  2Y73 A;  1IT8 A;  4ORL A;  5AEW B;  1B2X A;  3PGB A;  1VQ4 3;  3K63 A;  2F99 A;  3X3Z A;  5AYR B;  3SOA A;  3LT8 A;  2QA4 3;  2W9P A;  3SX1 A;  1KC8 4;  4EV5 A;  1X1X A;  1LVN A;  3JUQ A;  3Q90 A;  2BNG A;  6STD A;  6RNT A;  1UCL A;  1DVD A;  1JB2 A;  1JB5 A;  3KN4 A;  2SBL A;  1B2M A;  5TGN A;  2W56 A;  3UNL A;  1UGI A;  1N5P A;  4HYZ A;  4DKI A;  5CF1 A;  1O7N B;  2KF6 A;  2Z6B A;  1AR0 A;  1S5A A;  1G96 A;  3A76 A;  3GZY B;  2P38 A;  1LOW A;  3E99 A;  2K3D A;  3BNC A;  1A2K A;  4GB5 A;  1FUT A;  5JBS A;  1G0T A;  3NV0 B;  5CF2 A;  1X1U A;  1LXE A;  4R4K A;  1OHS A;  3X42 A;  2K0M A;  4FMC A;  4L8P A;  3ZG5 A;  1EKM A;  4WYK A;  2E2U A;  1FYS A;  1OF5 A;  3K5T A;  3MHE A;  4MJD A;  4EYC A;  5M1A A;  1QAK A;  2INX A;  4IT7 A;  1M1K 4;  3D5I A;  3DGM A;  2ML6 A;  2W2C A;  1BNF A;  1RRL A;  2P05 A;  2W56 B;  2W03 A;  1JZD A;  1ZX2 A;  3AHW A;  1ULJ B;  3BND A;  2GBX B;  4BTW A;  2KCD A;  4N3V A;  4EW5 A;  2QEX 3;  1SPU A;  1OH0 A;  2CG0 A;  4HM8 B;  1I0V A;  1UI7 A;  2C10 A;  1G02 A;  4HM5 B;  3CD6 3;  1JBR A;  1KSI A;  3CNX A;  3UL5 A;  3NBB A;  1YI2 3;  5D82 A;  4RBN A;  1DE3 A;  1W6Y A;  3FCS B;  2BMO B;  2CFW A;  2YFL B;  3GZR A;  1STF I;  1D6Y A;  3CC4 3;  1I3I A;  3LZA A;  2L1S A;  4XBY A;  5D83 A;  3M8C A;  3X41 A;  1N8Q A;  1B2U A;  1RJO A;  2J8X B;  1VQQ A;  1BSC A;  3NHX A;  3G16 A;  3D79 A;  1X1Y A;  4HZ9 B;  5AIH A;  1VQM 3;  2BMQ B;  2UX0 A;  1OCV A;  2YFJ B;  1JN5 B;  1HU9 A;  3G8Z A;  3CCR 3;  1VQ7 3;  1M1X B;  3NXJ A;  4BL2 A;  1T2H A;  3GWR A;  5CXO A;  3V99 A;  1O7M B;  3FG1 A;  1VQ5 3;  3NUV A;  4FMB A;  3FF2 A;  3MSO A;  3OXA A;  5G1K A;  4EBG A;  1NU3 A;  1RDS A;  3D9R A;  1L5G B;  2R4I A;  1Q82 4;  5STD A;  4AKY A;  3J7Y d;  3HZP A;  4XB5 A;  2W6J H;  1LRA A;  1TTO A;  1UUW B;  1TFO A;  3CCM 3;  3JUN A;  5IG3 A;  2RCD A;  4KT3 B;  3ROB A;  4HOH A;  1RHL A;  4L7K A;  3EQQ B;  3IJE B;  2HMJ B;  1QAL A;  4J5G A;  2STD A;  2CK3 H;  1I2G A;  2B24 B;  1Q40 B;  3F8H A;  5M18 A;  4K1V A;  2OOV C;  4K1U A;  1Q86 4;  1FW7 A;  1WTH A;  3DGO A;  1FGT A;  3DUK A;  3EF8 A;  3BU4 A;  3Q1C A;  1B20 A;  4KVH A;  2QGU A;  2QIY A;  1QAF A;  1Y4K A;  1Q7H A;  3HOH A;  3EBY A;  3U97 A;  4EV2 A;  1BNR A;  2W9Q A;  5IER A;  1NB3 I;  2CKF B;  4H3U A;  3PCS A;  3U1W A;  1IYY A;  1QJG A;  2KRT A;  3I0Y A;  4AEQ A;  1FUW A;  3GRD A;  4GSP A;  1RNT A;  2JQ5 A;  2JDI H;  3CPO A;  4FCZ A;  3FGY A;  4NHF A;  3DXO A;  9RNT A;  1UCI A;  2RSX A;  1B27 A;  2HML B;  4N6L A;  3V92 A;  1STD A;  1RGE A;  1NDO B;  1ZO2 A;  2KXG A;  1MGW A;  3EHC A;  4H61 A;  3PCR A;  3N9H A;  1LNI A;  2Y74 A;  3F8X A;  5HGR A;  2CWV A;  1Q42 A;  2CWU A;  4MMX B;  5AYS C;  3OW2 2;  1DET A;  4R9K A;  3NQY A;  5HOH A;  1M9G A;  3NM2 A;  4BTX A;  1RCK A;  4I4K A;  4HJL B;  2R41 A;  3CCV 3;  4N6U A;  5BVB A;  3F9S A;  1JKG B;  4U13 A;  1FA3 A;  2XH9 A;  3ECF A;  3H51 A;  2GEY A;  2CFD A;  4J8T A;  3EC9 A;  2A15 A;  3DM8 A;  1SQW A;  2F4Y A;  4J5K A;  2C11 A;  1O7P B;  4R9L A;  2PZV A;  1I2F A;  3LTD A;  2GU1 A;  1NJI 4;  1WMN A;  2MF7 A;  1RTU A;  3PYJ A;  1YNV X;  1BU4 A;  3OWU A;  2WOF A;  1UGH I;  1OF5 B;  1I70 A;  4HBR A;  3STD A;  1RN1 A;  1DVC A;  3WA3 A;  3UL6 A;  3G4S 3;  1NWW A;  1ULI B;  3SLU A;  3FSD A;  1VQP 3;  5EQL A;  3JUO A;  1AVL A;  4X2H A;  4X2O A;  2BMR B;  4N6V 0;  1DYU A;  1U5O A;  3MKI A;  5AII A;  3NX0 A;  1OAC A;  1WMO A;  2OWP A;  3DGN A;  1M90 4;  1LNH A;  3KZT A;  5IEO A;  1NB5 I;  1KWI A;  1WQL B;  3BNB A;  2OTJ 3;  2HMK B;  1T2I A;  2FGT A;  4MEI A;  2Z7A A;  4LMI A;  1O7W B;  4O8S A;  4IIA A;  3EN1 B;  2V1L A;  1TP6 A;  2WOH A;  3OV4 A;  3CCS 3;  1RN4 A;  1SAR A;  3KCH A;  1UCJ A;  4LSO A;  3LML A;  1IVW A;  1RGH A;  2CFK A;  4FR9 A;  1BNJ A;  3N8B A;  4FCJ A;  4BU4 A;  2O3O A;  1OGX A;  2AAD A;  2YX9 A;  3F7X A;  1TIJ A;  4Q53 A;  3UB1 A;  3FF0 A;  3TDG A;  4O3V A;  1CYU A;  1JBS A;  4RNT A;  3JUM A;  3CC2 3;  1DMM A;  2OOV A;  3CCL 3;  1YJ9 3;  3WOF B;  1FZU A;  2H0G A;  2ML5 A;  1B21 A;  1MWU A;  1V57 A;  1W02 A;  2LQV A;  3PXM A;  4KZ1 A;  1R4Y A;  1JZO A;  1VQL 3;  2F98 A;  2BO9 B;  1W2B 2;  1BRJ A;  7GSP A;  2F5W A;  2KF4 A;  3FLJ A;  3GAX A;  4HM7 B;  2CG1 A;  1VZZ A;  1JNQ A;  3HK4 A;  1CYV A;  3WOE B;  1C7H A;  1LOV A;  2CC3 A;  3URP A;  1F8N A;  3G6E 3;  1ISK A;  3VF1 A;  1FGO A;  3CCU 3;  1GMP A;  1IV9 A;  1GMQ A;  3WMD A;  4LGQ A;  1OUN A;  1UW1 A;  2E2V A;  2GEX A;  3RGR A;  3FKA A;  2RGQ A;  5GSP A;  1O7H B;  5DRE A;  4BIR A;  3KFQ C;  2SAR A;  1V74 A;  3NBJ A;  4FMD A;  4CJN A;  3IMA B;  3KII A;  1YJW 3;  1BSD A;  1IVV A;  1K41 A;  2D1W A;  2XGN A;  3LOY A;  2ZHX B;  3GSP A;  5DRV A;  1TRQ A;  2CIU A;  1N5H A;  2D42 A;  3MYT A;  3WOD G;  4BL3 A;  1W6C A;  5M19 A;  1Q7Y 4;  1QVG 2;  3BNE A;  1GOU A;  5EEO A;  1BGS A;  1WMP A;  2IMJ A;  5I97 A;  1US1 A;  3OWY A;  4NRE A;  4HM6 B;  2CFG A;  4CCV A;  2L4V A;  3AHS A;  1BVI A;  3NV0 A;  1YIT 3;  3FG4 A;  4WHA A;  1GS3 A;  3AMO A;  1BOX A;  1GD4 A;  1RGF A;  1UUG B;  2XFT A;  3F14 A;  3FH1 A;  4WYK B;  4EXR A;  5IF6 A;  1RGG A;  4O2H A;  1U8C B;  3K7C A;  4FMA A;  3S67 A;  3PZW A;  1LOX A;  2HMN B;  3T8U A;  1UI8 A;  1MWR A;  1EEJ A;  3KSP A;  4XBX A;  3MWZ A;  4OUQ A;  5IG4 A;  4BTY A;  1TUH A;  2UUG C;  1RGA A;  2K54 A;  4N6O B;  3AGN A;  3DH2 A;  4PEJ A;  1LQM B;  3HI7 A;  1I3F A;  2OQE A;  3B4O A;  1TRP A;  1IVX A;  1IDP A;  4RZM A;  1A90 A;  2WO0 A;  1GOY A;  5IW9 A;  3ZG0 A;  3K0Z A;  5LC6 A;  1YVS A;  3S5C A;  5KP1 A;  1VQ9 3;  1EUI C;  1IV7 A;  1QMA A;  3AMO B;  3X3X A;  1MWS A;  3SYU A;  1BSE A;  3LT9 A;  2H0H A;  2O9U X;  3CME 3;  1CEW I;  1OGZ A;  3D3L A;  3DMC A;  1DMQ A;  2BHM A;  5JPU A;  3EJV A;  2KAA A;  2PNC A;  2CW9 A;  1RGK A;  1O7G B;  2GBW B;  3G0K A;  4N6N B;  2GXF A;  1D6Z A;  4HAA A;  1RSN A;  4HM3 B;  3SED A;  3I56 3;  3GZB A;  1I0X A;  2KF3 A;  1GD3 A;  1W01 A;  2CWT A;  3LTB A;  3NBR A;  4JF8 A;  5FW5 A;  1B2S A;  5IG5 A;  1K8A 4;  3RNT A;  2RFR A;  4STD A;  3QK9 A;  1W7C A;  2W0Q A;  4OK0 A;  1YHQ 3;  3HII A;  1IU7 A;  1FGM A;  1RCL A;  3FZW A;  1JRQ A;  3I55 3;  5KP3 A;  2HMM B;  1AQZ A;  3OWS A;  3O8Y A;  2IUK A;  3K9M C;  3LTC A;  4K90 B;  1JN5 A;  4HM2 B;  5RNT A;  1NO3 A;  3IPT A;  1E3V A;  3EB8 A;  1BSB A;  3DZL A;  3EX9 A;  4KFF A;  4HVN A;  4N6M A;  5CLK A;  3GZX B;  5IEP A;  1MOL A;  1JBT A;  1HKX A;  4OVM A;  2W04 A;  1B3S A;  1BNE A;  1Q40 A;  1W6G A;  4KFD A;  2GSP A;  1BRH A;  1GMR A;  1W2Z A;  4HM4 B;  4IPB A;  1PYL A;  5FGO A;  4R1K A;  5AIF A;  1MNL A;  4HKV B;  1LQG C;  2Q07 A;  2I9W A;  3BIR A;  1HYF A;  3MG1 A;  1JJ2 2;  3CU3 A;  1GOV A;  2F5M A;  3T8N A;  1BUJ A;  2FXT A;  2HOH A;  4WP5 A;  2XEP A;  3BB9 A;  1IQY A;  2CFL A;  7STD A;  3PS8 A;  5KP4 A;  1D6U A;  2LYX A;  2CX1 A;  2KF5 A;  1GYB A;  1IQ8 A;  1BSA A;  1FGQ A;  3N54 B;  1BUQ A;  1RGL A;  4WWU C;  5D81 A;  3CMA 3;  2FNQ A;  4WFO A;  2BIR A;  2GU3 A;  2XSO B;  1N8R 4;  3H3H A;  4I5Q A;  5JPP A;  1QVF 2;  2ZA4 A;  1AVK A;  2C4B A; 
#chains in the Genus database with same CATH homology
 3EE1 A;  1VQ6 3;  5A0O B;  3MG2 A;  3L0R A;  4MMZ B;  1W4N A;  5LC7 A;  3S27 A;  3T0U A;  1SJW A;  1GY6 A;  5ELU A;  3G71 3;  4MMY B;  1VQN 3;  1PFP A;  4HZB B;  4K61 A;  1E97 A;  3Q2P A;  5AI1 A;  1K9M 4;  2BT3 A;  1T5Y A;  3FG3 A;  3SVA A;  1EG9 B;  1SII A;  3CPW 2;  1YIJ 3;  4XM4 A;  3JVC A;  1DMN A;  1W5Z A;  1JB4 A;  1TU5 A;  1EQK A;  4LZI A;  3V98 A;  3OX9 A;  4G1M B;  1WNH A;  5IEN A;  4L8O A;  1E3R A;  2OQE C;  2P0X A;  1ASK A;  2P0M A;  3KE7 A;  3S29 A;  2XSH B;  1S72 3;  3CCQ 3;  1OHO A;  1VQK 3;  1K28 A;  3BLZ A;  1GY5 A;  1Z1S A;  3MG3 A;  3LXU X;  2WGO A;  1SIH A;  3B7C A;  3X40 A;  1AV4 A;  4HM1 B;  3JUP A;  3F7S A;  4O02 B;  2Z77 A;  5G2G A;  3CC7 3;  4JRF A;  1J2B A;  3HX8 A;  1A2V A;  2YFI B;  5EVH A;  3DGL A;  1CQS A;  1YVB I;  2XR8 B;  2M7O A;  2F86 B;  3KSE D;  4ZM8 A;  2ZL8 A;  1N9J A;  3X3Y A;  8CHO A;  2OTL 3;  2HMO B;  2XF3 A;  3EN8 A;  4J9A A;  3CCE 3;  2MC8 A;  3NM7 A;  1ROA A;  1YGE A;  3ER7 A;  1W00 A;  1IK3 A;  4LEH A;  2WGQ A;  1EA2 A;  4EC6 A;  1K73 4;  1PU4 A;  4RNY A;  4AKZ A;  1FGR A;  1JKG A;  2CHC A;  1OPY A;  5AEU B;  3SOY A;  2Z76 A;  1KD1 4;  1VQ8 3;  2OCT A;  5AIG A;  2B1X B;  3LH4 A;  5BXQ A;  4RNZ A;  3B8L A;  3RGA A;  3VSY A;  1OHP A;  4GL6 A;  1ROV A;  4HM0 B;  3WDG B;  4FCM A;  1TFK A;  2CH9 A;  2IA7 A;  1RRH A;  3QRD A;  3ALA A;  1R4C A;  1IVU A;  3NQZ A;  5ELJ A;  3CCJ 3;  3F40 A;  4KFE A;  1JV2 B;  3SXX A;  5IG0 A;  2XFS A;  3LYG A;  4R80 A;  1RKY A;  3RDE A;  2E2T A;  1Q81 4;  3EBT A;  4QWT A;  2ZDJ A;  1YJN 3;  1VQO 3;  4TX4 A;  4XDW A;  4N6T A;  1IT7 A;  3VGN A;  2XRX B;  1RN7 A;  3DY5 A;  3WA2 X;  1UUV B;  4CDL A;  4XBT A;  3CXC 2;  2IUJ A;  1N9E A;  2XGL A;  5CK6 A;  3CNM A;  3HIG A;  1GY7 A;  3B4P A;  1IQX A;  3UJM A;  3LTA A;  2P09 A;  3MPH A;  1A67 A;  4XDV A;  1KQS 2;  3KKG A;  3S28 A;  1VQ4 3;  2Y73 A;  1IT8 A;  4ORL A;  5AEW B;  3PGB A;  3K63 A;  2F99 A;  3X3Z A;  5AYR B;  3SOA A;  2QA4 3;  2W9P A;  3SX1 A;  1KC8 4;  4EV5 A;  1LVN A;  3JUQ A;  3Q90 A;  2BNG A;  6STD A;  1DVD A;  1JB2 A;  1JB5 A;  3KN4 A;  2SBL A;  5TGN A;  2W56 A;  3UNL A;  1N5P A;  4HYZ A;  5CF1 A;  1O7N B;  2Z6B A;  1AR0 A;  1S5A A;  1G96 A;  3A76 A;  3GZY B;  2P38 A;  3E99 A;  3BNC A;  1A2K A;  4GB5 A;  5JBS A;  3NV0 B;  5CF2 A;  1LXE A;  4R4K A;  1OHS A;  3X42 A;  2K0M A;  4FMC A;  4L8P A;  1EKM A;  4WYK A;  2E2U A;  3K5T A;  1OF5 A;  3MHE A;  4MJD A;  4EYC A;  1QAK A;  2INX A;  4IT7 A;  1M1K 4;  3DGM A;  2ML6 A;  2W2C A;  1RRL A;  2P05 A;  2W03 A;  2W56 B;  1ZX2 A;  1ULJ B;  3BND A;  2GBX B;  4BTW A;  2KCD A;  4N3V A;  2QEX 3;  1SPU A;  1OH0 A;  2CG0 A;  4HM8 B;  1UI7 A;  2C10 A;  4HM5 B;  3CD6 3;  1KSI A;  3CNX A;  3UL5 A;  3NBB A;  1YI2 3;  5D82 A;  4RBN A;  1W6Y A;  3FCS B;  2BMO B;  2CFW A;  2YFL B;  3GZR A;  1STF I;  1D6Y A;  3CC4 3;  3LZA A;  4XBY A;  5D83 A;  3M8C A;  3X41 A;  1N8Q A;  1RJO A;  3NHX A;  3G16 A;  4HZ9 B;  5AIH A;  1VQM 3;  2BMQ B;  2UX0 A;  1OCV A;  2YFJ B;  1JN5 B;  1HU9 A;  3G8Z A;  3CCR 3;  1VQ7 3;  1M1X B;  3NXJ A;  3GWR A;  5CXO A;  3V99 A;  1O7M B;  3FG1 A;  1VQ5 3;  3NUV A;  4FMB A;  3FF2 A;  3MSO A;  3OXA A;  4EBG A;  1NU3 A;  1L5G B;  3D9R A;  2R4I A;  1Q82 4;  5STD A;  4AKY A;  3J7Y d;  3HZP A;  4XB5 A;  2W6J H;  1UUW B;  1TFO A;  3CCM 3;  3JUN A;  5IG3 A;  2RCD A;  3ROB A;  4L7K A;  3EQQ B;  3IJE B;  2HMJ B;  1QAL A;  2STD A;  2CK3 H;  2B24 B;  1Q40 B;  3F8H A;  4K1V A;  2OOV C;  4K1U A;  1Q86 4;  1WTH A;  3DGO A;  1FGT A;  3DUK A;  3EF8 A;  3Q1C A;  4KVH A;  2QGU A;  2QIY A;  1QAF A;  1Y4K A;  4EV2 A;  3EBY A;  3U97 A;  2W9Q A;  5IER A;  1NB3 I;  2CKF B;  4H3U A;  3PCS A;  3U1W A;  1QJG A;  2KRT A;  3I0Y A;  4AEQ A;  1FUW A;  3GRD A;  2JQ5 A;  2JDI H;  3CPO A;  4FCZ A;  3FGY A;  4NHF A;  3DXO A;  2RSX A;  2HML B;  4N6L A;  3V92 A;  1STD A;  1NDO B;  1ZO2 A;  2KXG A;  3EHC A;  4H61 A;  3PCR A;  3N9H A;  2Y74 A;  3F8X A;  5HGR A;  2CWV A;  1Q42 A;  2CWU A;  4MMX B;  5AYS C;  3OW2 2;  4R9K A;  3NQY A;  1M9G A;  3NM2 A;  4BTX A;  4I4K A;  4HJL B;  3CCV 3;  4N6U A;  5BVB A;  3F9S A;  1JKG B;  4U13 A;  1FA3 A;  2XH9 A;  3ECF A;  3H51 A;  2GEY A;  2CFD A;  4J8T A;  3EC9 A;  2A15 A;  3DM8 A;  1SQW A;  2C11 A;  1O7P B;  4R9L A;  2PZV A;  3LTD A;  2GU1 A;  1NJI 4;  1WMN A;  2MF7 A;  3PYJ A;  3OWU A;  2WOF A;  1OF5 B;  4HBR A;  3STD A;  1DVC A;  3WA3 A;  3UL6 A;  3G4S 3;  1NWW A;  1ULI B;  3SLU A;  3FSD A;  1VQP 3;  5EQL A;  3JUO A;  1AVL A;  4X2H A;  4X2O A;  2BMR B;  4N6V 0;  1DYU A;  1U5O A;  3MKI A;  5AII A;  3NX0 A;  1OAC A;  1WMO A;  2OWP A;  3DGN A;  1M90 4;  1LNH A;  3KZT A;  5IEO A;  1NB5 I;  1KWI A;  1WQL B;  3BNB A;  2OTJ 3;  2HMK B;  2FGT A;  4MEI A;  2Z7A A;  4LMI A;  1O7W B;  4O8S A;  4IIA A;  3EN1 B;  2V1L A;  1TP6 A;  2WOH A;  3OV4 A;  3CCS 3;  4LSO A;  3LML A;  1IVW A;  2CFK A;  4FR9 A;  3N8B A;  4FCJ A;  2O3O A;  1OGX A;  2YX9 A;  3F7X A;  1TIJ A;  4Q53 A;  3UB1 A;  3FF0 A;  3TDG A;  4O3V A;  1CYU A;  3JUM A;  3CC2 3;  1DMM A;  2OOV A;  3CCL 3;  1YJ9 3;  3WOF B;  3PXM A;  2ML5 A;  2LQV A;  1W02 A;  4KZ1 A;  1VQL 3;  2F98 A;  2BO9 B;  1W2B 2;  3FLJ A;  3GAX A;  4HM7 B;  2CG1 A;  1VZZ A;  1JNQ A;  3HK4 A;  1CYV A;  3WOE B;  1C7H A;  2CC3 A;  3G6E 3;  1ISK A;  1F8N A;  3VF1 A;  1FGO A;  3CCU 3;  1IV9 A;  3WMD A;  4LGQ A;  1OUN A;  1UW1 A;  2E2V A;  2GEX A;  3RGR A;  3FKA A;  2RGQ A;  1O7H B;  5DRE A;  3KFQ C;  1V74 A;  3NBJ A;  4FMD A;  3IMA B;  3KII A;  1YJW 3;  1IVV A;  1K41 A;  2D1W A;  2XGN A;  3LOY A;  5DRV A;  2CIU A;  3MYT A;  1N5H A;  2D42 A;  3WOD G;  1Q7Y 4;  1W6C A;  1QVG 2;  3BNE A;  5EEO A;  5I97 A;  1WMP A;  2IMJ A;  1US1 A;  3OWY A;  4NRE A;  4HM6 B;  2CFG A;  4CCV A;  2L4V A;  3NV0 A;  1YIT 3;  3FG4 A;  4WHA A;  1GS3 A;  3AMO A;  1GD4 A;  4EXR A;  2XFT A;  3F14 A;  3FH1 A;  4WYK B;  5IF6 A;  4O2H A;  1U8C B;  3K7C A;  4FMA A;  3S67 A;  3PZW A;  1LOX A;  2HMN B;  3T8U A;  1UI8 A;  3KSP A;  4XBX A;  3MWZ A;  4OUQ A;  5IG4 A;  4BTY A;  1TUH A;  2K54 A;  4N6O B;  4PEJ A;  3HI7 A;  2OQE A;  3B4O A;  1IVX A;  1IDP A;  4RZM A;  1A90 A;  2WO0 A;  5IW9 A;  1VQ9 3;  3K0Z A;  5LC6 A;  3S5C A;  5KP1 A;  3AMO B;  1IV7 A;  1QMA A;  3X3X A;  3LT9 A;  2O9U X;  3CME 3;  1CEW I;  3DMC A;  1OGZ A;  3D3L A;  1DMQ A;  2BHM A;  5JPU A;  3EJV A;  2PNC A;  2CW9 A;  2GBW B;  1O7G B;  3G0K A;  4N6N B;  2GXF A;  1D6Z A;  4HM3 B;  3SED A;  3I56 3;  3GZB A;  3LTB A;  1GD3 A;  1W01 A;  2CWT A;  3NBR A;  5FW5 A;  4JF8 A;  5IG5 A;  1K8A 4;  2RFR A;  4STD A;  3QK9 A;  1W7C A;  2W0Q A;  4OK0 A;  1YHQ 3;  3HII A;  1IU7 A;  1FGM A;  3FZW A;  1JRQ A;  3I55 3;  5KP3 A;  2HMM B;  3OWS A;  3O8Y A;  2IUK A;  3K9M C;  3LTC A;  4K90 B;  1JN5 A;  4HM2 B;  1NO3 A;  3IPT A;  1E3V A;  3EB8 A;  3DZL A;  3EX9 A;  4KFF A;  4HVN A;  4N6M A;  5CLK A;  3GZX B;  5IEP A;  1MOL A;  1HKX A;  4OVM A;  2W04 A;  1Q40 A;  1W6G A;  4KFD A;  1W2Z A;  4HM4 B;  4IPB A;  5FGO A;  4R1K A;  5AIF A;  1MNL A;  4HKV B;  2Q07 A;  2I9W A;  3MG1 A;  1JJ2 2;  3CU3 A;  3T8N A;  2FXT A;  4WP5 A;  2XEP A;  3BB9 A;  1IQY A;  2CFL A;  7STD A;  3PS8 A;  5KP4 A;  1D6U A;  2LYX A;  1GYB A;  1IQ8 A;  1FGQ A;  3N54 B;  1BUQ A;  4WWU C;  5D81 A;  3CMA 3;  2FNQ A;  4WFO A;  2XSO B;  2GU3 A;  1N8R 4;  3H3H A;  5JPP A;  1QVF 2;  1AVK A;  3LT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...