2W56B

Structure of the hypothetical protein vc0508 from vibrio cholerae vsp- ii pathogenicity island
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
131
Chain Sequence
TFTASSLPVSKKLHKLLSEQLTAHYLVFNFRDKSYSADEGGFHPVEMAICQTSTGEWSIEYITDFAYMGNYYPELERNLDFDFRVGQFFVAYRGWLPMQGSRDAKELYRLWESNFLAYVDMDAYNEIAITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords VC0508
publication title Structure of the Hypothetical Protein Vc0508 from Vibrio Cholerae Vsp-II Pathogenicity Island
rcsb
source organism Vibrio cholerae
total genus 33
structure length 131
sequence length 142
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10980 DUF2787 Protein of unknown function (DUF2787)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.430 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w56B00
2W56A 2V1LA 2W56B
chains in the Genus database with same CATH superfamily
4EBGA 1QVG2 1NJI4 2PNCA 5HOHA 5DREA 3BNBA 3S27A 3B4OA 4ILFA 1CYVA 5IERA 1CYUA 5AEWB 1OGZA 4EXRA 3UJMA 4EV2A 1A2VA 5BVBA 1N9JA 1OF5A 3CCJ3 5M18A 3GWRA 5EVHA 3G713 5AIGA 1RN7A 5KP3A 5DRVA 5IENA 3MKIA 3OX9A 1YGEA 3CC73 3FG3A 2GEYA 4I5QA 4AKYA 1BNEA 2RNTA 2AADA 1LOVA 4FR9A 1Y4KA 1BU4A 2XR8B 3LYGA 2OQEC 1BNFA 3FF0A 3SOAA 2UGIA 3D4AA 1DVCA 2I9WA 2C10A 1IDPA 1W4NA 2CWTA 3V92A 1ZGXA 2WGQA 2HMLB 3E99A 3S67A 3JUNA 1T2IA 1RKYA 1PY3A 1JZDA 2XFTA 3AGOA 3EB8A 3HIGA 3LXUX 1BNIA 2BHMA 2CFLA 3WA2X 1FUWA 1JV2B 1RGKA 2OOVC 1W6GA 2PZVA 1IV7A 1RGGA 3H3HA 6RNTA 3KCHA 4OUQA 5FGOA 4HAAA 2CWUA 4FMAA 4HM7B 5AI1A 4H61A 1RGHA 4L7KA 4N6MA 3RDEA 3EBYA 1G96A 5AIFA 1VQ43 1O7GB 2HMKB 3SX1A 4R4KA 1TRPA 3DGNA 1IU7A 1QAKA 1GMPA 2CFWA 2ML6A 3CC43 1BSEA 4EW5A 2KF5A 1J2BA 5KP1A 8CHOA 1OH0A 3KE7A 4XBYA 4EV5A 2FNQA 1K8A4 1N5HA 1IK3A 1IYYA 1EEJA 2IYJA 4HZBB 1BNJA 3CME3 1UW1A 2Q07A 4HKVB 1MGRA 3HOHA 1IVVA 1Q7HA 1F8NA 1MWSA 4MJDA 2W56A 2CFKA 5M19A 2KCDA 1UCJA 9RNTA 1JKGA 2W03A 1Q40B 2QIYA 3LTAA 1HKXA 2ZL8A 3CU3A 4J8TA 4BL3A 1SJWA 1E3VA 1RMSA 4BTXA 1NB3I 3NHXA 1MOLA 1R4CA 3EQQB 2IA7A 1K9M4 1BRKA 1RJOA 2YX9A 3JVCA 4RNYA 3ZG5A 4O2HA 1TFOA 1GD4A 1GY6A 1K28A 1X1WA 1GY5A 2GBWB 4XB5A 1D6YA 2L1SA 3F8XA 4J9AA 1BRNL 3KN4A 2R41A 3DMCA 2CKFB 3NUVA 4WFOA 5BIRA 1DVDA 3QRDA 4U13A 2OTJ3 3KSPA 4KZ1A 3BNDA 3GAXA 1B20A 1BGSA 6STDA 3NXJA 4O8SA 1SPUA 1VQ63 1OHOA 1GOYA 3FH1A 1AY7A 1QVF2 3KFQC 2HMNB 1VQ73 2BU4A 3WOEB 2BNGA 3FF2A 1TP6A 2HMOB 1OHPA 3LH4A 2WO0A 1NNVA 4FMCA 1LQGC 2W04A 2Z6BA 3CD63 1LNHA 3CCL3 1I3IA 3HX8A 4ORLA 1EKMA 5ELJA 1JNQA 1PFPA 5EQLA 3X3YA 3EJVA 3PXMA 1B3SA 3PCRA 3F8HA 2ZDJA 1X1YA 2GU3A 3URPA 1WMPA 1UUWB 1MNLA 2XRXB 2LYXA 1RGFA 2Z7AA 3KIIA 8RNTA 3CCV3 3PCSA 1OACA 1RGLA 5IF6A 4HM3B 2ZA4A 2BMRB 5CXOA 1NDOB 1RN1A 5G2GA 1LXEA 1STDA 1O7NB 4N6OB 1QAFA 3VSYA 4WP5A 2F5MA 4K1UA 3FSDA 4HM6B 1Q7Y4 1VQN3 2A15A 2CW9A 5G1LA 3DY5A 1UUVB 2W9QA 1Q814 1ULJB 1EUIC 3KSED 1E97A 1I0XA 2W2CA 1STFI 2GBXB 5CLKA 2V1LA 5STDA 1Q824 1KC84 2RCDA 2J8XB 1N9EA 2P09A 3K63A 1QMAA 1M9GA 3KKGA 3OXAA 1BRJA 2INXA 4Q53A 1FUTA 4XDWA 1YIJ3 3BIRA 3CXC2 1ASKA 2F5WA 1TTOA 1SIIA 3MSOA 2BO9B 3G0KA 3NBBA 4RBNA 1DMNA 3MWZA 4WYKB 5AEUB 1S5AA 2OCTA 4KT3B 1M904 3UB1A 1UGHI 1I70A 1T5YA 1LOYA 2M7OA 1GSPA 4N6UA 3WR2A 3PGBA 3F40A 1BRGA 1YGWA 2KRTA 3Q2PA 3DUKA 3KZTA 2CHCA 1W6CA 4QWTA 4XM4A 1MWUA 4CPKA 1G02A 3D5GA 1UI7A 3GSPA 2ZHXB 1FA3A 1AR0A 4HYZA 3GZYB 3JUQA 3BB9A 4HM8B 1K41A 5AIIA 3LMLA 2QA43 4H3UA 1TFKA 3DH2A 3SVAA 1C54A 1PYLA 3NV0B 3CCQ3 2AAEA 2K3DA 3F14A 5LC6A 1ROVA 3NX0A 1I0VA 2P05A 4IPBA 3V98A 1YVSA 3NQZA 1JB4A 2GXFA 3EE1A 1BSCA 3JUMA 6GSPA 1G0TA 1IVXA 3S5CA 1BUJA 3EC9A 2C4BA 3ER7A 3WA3A 3X3ZA 3K5TA 1A67A 5JPPA 2UX0A 5TGNA 1LOXA 4XBTA 4BTWA 3N54B 4WWUC 4AKZA 3LTDA 3MHEA 4NPBA 3CCE3 1HZ1A 1KD14 1TRQA 2K54A 1JN5B 1RGCA 2O9UX 1L5GB 3WDGB 3CCU3 1RCLA 3SEDA 3LOYA 3EBTA 3EX9A 2P0MA 1AVLA 5IG4A 3J7Yd 1JBTA 1B27A 3OWUA 3JUPA 1NWWA 3T8UA 4LZIA 3CPOA 2XSHB 3HI7A 3D79A 3RGAA 3NM7A 3Q1CA 1BVIA 1KSIA 4HM1B 5ELUA 4LYLB 2H0GA 2RFRA 5M1AA 1M1K4 1ZO2A 3CMA3 2JDIH 1OF5B 1LVNA 1V74A 1KQS2 3RGRA 1B2XA 4I4KA 4JF8A 1B2MA 1TJDA 1VQQA 3X42A 3OWSA 2KF3A 2O3OA 4HZ9B 2XSOB 3CCS3 1RHLA 1JBRA 2WOFA 1MWRA 3AMOA 1W2ZA 1Z1SA 3ROBA 1FGMA 1N8QA 1W02A 3U1WA 3JUOA 2IUJA 1T3BA 1O7HB 2CG1A 4FCJA 1D6ZA 1W7CA 3GZXB 4J5GA 4KFFA 5CF1A 3F7SA 4N6LA 3EHCA 1KWIA 1OUNA 1SARA 3WMDA 3Q3FA 5EEOA 5HGRA 1YJ93 1QJGA 1OPYA 3EN8A 1FGQA 5D81A 3K0ZA 1FZUA 2STDA 1ULIB 4HOHA 3T8NA 3WHOA 5CF2A 1BIRA 4L8PA 5AYSC 1ISKA 1UDII 1RNBA 3IPTA 5KP4A 4LMIA 1ZS7A 3N8BA 4MEIA 5BU4A 1UGIA 3IJEB 4J5KA 3ECFA 1R4YA 4HVNA 3PS8A 1MWTA 2QGUA 3DXOA 1YIT3 1RRLA 1BRIA 2CWVA 4ZM8A 4MMZB 1ROAA 5I97A 1DYUA 1B2UA 2Z76A 1VQM3 1LOWA 1V57A 1I2GA 2CIUA 4RNTA 3IMAB 1IQ8A 3AHWA 2MC8A 2R4IA 3MG2A 1UCIA 3PZWA 1YHQ3 1BNRA 3A76A 3MG3A 4LEHA 3GZRA 4HM2B 1D6UA 1U8CB 1RNTA 3G6E3 1RCKA 2W56B 3LTCA 4RNZA 3VF1A 3K9MC 1JKGB 1UUGB 1VQK3 1DETA 2CH9A 1VQP3 5AYRB 1B2SA 2RBIA 2FXTA 1U5OA 1BANA 3H51A 4R9LA 2HOHA 3D3LA 5AIHA 4GL6A 1OHSA 1OGXA 4HJLB 3WODG 2OWPA 4NREA 2F99A 1BRHA 1BOXA 1CEWI 3FGYA 3LZAA 1RGAA 3MPHA 2OQEA 3FKAA 2H0HA 2WGOA 5IG5A 2XH9A 1IT7A 5IEPA 1N5PA 1K734 1A90A 3DZLA 2F86B 1YNVX 4O02B 1SQWA 4KFDA 3SXXA 3CNMA 1IQYA 2BT3A 1WQLB 1O7PB 1GY7A 5BXQA 1RSNA 3BNCA 3FLJA 5IW9A 1BNGA 1YI23 1WNHA 5JBSA 3STDA 1W2B2 2ML5A 1T2HA 2B1XB 4FCMA 2GU1A 1A2KA 4IIAA 3CC23 1US1A 1JJ22 1VQ53 1C7HA 2D1WA 3FCSB 4RZMA 2C11A 4N6V0 1O7WB 3GZBA 3M8CA 2B24B 4LSOA 4OK0A 4N3VA 5LC7A 1WMOA 4PEJA 3DM8A 1PU4A 1Q9EA 2W0QA 1Q864 2BMOB 4MMXB 1B2ZA 1W00A 1W6YA 2W9PA 3UL6A 4MMYB 1IQXA 1GS3A 1BSDA 3NBRA 1FYSA 1Q40A 3G8ZA 1AV4A 2MF7A 3ALAA 1JB5A 1RLSA 4DKIA 5CK6A 2GSPA 1IT8A 2UUGC 4HBRA 4N6NB 1GYBA 2GEXA 1DMMA 5D82A 4BU4A 1VQL3 1X1XA 5FW5A 3AHSA 4CDLA 1TU5A 2LQVA 3MG1A 3SOYA 3X40A 2JQ5A 3FZWA 4K90B 3ZG0A 3B4PA 3DGOA 3EF8A 3QK9A 7RNTA 2WOHA 3CPW2 3RNTA 2KAAA 3A5EA 1M1XB 2KF6A 1W5ZA 3FG1A 3F9SA 4LGQA 1N8R4 4EYCA 1LQMB 1A2PA 1CH0A 1I3FA 1BRSA 1NO3A 1GOUA 2P0XA 2YFIB 4HM5B 3HK4A 2HMJB 4L8OA 4WHAA 3D5IA 3BNEA 4JRFA 1JRQA 1NB5I 2F4YA 4N6TA 1I8VA 4GSPA 2HMMB 3B8LA 3WOFB 1WTHA 1BSAA 1IVUA 4TX4A 2SBLA 2Z77A 4XBXA 5IG0A 5A0OB 1VZZA 2BIRA 1Q42A 1S723 3CNXA 4IT7A 3D9RA 4G1MB 4XDVA 4BTYA 1JBSA 1UI8A 3SYUA 3B7CA 3BU4A 3LT8A 1TUHA 3PYJA 1YVBI 2RSXA 1OCVA 2RGQA 3TDGA 3L0RA 3OWYA 1IVWA 3NM2A 1GD3A 1JZOA 3CCM3 1YJW3 4AEQA 3MYTA 1E3RA 7GSPA 2CX1A 2H0IA 2CX0A 3SLUA 3X3XA 3OW22 1EG9B 2XF3A 1EQKA 1GMQA 2K0MA 1CQSA 2YFLB 3BLZA 1LNIA 1GOVA 2KF4A 3NQYA 4EC6A 1DE3A 1NU3A 4CJNA 1FW7A 1HYFA 2CC3A 3EN1B 1MGWA 3S28A 2FGTA 1V58A 1HU9A 1VQO3 1GMRA 4R1KA 1UCKA 2F56A 2IMJA 2XGLA 4FCZA 3LT9A 3F7XA 4CCVA 2CFDA 1WMNA 3HIIA 4K1VA 3U97A 3G4S3 2QEX3 3I553 3OV4A 4FMDA 1FGRA 1BAOA 4HM4B 1YJN3 2F98A 2XFSA 1DMQA 2IUKA 1AVKA 3I0YA 4BL2A 2CK3H 2IY2A 3LTBA 4WYKA 3DGYA 2YFJB 1X1UA 1B21A 3UL5A 1BSBA 4STDA 3VGNA 2E2UA 4KFEA 2OTL3 2SARA 3X41A 4GHOA 2CFGA 1SIHA 1VQ83 3O8YA 4X2OA 4X2HA 1FGOA 3DGMA 1I2FA 3DGLA 3AMOB 1ZX2A 3GRDA 1LRAA 4KVHA 5D83A 3UNLA 1BUQA 2L4VA 2CG0A 1BNSA 1RTUA 3S29A 5JPUA 3N9HA 4GB5A 1UCLA 2XGNA 3G16A 1RRHA 3CCR3 2Y73A 3NV0A 1QALA 5RNTA 2W6JH 4O3VA 1IV9A 1TIJA 1FUSA 2BMQB 2P38A 3K7CA 3T0UA 1RN4A 3Q90A 3I563 2XEPA 2Y74A 3FG4A 7STDA 1EA2A 2KXGA 5GSPA 1VQ93 3HZPA 1JB2A 4FMBA 3V99A 1W01A 1RGEA 4R9KA 4K61A 4HM0B 1I2EA 5IEOA 4BIRA 5G1KA 2E2TA 5IG3A 1RDSA 3AGNA 4NHFA 3NBJA 4R80A 3ZFZA 4OVMA 1JN5A 1FGTA 2E2VA 2D42A 1O7MB 2OOVA 1AQZA
chains in the Genus database with same CATH topology
4EBGA 1QVG2 1NJI4 2PNCA 5DREA 3BNBA 3S27A 3B4OA 1CYVA 5IERA 1CYUA 5AEWB 1OGZA 4EXRA 3UJMA 4EV2A 1A2VA 5BVBA 1N9JA 1OF5A 3CCJ3 3GWRA 5EVHA 3G713 5AIGA 1RN7A 5KP3A 5DRVA 5IENA 3MKIA 3OX9A 1YGEA 3CC73 3FG3A 2GEYA 4FR9A 1Y4KA 2XR8B 3LYGA 2OQEC 3FF0A 3SOAA 1DVCA 2I9WA 2C10A 1IDPA 1W4NA 2CWTA 3V92A 2WGQA 2HMLB 3E99A 3S67A 3JUNA 1RKYA 2XFTA 3EB8A 3HIGA 3LXUX 2BHMA 2CFLA 3WA2X 1FUWA 1JV2B 2OOVC 1W6GA 2PZVA 1IV7A 3H3HA 4OUQA 5FGOA 2CWUA 4FMAA 4HM7B 5AI1A 4H61A 4L7KA 4N6MA 3RDEA 3EBYA 1G96A 5AIFA 1VQ43 1O7GB 2HMKB 3SX1A 4R4KA 3DGNA 1IU7A 1QAKA 2CFWA 2ML6A 3CC43 1J2BA 5KP1A 8CHOA 1OH0A 3KE7A 4XBYA 4EV5A 2FNQA 1K8A4 1N5HA 1IK3A 4HZBB 3CME3 1UW1A 2Q07A 4HKVB 1IVVA 1F8NA 4MJDA 2W56A 2CFKA 2KCDA 1JKGA 2W03A 1Q40B 2QIYA 3LTAA 1HKXA 2ZL8A 3CU3A 4J8TA 1SJWA 1E3VA 4BTXA 1NB3I 3NHXA 1MOLA 1R4CA 3EQQB 2IA7A 1K9M4 1RJOA 3JVCA 2YX9A 4RNYA 4O2HA 1TFOA 1GD4A 1GY6A 1K28A 2GBWB 1GY5A 4XB5A 1D6YA 3F8XA 4J9AA 3KN4A 3DMCA 2CKFB 3NUVA 4WFOA 1DVDA 3QRDA 4U13A 2OTJ3 3KSPA 4KZ1A 3BNDA 3GAXA 6STDA 3NXJA 4O8SA 1SPUA 1VQ63 1OHOA 3FH1A 1QVF2 3KFQC 2HMNB 1VQ73 3WOEB 2BNGA 3FF2A 1TP6A 2HMOB 1OHPA 3LH4A 2WO0A 4FMCA 2W04A 2Z6BA 3CD63 1LNHA 3CCL3 3HX8A 4ORLA 1EKMA 5ELJA 1JNQA 1PFPA 5EQLA 3X3YA 3EJVA 3PXMA 3PCRA 3F8HA 2ZDJA 2GU3A 1WMPA 1UUWB 1MNLA 2XRXB 2LYXA 2Z7AA 3KIIA 3CCV3 3PCSA 1OACA 5IF6A 4HM3B 2BMRB 5CXOA 1NDOB 5G2GA 1LXEA 1STDA 1O7NB 4N6OB 1QAFA 3VSYA 4WP5A 4K1UA 3FSDA 4HM6B 1Q7Y4 1VQN3 2A15A 2CW9A 3DY5A 1UUVB 2W9QA 1Q814 1ULJB 3KSED 1Q824 1E97A 2W2CA 1STFI 2GBXB 5CLKA 2V1LA 5STDA 1KC84 2RCDA 1N9EA 2P09A 3K63A 1QMAA 1M9GA 3KKGA 3OXAA 4XDWA 2INXA 4Q53A 1YIJ3 3CXC2 1ASKA 1SIIA 3MSOA 2BO9B 3G0KA 3NBBA 4RBNA 1DMNA 3MWZA 4WYKB 5AEUB 1S5AA 2OCTA 1M904 3UB1A 1T5YA 2M7OA 4N6UA 3PGBA 3F40A 2KRTA 3Q2PA 3DUKA 3KZTA 2CHCA 1W6CA 4QWTA 4XM4A 1UI7A 1FA3A 1AR0A 4HYZA 3GZYB 3JUQA 3BB9A 4HM8B 1K41A 5AIIA 3LMLA 2QA43 4H3UA 1TFKA 3SVAA 3NV0B 3CCQ3 3F14A 5LC6A 1ROVA 3NX0A 2P05A 4IPBA 3V98A 3NQZA 1JB4A 2GXFA 3EE1A 3JUMA 1IVXA 3S5CA 3EC9A 3WA3A 3ER7A 3X3ZA 3K5TA 1A67A 5JPPA 2UX0A 5TGNA 1LOXA 4XBTA 4BTWA 3N54B 4WWUC 4AKZA 3LTDA 3MHEA 3CCE3 1KD14 2O9UX 2K54A 1JN5B 1L5GB 3CCU3 3WDGB 3SEDA 3LOYA 3EBTA 3EX9A 2P0MA 1AVLA 5IG4A 3J7Yd 3OWUA 3JUPA 1NWWA 3T8UA 4LZIA 3CPOA 2XSHB 3HI7A 3RGAA 3NM7A 3Q1CA 1KSIA 4HM1B 5ELUA 2RFRA 1M1K4 3CMA3 1ZO2A 2JDIH 1OF5B 1LVNA 1V74A 1KQS2 3RGRA 4I4KA 4JF8A 3X42A 3OWSA 2O3OA 3CCS3 4HZ9B 2XSOB 2WOFA 3AMOA 1W2ZA 1Z1SA 3ROBA 1FGMA 1N8QA 1W02A 3U1WA 3JUOA 2IUJA 1O7HB 2CG1A 4FCJA 1D6ZA 1W7CA 3GZXB 4KFFA 5CF1A 3F7SA 4N6LA 3EHCA 1KWIA 1OUNA 3WMDA 5EEOA 1YJ93 5HGRA 1QJGA 1OPYA 3EN8A 1FGQA 5D81A 3K0ZA 2STDA 5CF2A 1ULIB 3T8NA 1ISKA 4L8PA 5AYSC 3IPTA 5KP4A 4LMIA 3N8BA 4MEIA 3IJEB 3ECFA 4HVNA 3PS8A 2QGUA 3DXOA 1YIT3 1RRLA 2CWVA 4ZM8A 4MMZB 1ROAA 5I97A 1DYUA 2Z76A 1VQM3 2CIUA 3IMAB 1IQ8A 2MC8A 2R4IA 3MG2A 3PZWA 1YHQ3 3A76A 3MG3A 4LEHA 3GZRA 4HM2B 1D6UA 1U8CB 3G6E3 2W56B 3LTCA 4RNZA 3VF1A 3K9MC 1JKGB 1VQK3 2CH9A 1VQP3 5AYRB 2FXTA 1U5OA 3H51A 4R9LA 3D3LA 5AIHA 4GL6A 1OHSA 1OGXA 4HJLB 3WODG 2OWPA 4NREA 2F99A 1CEWI 3FGYA 3LZAA 3MPHA 2OQEA 3FKAA 2WGOA 5IG5A 2XH9A 1IT7A 5IEPA 1N5PA 1K734 1A90A 3DZLA 2F86B 4O02B 1SQWA 4KFDA 3SXXA 3CNMA 1IQYA 2BT3A 1WQLB 1O7PB 1GY7A 5BXQA 3BNCA 5IW9A 3FLJA 1YI23 1WNHA 5JBSA 3STDA 1W2B2 2ML5A 2B1XB 4FCMA 2GU1A 1A2KA 4IIAA 3CC23 1US1A 1JJ22 1VQ53 1C7HA 2D1WA 3FCSB 4RZMA 2C11A 4N6V0 1O7WB 3GZBA 3M8CA 2B24B 4LSOA 4OK0A 4N3VA 5LC7A 1WMOA 4PEJA 3DM8A 1PU4A 2W0QA 1Q864 2BMOB 4MMXB 1W00A 1W6YA 2W9PA 3UL6A 4MMYB 1IQXA 1GS3A 3NBRA 1Q40A 3G8ZA 1AV4A 2MF7A 3ALAA 1JB5A 5CK6A 4HBRA 1IT8A 4N6NB 1VQL3 1GYBA 2GEXA 1DMMA 5D82A 5FW5A 4CDLA 1TU5A 2LQVA 3MG1A 3SOYA 3X40A 2JQ5A 3FZWA 4K90B 3B4PA 3DGOA 3EF8A 3QK9A 2WOHA 3CPW2 1M1XB 3FG1A 1W5ZA 3F9SA 4LGQA 1N8R4 4EYCA 4AKYA 1NO3A 2P0XA 4HM5B 2YFIB 4L8OA 4WHAA 3HK4A 2HMJB 3BNEA 4JRFA 1JRQA 1NB5I 4N6TA 2HMMB 3B8LA 3WOFB 1WTHA 1IVUA 4TX4A 2SBLA 2Z77A 4XBXA 5IG0A 5A0OB 1VZZA 1Q42A 1S723 3CNXA 4IT7A 3D9RA 4G1MB 4XDVA 4BTYA 1UI8A 3B7CA 3LT8A 1TUHA 3PYJA 1YVBI 2RSXA 1OCVA 2RGQA 3TDGA 3L0RA 3OWYA 1IVWA 3NM2A 1GD3A 1YJW3 3CCM3 4AEQA 3MYTA 1E3RA 3SLUA 1EQKA 3X3XA 3OW22 1EG9B 2XF3A 2YFLB 2K0MA 1CQSA 3BLZA 3NQYA 4EC6A 1NU3A 2CC3A 3EN1B 3S28A 2FGTA 1VQO3 1HU9A 4R1KA 2IMJA 2XGLA 4FCZA 4CCVA 3LT9A 3F7XA 2CFDA 1WMNA 3HIIA 4K1VA 3U97A 3G4S3 2QEX3 3I553 3OV4A 4FMDA 1FGRA 4HM4B 1YJN3 2F98A 2XFSA 1DMQA 2IUKA 1AVKA 3I0YA 2CK3H 3LTBA 4WYKA 2YFJB 3UL5A 4STDA 3VGNA 2E2UA 4KFEA 2OTL3 3X41A 2CFGA 1SIHA 1VQ83 3O8YA 4X2OA 4X2HA 1FGOA 3DGMA 3DGLA 3AMOB 1ZX2A 3GRDA 4KVHA 5D83A 3UNLA 1BUQA 2L4VA 2CG0A 3S29A 5JPUA 3N9HA 4GB5A 2XGNA 3G16A 1RRHA 3CCR3 2Y73A 3NV0A 1QALA 2W6JH 4O3VA 1IV9A 1TIJA 2P38A 2BMQB 3K7CA 3T0UA 3I563 3Q90A 2XEPA 2Y74A 3FG4A 7STDA 1EA2A 2KXGA 1VQ93 3HZPA 1JB2A 4FMBA 3V99A 1W01A 4R9KA 4K61A 4HM0B 5IEOA 2E2TA 5IG3A 4NHFA 3NBJA 4R80A 4OVMA 1JN5A 1FGTA 2E2VA 2D42A 1O7MB 2OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W56 A;  2V1L A;  2W56 B; 
#chains in the Genus database with same CATH topology
 4EBG A;  1QVG 2;  1NJI 4;  2PNC A;  5HOH A;  5DRE A;  3BNB A;  3S27 A;  3B4O A;  4ILF A;  1CYV A;  5IER A;  1CYU A;  5AEW B;  1OGZ A;  4EXR A;  3UJM A;  4EV2 A;  1A2V A;  5BVB A;  1N9J A;  1OF5 A;  3CCJ 3;  5M18 A;  3GWR A;  5EVH A;  3G71 3;  5AIG A;  1RN7 A;  5KP3 A;  5DRV A;  5IEN A;  3MKI A;  3OX9 A;  1YGE A;  3CC7 3;  3FG3 A;  2GEY A;  4I5Q A;  4AKY A;  1BNE A;  2RNT A;  2AAD A;  1LOV A;  4FR9 A;  1Y4K A;  1BU4 A;  2XR8 B;  3LYG A;  2OQE C;  1BNF A;  3FF0 A;  3SOA A;  2UGI A;  3D4A A;  1DVC A;  2I9W A;  2C10 A;  1IDP A;  1W4N A;  2CWT A;  3V92 A;  1ZGX A;  2WGQ A;  2HML B;  3E99 A;  3S67 A;  3JUN A;  1T2I A;  1RKY A;  1PY3 A;  1JZD A;  2XFT A;  3AGO A;  3EB8 A;  3HIG A;  3LXU X;  1BNI A;  2BHM A;  2CFL A;  3WA2 X;  1FUW A;  1JV2 B;  1RGK A;  2OOV C;  1W6G A;  2PZV A;  1IV7 A;  1RGG A;  3H3H A;  6RNT A;  3KCH A;  4OUQ A;  5FGO A;  4HAA A;  2CWU A;  4FMA A;  4HM7 B;  5AI1 A;  4H61 A;  1RGH A;  4L7K A;  4N6M A;  3RDE A;  3EBY A;  1G96 A;  5AIF A;  1VQ4 3;  1O7G B;  2HMK B;  3SX1 A;  4R4K A;  1TRP A;  3DGN A;  1IU7 A;  1QAK A;  1GMP A;  2CFW A;  2ML6 A;  3CC4 3;  1BSE A;  4EW5 A;  2KF5 A;  1J2B A;  5KP1 A;  8CHO A;  1OH0 A;  3KE7 A;  4XBY A;  4EV5 A;  2FNQ A;  1K8A 4;  1N5H A;  1IK3 A;  1IYY A;  1EEJ A;  2IYJ A;  4HZB B;  1BNJ A;  3CME 3;  1UW1 A;  2Q07 A;  4HKV B;  1MGR A;  3HOH A;  1IVV A;  1Q7H A;  1F8N A;  1MWS A;  4MJD A;  2W56 A;  2CFK A;  5M19 A;  2KCD A;  1UCJ A;  9RNT A;  1JKG A;  2W03 A;  1Q40 B;  2QIY A;  3LTA A;  1HKX A;  2ZL8 A;  3CU3 A;  4J8T A;  4BL3 A;  1SJW A;  1E3V A;  1RMS A;  4BTX A;  1NB3 I;  3NHX A;  1MOL A;  1R4C A;  3EQQ B;  2IA7 A;  1K9M 4;  1BRK A;  1RJO A;  2YX9 A;  3JVC A;  4RNY A;  3ZG5 A;  4O2H A;  1TFO A;  1GD4 A;  1GY6 A;  1K28 A;  1X1W A;  1GY5 A;  2GBW B;  4XB5 A;  1D6Y A;  2L1S A;  3F8X A;  4J9A A;  1BRN L;  3KN4 A;  2R41 A;  3DMC A;  2CKF B;  3NUV A;  4WFO A;  5BIR A;  1DVD A;  3QRD A;  4U13 A;  2OTJ 3;  3KSP A;  4KZ1 A;  3BND A;  3GAX A;  1B20 A;  1BGS A;  6STD A;  3NXJ A;  4O8S A;  1SPU A;  1VQ6 3;  1OHO A;  1GOY A;  3FH1 A;  1AY7 A;  1QVF 2;  3KFQ C;  2HMN B;  1VQ7 3;  2BU4 A;  3WOE B;  2BNG A;  3FF2 A;  1TP6 A;  2HMO B;  1OHP A;  3LH4 A;  2WO0 A;  1NNV A;  4FMC A;  1LQG C;  2W04 A;  2Z6B A;  3CD6 3;  1LNH A;  3CCL 3;  1I3I A;  3HX8 A;  4ORL A;  1EKM A;  5ELJ A;  1JNQ A;  1PFP A;  5EQL A;  3X3Y A;  3EJV A;  3PXM A;  1B3S A;  3PCR A;  3F8H A;  2ZDJ A;  1X1Y A;  2GU3 A;  3URP A;  1WMP A;  1UUW B;  1MNL A;  2XRX B;  2LYX A;  1RGF A;  2Z7A A;  3KII A;  8RNT A;  3CCV 3;  3PCS A;  1OAC A;  1RGL A;  5IF6 A;  4HM3 B;  2ZA4 A;  2BMR B;  5CXO A;  1NDO B;  1RN1 A;  5G2G A;  1LXE A;  1STD A;  1O7N B;  4N6O B;  1QAF A;  3VSY A;  4WP5 A;  2F5M A;  4K1U A;  3FSD A;  4HM6 B;  1Q7Y 4;  1VQN 3;  2A15 A;  2CW9 A;  5G1L A;  3DY5 A;  1UUV B;  2W9Q A;  1Q81 4;  1ULJ B;  1EUI C;  3KSE D;  1E97 A;  1I0X A;  2W2C A;  1STF I;  2GBX B;  5CLK A;  2V1L A;  5STD A;  1Q82 4;  1KC8 4;  2RCD A;  2J8X B;  1N9E A;  2P09 A;  3K63 A;  1QMA A;  1M9G A;  3KKG A;  3OXA A;  1BRJ A;  2INX A;  4Q53 A;  1FUT A;  4XDW A;  1YIJ 3;  3BIR A;  3CXC 2;  1ASK A;  2F5W A;  1TTO A;  1SII A;  3MSO A;  2BO9 B;  3G0K A;  3NBB A;  4RBN A;  1DMN A;  3MWZ A;  4WYK B;  5AEU B;  1S5A A;  2OCT A;  4KT3 B;  1M90 4;  3UB1 A;  1UGH I;  1I70 A;  1T5Y A;  1LOY A;  2M7O A;  1GSP A;  4N6U A;  3WR2 A;  3PGB A;  3F40 A;  1BRG A;  1YGW A;  2KRT A;  3Q2P A;  3DUK A;  3KZT A;  2CHC A;  1W6C A;  4QWT A;  4XM4 A;  1MWU A;  4CPK A;  1G02 A;  3D5G A;  1UI7 A;  3GSP A;  2ZHX B;  1FA3 A;  1AR0 A;  4HYZ A;  3GZY B;  3JUQ A;  3BB9 A;  4HM8 B;  1K41 A;  5AII A;  3LML A;  2QA4 3;  4H3U A;  1TFK A;  3DH2 A;  3SVA A;  1C54 A;  1PYL A;  3NV0 B;  3CCQ 3;  2AAE A;  2K3D A;  3F14 A;  5LC6 A;  1ROV A;  3NX0 A;  1I0V A;  2P05 A;  4IPB A;  3V98 A;  1YVS A;  3NQZ A;  1JB4 A;  2GXF A;  3EE1 A;  1BSC A;  3JUM A;  6GSP A;  1G0T A;  1IVX A;  3S5C A;  1BUJ A;  3EC9 A;  2C4B A;  3ER7 A;  3WA3 A;  3X3Z A;  3K5T A;  1A67 A;  5JPP A;  2UX0 A;  5TGN A;  1LOX A;  4XBT A;  4BTW A;  3N54 B;  4WWU C;  4AKZ A;  3LTD A;  3MHE A;  4NPB A;  3CCE 3;  1HZ1 A;  1KD1 4;  1TRQ A;  2K54 A;  1JN5 B;  1RGC A;  2O9U X;  1L5G B;  3WDG B;  3CCU 3;  1RCL A;  3SED A;  3LOY A;  3EBT A;  3EX9 A;  2P0M A;  1AVL A;  5IG4 A;  3J7Y d;  1JBT A;  1B27 A;  3OWU A;  3JUP A;  1NWW A;  3T8U A;  4LZI A;  3CPO A;  2XSH B;  3HI7 A;  3D79 A;  3RGA A;  3NM7 A;  3Q1C A;  1BVI A;  1KSI A;  4HM1 B;  5ELU A;  4LYL B;  2H0G A;  2RFR A;  5M1A A;  1M1K 4;  1ZO2 A;  3CMA 3;  2JDI H;  1OF5 B;  1LVN A;  1V74 A;  1KQS 2;  3RGR A;  1B2X A;  4I4K A;  4JF8 A;  1B2M A;  1TJD A;  1VQQ A;  3X42 A;  3OWS A;  2KF3 A;  2O3O A;  4HZ9 B;  2XSO B;  3CCS 3;  1RHL A;  1JBR A;  2WOF A;  1MWR A;  3AMO A;  1W2Z A;  1Z1S A;  3ROB A;  1FGM A;  1N8Q A;  1W02 A;  3U1W A;  3JUO A;  2IUJ A;  1T3B A;  1O7H B;  2CG1 A;  4FCJ A;  1D6Z A;  1W7C A;  3GZX B;  4J5G A;  4KFF A;  5CF1 A;  3F7S A;  4N6L A;  3EHC A;  1KWI A;  1OUN A;  1SAR A;  3WMD A;  3Q3F A;  5EEO A;  5HGR A;  1YJ9 3;  1QJG A;  1OPY A;  3EN8 A;  1FGQ A;  5D81 A;  3K0Z A;  1FZU A;  2STD A;  1ULI B;  4HOH A;  3T8N A;  3WHO A;  5CF2 A;  1BIR A;  4L8P A;  5AYS C;  1ISK A;  1UDI I;  1RNB A;  3IPT A;  5KP4 A;  4LMI A;  1ZS7 A;  3N8B A;  4MEI A;  5BU4 A;  1UGI A;  3IJE B;  4J5K A;  3ECF A;  1R4Y A;  4HVN A;  3PS8 A;  1MWT A;  2QGU A;  3DXO A;  1YIT 3;  1RRL A;  1BRI A;  2CWV A;  4ZM8 A;  4MMZ B;  1ROA A;  5I97 A;  1DYU A;  1B2U A;  2Z76 A;  1VQM 3;  1LOW A;  1V57 A;  1I2G A;  2CIU A;  4RNT A;  3IMA B;  1IQ8 A;  3AHW A;  2MC8 A;  2R4I A;  3MG2 A;  1UCI A;  3PZW A;  1YHQ 3;  1BNR A;  3A76 A;  3MG3 A;  4LEH A;  3GZR A;  4HM2 B;  1D6U A;  1U8C B;  1RNT A;  3G6E 3;  1RCK A;  2W56 B;  3LTC A;  4RNZ A;  3VF1 A;  3K9M C;  1JKG B;  1UUG B;  1VQK 3;  1DET A;  2CH9 A;  1VQP 3;  5AYR B;  1B2S A;  2RBI A;  2FXT A;  1U5O A;  1BAN A;  3H51 A;  4R9L A;  2HOH A;  3D3L A;  5AIH A;  4GL6 A;  1OHS A;  1OGX A;  4HJL B;  3WOD G;  2OWP A;  4NRE A;  2F99 A;  1BRH A;  1BOX A;  1CEW I;  3FGY A;  3LZA A;  1RGA A;  3MPH A;  2OQE A;  3FKA A;  2H0H A;  2WGO A;  5IG5 A;  2XH9 A;  1IT7 A;  5IEP A;  1N5P A;  1K73 4;  1A90 A;  3DZL A;  2F86 B;  1YNV X;  4O02 B;  1SQW A;  4KFD A;  3SXX A;  3CNM A;  1IQY A;  2BT3 A;  1WQL B;  1O7P B;  1GY7 A;  5BXQ A;  1RSN A;  3BNC A;  3FLJ A;  5IW9 A;  1BNG A;  1YI2 3;  1WNH A;  5JBS A;  3STD A;  1W2B 2;  2ML5 A;  1T2H A;  2B1X B;  4FCM A;  2GU1 A;  1A2K A;  4IIA A;  3CC2 3;  1US1 A;  1JJ2 2;  1VQ5 3;  1C7H A;  2D1W A;  3FCS B;  4RZM A;  2C11 A;  4N6V 0;  1O7W B;  3GZB A;  3M8C A;  2B24 B;  4LSO A;  4OK0 A;  4N3V A;  5LC7 A;  1WMO A;  4PEJ A;  3DM8 A;  1PU4 A;  1Q9E A;  2W0Q A;  1Q86 4;  2BMO B;  4MMX B;  1B2Z A;  1W00 A;  1W6Y A;  2W9P A;  3UL6 A;  4MMY B;  1IQX A;  1GS3 A;  1BSD A;  3NBR A;  1FYS A;  1Q40 A;  3G8Z A;  1AV4 A;  2MF7 A;  3ALA A;  1JB5 A;  1RLS A;  4DKI A;  5CK6 A;  2GSP A;  1IT8 A;  2UUG C;  4HBR A;  4N6N B;  1GYB A;  2GEX A;  1DMM A;  5D82 A;  4BU4 A;  1VQL 3;  1X1X A;  5FW5 A;  3AHS A;  4CDL A;  1TU5 A;  2LQV A;  3MG1 A;  3SOY A;  3X40 A;  2JQ5 A;  3FZW A;  4K90 B;  3ZG0 A;  3B4P A;  3DGO A;  3EF8 A;  3QK9 A;  7RNT A;  2WOH A;  3CPW 2;  3RNT A;  2KAA A;  3A5E A;  1M1X B;  2KF6 A;  1W5Z A;  3FG1 A;  3F9S A;  4LGQ A;  1N8R 4;  4EYC A;  1LQM B;  1A2P A;  1CH0 A;  1I3F A;  1BRS A;  1NO3 A;  1GOU A;  2P0X A;  2YFI B;  4HM5 B;  3HK4 A;  2HMJ B;  4L8O A;  4WHA A;  3D5I A;  3BNE A;  4JRF A;  1JRQ A;  1NB5 I;  2F4Y A;  4N6T A;  1I8V A;  4GSP A;  2HMM B;  3B8L A;  3WOF B;  1WTH A;  1BSA A;  1IVU A;  4TX4 A;  2SBL A;  2Z77 A;  4XBX A;  5IG0 A;  5A0O B;  1VZZ A;  2BIR A;  1Q42 A;  1S72 3;  3CNX A;  4IT7 A;  3D9R A;  4G1M B;  4XDV A;  4BTY A;  1JBS A;  1UI8 A;  3SYU A;  3B7C A;  3BU4 A;  3LT8 A;  1TUH A;  3PYJ A;  1YVB I;  2RSX A;  1OCV A;  2RGQ A;  3TDG A;  3L0R A;  3OWY A;  1IVW A;  3NM2 A;  1GD3 A;  1JZO A;  3CCM 3;  1YJW 3;  4AEQ A;  3MYT A;  1E3R A;  7GSP A;  2CX1 A;  2H0I A;  2CX0 A;  3SLU A;  3X3X A;  3OW2 2;  1EG9 B;  2XF3 A;  1EQK A;  1GMQ A;  2K0M A;  1CQS A;  2YFL B;  3BLZ A;  1LNI A;  1GOV A;  2KF4 A;  3NQY A;  4EC6 A;  1DE3 A;  1NU3 A;  4CJN A;  1FW7 A;  1HYF A;  2CC3 A;  3EN1 B;  1MGW A;  3S28 A;  2FGT A;  1V58 A;  1HU9 A;  1VQO 3;  1GMR A;  4R1K A;  1UCK A;  2F56 A;  2IMJ A;  2XGL A;  4FCZ A;  3LT9 A;  3F7X A;  4CCV A;  2CFD A;  1WMN A;  3HII A;  4K1V A;  3U97 A;  3G4S 3;  2QEX 3;  3I55 3;  3OV4 A;  4FMD A;  1FGR A;  1BAO A;  4HM4 B;  1YJN 3;  2F98 A;  2XFS A;  1DMQ A;  2IUK A;  1AVK A;  3I0Y A;  4BL2 A;  2CK3 H;  2IY2 A;  3LTB A;  4WYK A;  3DGY A;  2YFJ B;  1X1U A;  1B21 A;  3UL5 A;  1BSB A;  4STD A;  3VGN A;  2E2U A;  4KFE A;  2OTL 3;  2SAR A;  3X41 A;  4GHO A;  2CFG A;  1SIH A;  1VQ8 3;  3O8Y A;  4X2O A;  4X2H A;  1FGO A;  3DGM A;  1I2F A;  3DGL A;  3AMO B;  1ZX2 A;  3GRD A;  1LRA A;  4KVH A;  5D83 A;  3UNL A;  1BUQ A;  2L4V A;  2CG0 A;  1BNS A;  1RTU A;  3S29 A;  5JPU A;  3N9H A;  4GB5 A;  1UCL A;  2XGN A;  3G16 A;  1RRH A;  3CCR 3;  2Y73 A;  3NV0 A;  1QAL A;  5RNT A;  2W6J H;  4O3V A;  1IV9 A;  1TIJ A;  1FUS A;  2BMQ B;  2P38 A;  3K7C A;  3T0U A;  1RN4 A;  3Q90 A;  3I56 3;  2XEP A;  2Y74 A;  3FG4 A;  7STD A;  1EA2 A;  2KXG A;  5GSP A;  1VQ9 3;  3HZP A;  1JB2 A;  4FMB A;  3V99 A;  1W01 A;  1RGE A;  4R9K A;  4K61 A;  4HM0 B;  1I2E A;  5IEO A;  4BIR A;  5G1K A;  2E2T A;  5IG3 A;  1RDS A;  3AGN A;  4NHF A;  3NBJ A;  4R80 A;  3ZFZ A;  4OVM A;  1JN5 A;  1FGT A;  2E2V A;  2D42 A;  1O7M B;  2OOV A;  1AQZ A; 
#chains in the Genus database with same CATH homology
 4EBG A;  1QVG 2;  1NJI 4;  2PNC A;  5DRE A;  3BNB A;  3S27 A;  3B4O A;  1CYV A;  5IER A;  1CYU A;  5AEW B;  1OGZ A;  4EXR A;  3UJM A;  4EV2 A;  1A2V A;  5BVB A;  1N9J A;  1OF5 A;  3CCJ 3;  3GWR A;  5EVH A;  3G71 3;  5AIG A;  1RN7 A;  5KP3 A;  5DRV A;  5IEN A;  3MKI A;  3OX9 A;  1YGE A;  3CC7 3;  3FG3 A;  2GEY A;  4FR9 A;  1Y4K A;  2XR8 B;  3LYG A;  2OQE C;  3FF0 A;  3SOA A;  1DVC A;  2I9W A;  2C10 A;  1IDP A;  1W4N A;  2CWT A;  3V92 A;  2WGQ A;  2HML B;  3E99 A;  3S67 A;  3JUN A;  1RKY A;  2XFT A;  3EB8 A;  3HIG A;  3LXU X;  2BHM A;  2CFL A;  3WA2 X;  1FUW A;  1JV2 B;  2OOV C;  1W6G A;  2PZV A;  1IV7 A;  3H3H A;  4OUQ A;  5FGO A;  2CWU A;  4FMA A;  4HM7 B;  5AI1 A;  4H61 A;  4L7K A;  4N6M A;  3RDE A;  3EBY A;  1G96 A;  5AIF A;  1VQ4 3;  1O7G B;  2HMK B;  3SX1 A;  4R4K A;  3DGN A;  1IU7 A;  1QAK A;  2CFW A;  2ML6 A;  3CC4 3;  1J2B A;  5KP1 A;  8CHO A;  1OH0 A;  3KE7 A;  4XBY A;  4EV5 A;  2FNQ A;  1K8A 4;  1N5H A;  1IK3 A;  4HZB B;  3CME 3;  1UW1 A;  2Q07 A;  4HKV B;  1IVV A;  1F8N A;  4MJD A;  2W56 A;  2CFK A;  2KCD A;  1JKG A;  2W03 A;  1Q40 B;  2QIY A;  3LTA A;  1HKX A;  2ZL8 A;  3CU3 A;  4J8T A;  1SJW A;  1E3V A;  4BTX A;  1NB3 I;  3NHX A;  1MOL A;  1R4C A;  3EQQ B;  2IA7 A;  1K9M 4;  1RJO A;  3JVC A;  2YX9 A;  4RNY A;  4O2H A;  1TFO A;  1GD4 A;  1GY6 A;  1K28 A;  2GBW B;  1GY5 A;  4XB5 A;  1D6Y A;  3F8X A;  4J9A A;  3KN4 A;  3DMC A;  2CKF B;  3NUV A;  4WFO A;  1DVD A;  3QRD A;  4U13 A;  2OTJ 3;  3KSP A;  4KZ1 A;  3BND A;  3GAX A;  6STD A;  3NXJ A;  4O8S A;  1SPU A;  1VQ6 3;  1OHO A;  3FH1 A;  1QVF 2;  3KFQ C;  2HMN B;  1VQ7 3;  3WOE B;  2BNG A;  3FF2 A;  1TP6 A;  2HMO B;  1OHP A;  3LH4 A;  2WO0 A;  4FMC A;  2W04 A;  2Z6B A;  3CD6 3;  1LNH A;  3CCL 3;  3HX8 A;  4ORL A;  1EKM A;  5ELJ A;  1JNQ A;  1PFP A;  5EQL A;  3X3Y A;  3EJV A;  3PXM A;  3PCR A;  3F8H A;  2ZDJ A;  2GU3 A;  1WMP A;  1UUW B;  1MNL A;  2XRX B;  2LYX A;  2Z7A A;  3KII A;  3CCV 3;  3PCS A;  1OAC A;  5IF6 A;  4HM3 B;  2BMR B;  5CXO A;  1NDO B;  5G2G A;  1LXE A;  1STD A;  1O7N B;  4N6O B;  1QAF A;  3VSY A;  4WP5 A;  4K1U A;  3FSD A;  4HM6 B;  1Q7Y 4;  1VQN 3;  2A15 A;  2CW9 A;  3DY5 A;  1UUV B;  2W9Q A;  1Q81 4;  1ULJ B;  3KSE D;  1Q82 4;  1E97 A;  2W2C A;  1STF I;  2GBX B;  5CLK A;  2V1L A;  5STD A;  1KC8 4;  2RCD A;  1N9E A;  2P09 A;  3K63 A;  1QMA A;  1M9G A;  3KKG A;  3OXA A;  4XDW A;  2INX A;  4Q53 A;  1YIJ 3;  3CXC 2;  1ASK A;  1SII A;  3MSO A;  2BO9 B;  3G0K A;  3NBB A;  4RBN A;  1DMN A;  3MWZ A;  4WYK B;  5AEU B;  1S5A A;  2OCT A;  1M90 4;  3UB1 A;  1T5Y A;  2M7O A;  4N6U A;  3PGB A;  3F40 A;  2KRT A;  3Q2P A;  3DUK A;  3KZT A;  2CHC A;  1W6C A;  4QWT A;  4XM4 A;  1UI7 A;  1FA3 A;  1AR0 A;  4HYZ A;  3GZY B;  3JUQ A;  3BB9 A;  4HM8 B;  1K41 A;  5AII A;  3LML A;  2QA4 3;  4H3U A;  1TFK A;  3SVA A;  3NV0 B;  3CCQ 3;  3F14 A;  5LC6 A;  1ROV A;  3NX0 A;  2P05 A;  4IPB A;  3V98 A;  3NQZ A;  1JB4 A;  2GXF A;  3EE1 A;  3JUM A;  1IVX A;  3S5C A;  3EC9 A;  3WA3 A;  3ER7 A;  3X3Z A;  3K5T A;  1A67 A;  5JPP A;  2UX0 A;  5TGN A;  1LOX A;  4XBT A;  4BTW A;  3N54 B;  4WWU C;  4AKZ A;  3LTD A;  3MHE A;  3CCE 3;  1KD1 4;  2O9U X;  2K54 A;  1JN5 B;  1L5G B;  3CCU 3;  3WDG B;  3SED A;  3LOY A;  3EBT A;  3EX9 A;  2P0M A;  1AVL A;  5IG4 A;  3J7Y d;  3OWU A;  3JUP A;  1NWW A;  3T8U A;  4LZI A;  3CPO A;  2XSH B;  3HI7 A;  3RGA A;  3NM7 A;  3Q1C A;  1KSI A;  4HM1 B;  5ELU A;  2RFR A;  1M1K 4;  3CMA 3;  1ZO2 A;  2JDI H;  1OF5 B;  1LVN A;  1V74 A;  1KQS 2;  3RGR A;  4I4K A;  4JF8 A;  3X42 A;  3OWS A;  2O3O A;  3CCS 3;  4HZ9 B;  2XSO B;  2WOF A;  3AMO A;  1W2Z A;  1Z1S A;  3ROB A;  1FGM A;  1N8Q A;  1W02 A;  3U1W A;  3JUO A;  2IUJ A;  1O7H B;  2CG1 A;  4FCJ A;  1D6Z A;  1W7C A;  3GZX B;  4KFF A;  5CF1 A;  3F7S A;  4N6L A;  3EHC A;  1KWI A;  1OUN A;  3WMD A;  5EEO A;  1YJ9 3;  5HGR A;  1QJG A;  1OPY A;  3EN8 A;  1FGQ A;  5D81 A;  3K0Z A;  2STD A;  5CF2 A;  1ULI B;  3T8N A;  1ISK A;  4L8P A;  5AYS C;  3IPT A;  5KP4 A;  4LMI A;  3N8B A;  4MEI A;  3IJE B;  3ECF A;  4HVN A;  3PS8 A;  2QGU A;  3DXO A;  1YIT 3;  1RRL A;  2CWV A;  4ZM8 A;  4MMZ B;  1ROA A;  5I97 A;  1DYU A;  2Z76 A;  1VQM 3;  2CIU A;  3IMA B;  1IQ8 A;  2MC8 A;  2R4I A;  3MG2 A;  3PZW A;  1YHQ 3;  3A76 A;  3MG3 A;  4LEH A;  3GZR A;  4HM2 B;  1D6U A;  1U8C B;  3G6E 3;  2W56 B;  3LTC A;  4RNZ A;  3VF1 A;  3K9M C;  1JKG B;  1VQK 3;  2CH9 A;  1VQP 3;  5AYR B;  2FXT A;  1U5O A;  3H51 A;  4R9L A;  3D3L A;  5AIH A;  4GL6 A;  1OHS A;  1OGX A;  4HJL B;  3WOD G;  2OWP A;  4NRE A;  2F99 A;  1CEW I;  3FGY A;  3LZA A;  3MPH A;  2OQE A;  3FKA A;  2WGO A;  5IG5 A;  2XH9 A;  1IT7 A;  5IEP A;  1N5P A;  1K73 4;  1A90 A;  3DZL A;  2F86 B;  4O02 B;  1SQW A;  4KFD A;  3SXX A;  3CNM A;  1IQY A;  2BT3 A;  1WQL B;  1O7P B;  1GY7 A;  5BXQ A;  3BNC A;  5IW9 A;  3FLJ A;  1YI2 3;  1WNH A;  5JBS A;  3STD A;  1W2B 2;  2ML5 A;  2B1X B;  4FCM A;  2GU1 A;  1A2K A;  4IIA A;  3CC2 3;  1US1 A;  1JJ2 2;  1VQ5 3;  1C7H A;  2D1W A;  3FCS B;  4RZM A;  2C11 A;  4N6V 0;  1O7W B;  3GZB A;  3M8C A;  2B24 B;  4LSO A;  4OK0 A;  4N3V A;  5LC7 A;  1WMO A;  4PEJ A;  3DM8 A;  1PU4 A;  2W0Q A;  1Q86 4;  2BMO B;  4MMX B;  1W00 A;  1W6Y A;  2W9P A;  3UL6 A;  4MMY B;  1IQX A;  1GS3 A;  3NBR A;  1Q40 A;  3G8Z A;  1AV4 A;  2MF7 A;  3ALA A;  1JB5 A;  5CK6 A;  4HBR A;  1IT8 A;  4N6N B;  1VQL 3;  1GYB A;  2GEX A;  1DMM A;  5D82 A;  5FW5 A;  4CDL A;  1TU5 A;  2LQV A;  3MG1 A;  3SOY A;  3X40 A;  2JQ5 A;  3FZW A;  4K90 B;  3B4P A;  3DGO A;  3EF8 A;  3QK9 A;  2WOH A;  3CPW 2;  1M1X B;  3FG1 A;  1W5Z A;  3F9S A;  4LGQ A;  1N8R 4;  4EYC A;  4AKY A;  1NO3 A;  2P0X A;  4HM5 B;  2YFI B;  4L8O A;  4WHA A;  3HK4 A;  2HMJ B;  3BNE A;  4JRF A;  1JRQ A;  1NB5 I;  4N6T A;  2HMM B;  3B8L A;  3WOF B;  1WTH A;  1IVU A;  4TX4 A;  2SBL A;  2Z77 A;  4XBX A;  5IG0 A;  5A0O B;  1VZZ A;  1Q42 A;  1S72 3;  3CNX A;  4IT7 A;  3D9R A;  4G1M B;  4XDV A;  4BTY A;  1UI8 A;  3B7C A;  3LT8 A;  1TUH A;  3PYJ A;  1YVB I;  2RSX A;  1OCV A;  2RGQ A;  3TDG A;  3L0R A;  3OWY A;  1IVW A;  3NM2 A;  1GD3 A;  1YJW 3;  3CCM 3;  4AEQ A;  3MYT A;  1E3R A;  3SLU A;  1EQK A;  3X3X A;  3OW2 2;  1EG9 B;  2XF3 A;  2YFL B;  2K0M A;  1CQS A;  3BLZ A;  3NQY A;  4EC6 A;  1NU3 A;  2CC3 A;  3EN1 B;  3S28 A;  2FGT A;  1VQO 3;  1HU9 A;  4R1K A;  2IMJ A;  2XGL A;  4FCZ A;  4CCV A;  3LT9 A;  3F7X A;  2CFD A;  1WMN A;  3HII A;  4K1V A;  3U97 A;  3G4S 3;  2QEX 3;  3I55 3;  3OV4 A;  4FMD A;  1FGR A;  4HM4 B;  1YJN 3;  2F98 A;  2XFS A;  1DMQ A;  2IUK A;  1AVK A;  3I0Y A;  2CK3 H;  3LTB A;  4WYK A;  2YFJ B;  3UL5 A;  4STD A;  3VGN A;  2E2U A;  4KFE A;  2OTL 3;  3X41 A;  2CFG A;  1SIH A;  1VQ8 3;  3O8Y A;  4X2O A;  4X2H A;  1FGO A;  3DGM A;  3DGL A;  3AMO B;  1ZX2 A;  3GRD A;  4KVH A;  5D83 A;  3UNL A;  1BUQ A;  2L4V A;  2CG0 A;  3S29 A;  5JPU A;  3N9H A;  4GB5 A;  2XGN A;  3G16 A;  1RRH A;  3CCR 3;  2Y73 A;  3NV0 A;  1QAL A;  2W6J H;  4O3V A;  1IV9 A;  1TIJ A;  2P38 A;  2BMQ B;  3K7C A;  3T0U A;  3I56 3;  3Q90 A;  2XEP A;  2Y74 A;  3FG4 A;  7STD A;  1EA2 A;  2KXG A;  1VQ9 3;  3HZP A;  1JB2 A;  4FMB A;  3V99 A;  1W01 A;  4R9K A;  4K61 A;  4HM0 B;  5IEO A;  2E2T A;  5IG3 A;  4NHF A;  3NBJ A;  4R80 A;  4OVM A;  1JN5 A;  1FGT A;  2E2V A;  2D42 A;  1O7M B;  2OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...