1TRPA

X-ray crystallographic and calorimeric studies of the effects of the mutation trp 59 tyr in ribonuclease t1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNWEGFDFSVSSPYYEYPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title X-ray crystallographic and calorimetric studies of the effects of the mutation Trp59-->Tyr in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 23
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1trpA00
1GSPA 8RNTA 1I70A 1I8VA 1I0XA 1TRQA 1X1XA 2ZA4A 2F4YA 1RN4A 3BIRA 1RNTA 1A2PA 1BSBA 1RGHA 1YVSA 1B2XA 2KF3A 1BOXA 3D5IA 1FW7A 3GSPA 1RMSA 1YNVX 4BU4A 1GMRA 1MGWA 3HOHA 2AAEA 3WR2A 2KAAA 1UCKA 1IYYA 1B2SA 1BNGA 1YGWA 1BNFA 1B3SA 3D4AA 1RGFA 1RGLA 3AGOA 3SYUA 5RNTA 2SARA 1JBSA 1B2UA 4J5GA 2F56A 1BUJA 1BSCA 1G02A 1RTUA 1UCJA 1B27A 1FUTA 2AADA 1BU4A 1BNEA 1LOYA 2KF6A 6GSPA 3RNTA 1R4YA 1DE3A 1CH0A 2F5MA 4HOHA 1BNRA 2BIRA 3URPA 1LNIA 2GSPA 2RNTA 3AGNA 1RGAA 1HZ1A 4GSPA 1B2ZA 1ZGXA 1DETA 1AQZA 1C54A 1X1UA 2C4BA 1RGKA 3KCHA 3DGYA 9RNTA 1TTOA 2F5WA 1RCKA 1BIRA 1RDSA 4BIRA 4GHOA 5BU4A 2BU4A 1BNJA 6RNTA 1BSEA 2KF5A 1BSDA 1GOYA 1X1WA 1I3IA 1I2FA 5BIRA 1TRPA 1BRKA 1RGCA 1T2HA 1X1YA 3DH2A 1AY7A 1GOVA 1I2GA 1FYSA 2RBIA 1BNIA 1Q9EA 7GSPA 7RNTA 2KF4A 2HOHA 1B21A 1RGEA 1RCLA 1I2EA 3Q3FA 1RLSA 1MGRA 1GOUA 1RGGA 1BRIA 1BAOA 4HAAA 1JBTA 1FUSA 1I3FA 3D5GA 1RNBA 1LRAA 1LOVA 5HOHA 1UCIA 1FZUA 1GMPA 1BNSA 1BANA 1PYLA 4RNTA 1BRJA 3WHOA 1BVIA 5GSPA 1UCLA 1RN1A 1B2MA 1GMQA 4J5KA 1JBRA 1T2IA 1BRGA 1BGSA 1RHLA 1LOWA 1I0VA 3A5EA 1BRNL 1HYFA 1BSAA 3AHWA 1BRSA 1PY3A 3BU4A 1SARA 1RSNA 1BRHA 3AHSA 1B20A
chains in the Genus database with same CATH superfamily
4H61A 3DY5A 1VQ43 8RNTA 3MG1A 1I8VA 1Z1SA 1GD3A 1A2VA 1TIJA 1X1XA 5KP4A 1RN4A 5AEUB 5AYSC 3CXC2 2BMRB 1BSBA 2SBLA 3K63A 2RFRA 1K734 5IERA 3F14A 4KZ1A 1J2BA 3GSPA 1RMSA 3DGLA 3LH4A 3RDEA 4BU4A 3NUVA 3HOHA 4HM4B 3S27A 2AAEA 4LGQA 2WO0A 1ULIB 5EVHA 4WFOA 5ELJA 3HIIA 5M19A 1BNFA 1B3SA 4XM4A 1V74A 5A0OB 1JB4A 4R1KA 2Z76A 3JUMA 3MSOA 1M1XB 2IA7A 4HM3B 3G8ZA 1NU3A 2F86B 3SYUA 1YJN3 5LC6A 3EJVA 3E99A 3HI7A 1K9M4 1JBSA 2F98A 1QMAA 2UX0A 3IPTA 3CMA3 1AVLA 1NWWA 1OACA 2XH9A 3CCV3 2KF6A 1BU4A 2OTJ3 3ER7A 2CFGA 3RNTA 3CPOA 5AEWB 4KT3B 4GB5A 4HOHA 1FUWA 4R9KA 4RNYA 1KD14 4WWUC 1HKXA 5D82A 3EB8A 2ZDJA 3BNDA 3X3XA 3F8HA 4N6TA 3SLUA 1FGOA 2RNTA 3VSYA 3Q2PA 2A15A 4GSPA 4HM1B 1ZGXA 1WTHA 4IIAA 1AQZA 4BL2A 1C54A 1IVUA 4EV5A 4WP5A 5ELUA 3MKIA 1QVF2 1SQWA 3FF2A 3UNLA 3X3YA 1AVKA 3CME3 1VQL3 3FLJA 1U8CB 3GWRA 3CCU3 2XFTA 5EEOA 1A67A 4X2HA 5IENA 3LT8A 3UJMA 2BU4A 1MWTA 3LTBA 2E2UA 1YIT3 2OCTA 2YX9A 4O02B 3NQYA 3UL5A 4XBTA 1X1WA 2W9PA 3PZWA 1GD4A 3NBBA 4GL6A 1A2KA 3CC73 1I2FA 2XF3A 2WOHA 3B8LA 3JUQA 1BRKA 1V58A 1GYBA 3X3ZA 3CCS3 2BHMA 1AY7A 1GOVA 1WMNA 2YFJB 4K1VA 5FW5A 1VQK3 4K1UA 2RBIA 3WOFB 3L0RA 2P38A 2MF7A 2O3OA 4J8TA 3WOEB 1RGEA 1I2EA 1RCLA 1MNLA 3RGAA 2PNCA 3OV4A 1N5HA 5IEOA 1MGRA 1WMPA 2QA43 5KP3A 1FUSA 4HJLB 3ZG0A 1JZOA 1UCIA 4FMBA 1UUWB 1BNSA 3SXXA 1BANA 3WHOA 3KSED 1BVIA 4HBRA 3OXAA 4JF8A 1IDPA 4HYZA 4LZIA 1B2MA 3HX8A 3FCSB 3FG3A 2Y73A 1JB5A 1BGSA 5JPPA 1VQN3 1FGRA 3K9MC 3ROBA 3LZAA 1I0VA 1YJW3 4BTXA 4XDVA 3SVAA 1OHSA 1KWIA 1JB2A 1ROVA 1RRHA 1DE3A 5IG0A 2BO9B 2CFWA 1KSIA 1MOLA 2CW9A 4R80A 4RNZA 1I70A 1SIIA 4FMDA 1TRQA 3CCE3 3CCR3 2F4YA 3BIRA 1N8QA 2CKFB 1AR0A 2HMKB 4PEJA 2CFKA 4OK0A 1RGHA 1W02A 1YVSA 2QGUA 2BNGA 3GAXA 4LYLB 3D5IA 1TU5A 1M9GA 1N9JA 2H0GA 1W5ZA 3I563 1IVXA 3D3LA 3MWZA 1MGWA 3FH1A 3HIGA 3TDGA 1FGMA 1UCKA 1B2SA 2CWVA 2HMOB 1OF5B 1QALA 3KN4A 3X40A 8CHOA 3CC23 2SARA 2CG1A 3LMLA 3NX0A 4J9AA 2W6JH 3OWUA 2WGOA 4HM7B 4MMXB 1VQO3 1DMQA 5JPUA 1UCJA 1EUIC 1E3VA 3CU3A 4Q53A 1W00A 3NXJA 2AADA 2Z6BA 3K5TA 1CYUA 1R4YA 1S5AA 5AI1A 5IG3A 2F5MA 2JDIH 2K54A 3LTDA 4K61A 5G1LA 2BIRA 1JKGB 1F8NA 3NQZA 3M8CA 3JVCA 3QRDA 2C10A 1FGTA 3FF0A 4FMCA 3V99A 2GSPA 1LXEA 2YFIB 1D6YA 1IV9A 3AGNA 3IJEB 1RGAA 1OGZA 4NHFA 4LMIA 1B2ZA 1UI7A 3WA2X 1JNQA 2M7OA 1GY6A 3DGYA 9RNTA 5AIGA 2W56B 2LYXA 2XEPA 3WDGB 1SJWA 2F5WA 4G1MB 4L8PA 4FMAA 1MWUA 4XB5A 3X41A 2PZVA 1GS3A 1O7NB 1WQLB 4R9LA 1BSEA 1W7CA 1OHOA 2KF5A 3G16A 2JQ5A 3PS8A 1IK3A 1IU7A 1BSDA 4CJNA 1I3IA 3GZYB 5AIIA 3T8NA 2HMNB 3N8BA 3HK4A 1RGCA 2GEXA 4LSOA 3F7SA 5AIHA 5IG4A 4N6OB 2XSHB 4KFFA 4HM5B 2WGQA 1EEJA 1W2B2 1NB3I 3AMOB 4WYKA 1TFKA 3PCSA 1WNHA 3LT9A 4OVMA 2IYJA 2OTL3 3NBRA 2STDA 1GOUA 1UGHI 4BTWA 1BAOA 2QIYA 3EBTA 3FG4A 3D5GA 2FXTA 3CNMA 3DGMA 5HOHA 1FZUA 3O8YA 4MJDA 1RKYA 1VQ93 4RNTA 4O3VA 1ULJB 1RN1A 5G2GA 1QVG2 4N6V0 2J8XB 1O7MB 2KRTA 1JBRA 5IEPA 3BNEA 1BRGA 1O7WB 1QAKA 2LQVA 5I97A 1VQ83 3LOYA 2E2VA 3BB9A 1UW1A 1OF5A 1Q824 2L4VA 1LOXA 1NNVA 1HYFA 1DMMA 2L1SA 1T3BA 3ZFZA 1BRSA 4HM2B 1O7PB 5HGRA 1DMNA 4BL3A 4CCVA 3CNXA 2BMOB 1SARA 4K90B 1A90A 2ML6A 1FA3A 2B1XB 5DRVA 2GBWB 1GSPA 1OPYA 1GY5A 3Q90A 5STDA 3ZG5A 2FGTA 1IT7A 3NBJA 4N6NB 3I0YA 1KC84 1VQ53 5IF6A 4DKIA 4ZM8A 2IY2A 1A2PA 3JUPA 4N6LA 4OUQA 4BTYA 3OW22 1G96A 3FSDA 1S723 2KF3A 3G713 3NHXA 1ISKA 5CF1A 3F7XA 5TGNA 4MMYB 4CDLA 2CH9A 1YHQ3 3K0ZA 1DYUA 3V92A 3B7CA 3MG2A 2C11A 3G4S3 1JN5B 3LTAA 4O2HA 1QJGA 2RCDA 1YGWA 2GU1A 4FCJA 1LVNA 3D4AA 1RGFA 5KP1A 2IMJA 7STDA 1SPUA 1Y4KA 2YFLB 3DZLA 4TX4A 2CC3A 1VQM3 1R4CA 3HZPA 4HM6B 4J5GA 3S29A 1BUQA 1Q42A 1K8A4 1G02A 3V98A 3Q1CA 3H51A 2CFDA 1W01A 2O9UX 3U1WA 1IQ8A 3GZRA 3PGBA 5CK6A 1BNEA 1VQQA 6GSPA 1IQXA 3STDA 2CK3H 1EQKA 3X42A 1CH0A 1Q40B 2OOVA 4IT7A 1EA2A 3URPA 1Q814 5IG5A 3NV0B 1JRQA 1TUHA 5CLKA 2GEYA 1DVCA 1GY7A 2CG0A 1Q7HA 3N54B 4NPBA 1E3RA 3FG1A 3KIIA 2CX1A 3SEDA 1NB5I 3CPW2 5EQLA 2INXA 2XSOB 5G1KA 3AMOA 2K3DA 2XGNA 1X1UA 3WMDA 3EE1A 4XDWA 1AV4A 1RGKA 3GZBA 3KZTA 3KCHA 1NDOB 3UL6A 1M1K4 1Q864 4I5QA 3GRDA 1UUGB 3LYGA 2CIUA 1RCKA 5D81A 4BIRA 3B4PA 2RSXA 1G0TA 4GHOA 3OX9A 1LQGC 1UUVB 2F99A 4L7KA 4AEQA 3A76A 2D42A 2Y74A 4NREA 3N9HA 3D9RA 3CD63 1O7GB 1TRPA 2UGIA 1T2HA 2W9QA 3EN8A 4H3UA 4N6UA 1W6YA 1CQSA 4KVHA 3DH2A 1N9EA 2V1LA 2CWTA 1UDII 1MWRA 1FYSA 3SOYA 4STDA 1Q9EA 7RNTA 3QK9A 3MPHA 1L5GB 1IVVA 3CCQ3 2H0IA 2MC8A 3SX1A 3CCM3 2R4IA 1W4NA 1RGGA 4FR9A 1BRIA 3T8UA 4EC6A 1JBTA 1I3FA 3EX9A 1SIHA 4QWTA 4I4KA 1STFI 2HMLB 3CCJ3 1VQ73 3J7Yd 1GMPA 1IVWA 1QAFA 1V57A 3FGYA 3WA3A 2P0MA 3KSPA 3T0UA 5GSPA 1EG9B 1E97A 2P05A 1T5YA 4N3VA 1TJDA 2XFSA 4IPBA 3S67A 3EBYA 1T2IA 4X2OA 1RHLA 4KFDA 1JN5A 1FGQA 3F9SA 1WMOA 1NJI4 1W2ZA 1K41A 4R4KA 1VQP3 1CYVA 3G0KA 1YI23 1BSAA 3AHWA 5DREA 4CPKA 1PY3A 1ZS7A 4XBXA 3I553 4EBGA 2D1WA 1RSNA 1B20A 3JUOA 3DGNA 2ZL8A 1MWSA 1I0XA 2ZA4A 4EV2A 4WHAA 3BNBA 2XR8B 3BLZA 1OGXA 3MG3A 1RNTA 3PXMA 2P0XA 4MEIA 2Q07A 2P09A 1B2XA 3FKAA 2KCDA 1BOXA 2BMQB 3EN1B 1Q40A 1FW7A 3K7CA 4HZBB 3MYTA 3KKGA 1KQS2 1YNVX 3NV0A 1U5OA 4KFEA 4AKZA 1JZDA 4JRFA 1YJ93 1GMRA 1OUNA 2K0MA 3WR2A 2KAAA 1Q7Y4 1IYYA 1BNGA 3RGRA 3LXUX 1M904 1RGLA 3AGOA 6STDA 1LNHA 3LTCA 5RNTA 3H3HA 4HM0B 1B2UA 3WODG 1RJOA 2F56A 1BUJA 1IQYA 2H0HA 1BSCA 3DXOA 2WOFA 1RTUA 2BT3A 2Z77A 2W04A 2OQEC 1ZX2A 1B27A 2IUKA 3ALAA 3PCRA 1JJ22 1D6UA 2XRXB 2IUJA 1FUTA 1DVDA 1LOYA 2ZHXB 2HMJB 1EKMA 3ECFA 4ILFA 2CHCA 5CXOA 5IW9A 2KXGA 4ORLA 1BNRA 1US1A 3IMAB 1HU9A 2ML5A 1JKGA 1PFPA 3S5CA 2OOVC 5BVBA 1IV7A 1VQ63 1RN7A 1LNIA 2QEX3 4LEHA 4XBYA 5M18A 1CEWI 3SOAA 4U13A 1YIJ3 1PU4A 1HZ1A 2CWUA 2GU3A 1D6ZA 1DETA 1UGIA 3S28A 1YVBI 3NM2A 2C4BA 1VZZA 3OWSA 5BXQA 4HZ9B 1OCVA 1TTOA 2OQEA 2W56A 2UUGC 1BIRA 1RDSA 3FZWA 3NM7A 3CCL3 3KFQC 1ASKA 1N5PA 3DMCA 5BU4A 1NO3A 1BNJA 6RNTA 2GXFA 1STDA 2W0QA 3U97A 1LQMB 2FNQA 2W03A 3JUNA 4MMZB 1GOYA 3GZXB 4FCMA 2I9WA 2R41A 4EW5A 5BIRA 2HMMB 2W2CA 2XGLA 3D79A 1X1YA 1N8R4 5D83A 5FGOA 1IT8A 2B24B 1I2GA 1TFOA 3MHEA 1BNIA 4L8OA 4RZMA 3OWYA 4RBNA 4WYKB 7GSPA 1JV2B 2KF4A 2HOHA 1B21A 3B4OA 1YGEA 2CFLA 3Q3FA 3UB1A 1UI8A 1ZO2A 4HVNA 1RLSA 4HAAA 1C7HA 3DM8A 4HM8B 5LC7A 5M1AA 1OH0A 3EC9A 3VF1A 1RNBA 5CF2A 1LRAA 1LOVA 4FCZA 3EQQB 2GBXB 1PYLA 5AIFA 1BRJA 1TP6A 1W6GA 3DUKA 3VGNA 3BNCA 2CX0A 3DGOA 1RRLA 1UCLA 4AKYA 2E2TA 3CC43 4HKVB 1W6CA 1GMQA 1O7HB 4J5KA 2Z7AA 1OHPA 5JBSA 1ROAA 5AYRB 1LOWA 3EF8A 4N6MA 4O8SA 4EXRA 3A5EA 3F40A 1BRNL 4EYCA 3G6E3 3PYJA 1K28A 2OWPA 3EHCA 3BU4A 3KE7A 3F8XA 1BRHA 2RGQA 3AHSA
chains in the Genus database with same CATH topology
1GSPA 8RNTA 1I70A 1I8VA 1I0XA 1TRQA 1X1XA 2ZA4A 2F4YA 1RN4A 3BIRA 1RNTA 1A2PA 1BSBA 1RGHA 1YVSA 1B2XA 2KF3A 1BOXA 3D5IA 1FW7A 3GSPA 1RMSA 1YNVX 4BU4A 1GMRA 1MGWA 3HOHA 2AAEA 3WR2A 2KAAA 1UCKA 1IYYA 1B2SA 1BNGA 1YGWA 1BNFA 1B3SA 3D4AA 1RGFA 1RGLA 3AGOA 3SYUA 5RNTA 2SARA 1JBSA 1B2UA 4J5GA 2F56A 1BUJA 1BSCA 1G02A 1RTUA 1UCJA 1B27A 1FUTA 2AADA 1BU4A 1BNEA 1LOYA 2KF6A 6GSPA 3RNTA 1R4YA 1DE3A 1CH0A 2F5MA 4HOHA 1BNRA 2BIRA 3URPA 1LNIA 2GSPA 2RNTA 3AGNA 1RGAA 1HZ1A 4GSPA 1B2ZA 1ZGXA 1DETA 1AQZA 1C54A 1X1UA 2C4BA 1RGKA 3KCHA 3DGYA 9RNTA 1TTOA 2F5WA 1RCKA 1BIRA 1RDSA 4BIRA 4GHOA 5BU4A 2BU4A 1BNJA 6RNTA 1BSEA 2KF5A 1BSDA 1GOYA 1X1WA 1I3IA 1I2FA 5BIRA 1TRPA 1BRKA 1RGCA 1T2HA 1X1YA 3DH2A 1AY7A 1GOVA 1I2GA 1FYSA 2RBIA 1BNIA 1Q9EA 7GSPA 7RNTA 2KF4A 2HOHA 1B21A 1RGEA 1RCLA 1I2EA 3Q3FA 1RLSA 1MGRA 1GOUA 1RGGA 1BRIA 1BAOA 4HAAA 1JBTA 1FUSA 1I3FA 3D5GA 1RNBA 1LRAA 1LOVA 5HOHA 1UCIA 1FZUA 1GMPA 1BNSA 1BANA 1PYLA 4RNTA 1BRJA 3WHOA 1BVIA 5GSPA 1UCLA 1RN1A 1B2MA 1GMQA 4J5KA 1JBRA 1T2IA 1BRGA 1BGSA 1RHLA 1LOWA 1I0VA 3A5EA 1BRNL 1HYFA 1BSAA 3AHWA 1BRSA 1PY3A 3BU4A 1SARA 1RSNA 1BRHA 3AHSA 1B20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSP A;  8RNT A;  1I70 A;  1I8V A;  1I0X A;  1TRQ A;  1X1X A;  2ZA4 A;  2F4Y A;  1RN4 A;  3BIR A;  1RNT A;  1A2P A;  1BSB A;  1RGH A;  1YVS A;  1B2X A;  2KF3 A;  1BOX A;  3D5I A;  1FW7 A;  3GSP A;  1RMS A;  1YNV X;  4BU4 A;  1GMR A;  1MGW A;  3HOH A;  2AAE A;  3WR2 A;  2KAA A;  1UCK A;  1IYY A;  1B2S A;  1BNG A;  1YGW A;  1BNF A;  1B3S A;  3D4A A;  1RGF A;  1RGL A;  3AGO A;  3SYU A;  5RNT A;  2SAR A;  1JBS A;  1B2U A;  4J5G A;  2F56 A;  1BUJ A;  1BSC A;  1G02 A;  1RTU A;  1UCJ A;  1B27 A;  1FUT A;  2AAD A;  1BU4 A;  1BNE A;  1LOY A;  2KF6 A;  6GSP A;  3RNT A;  1R4Y A;  1DE3 A;  1CH0 A;  2F5M A;  4HOH A;  1BNR A;  2BIR A;  3URP A;  1LNI A;  2GSP A;  2RNT A;  3AGN A;  1RGA A;  1HZ1 A;  4GSP A;  1B2Z A;  1ZGX A;  1DET A;  1AQZ A;  1C54 A;  1X1U A;  2C4B A;  1RGK A;  3KCH A;  3DGY A;  9RNT A;  1TTO A;  2F5W A;  1RCK A;  1BIR A;  1RDS A;  4BIR A;  4GHO A;  5BU4 A;  2BU4 A;  1BNJ A;  6RNT A;  1BSE A;  2KF5 A;  1BSD A;  1GOY A;  1X1W A;  1I3I A;  1I2F A;  5BIR A;  1TRP A;  1BRK A;  1RGC A;  1T2H A;  1X1Y A;  3DH2 A;  1AY7 A;  1GOV A;  1I2G A;  1FYS A;  2RBI A;  1BNI A;  1Q9E A;  7GSP A;  7RNT A;  2KF4 A;  2HOH A;  1B21 A;  1RGE A;  1RCL A;  1I2E A;  3Q3F A;  1RLS A;  1MGR A;  1GOU A;  1RGG A;  1BRI A;  1BAO A;  4HAA A;  1JBT A;  1FUS A;  1I3F A;  3D5G A;  1RNB A;  1LRA A;  1LOV A;  5HOH A;  1UCI A;  1FZU A;  1GMP A;  1BNS A;  1BAN A;  1PYL A;  4RNT A;  1BRJ A;  3WHO A;  1BVI A;  5GSP A;  1UCL A;  1RN1 A;  1B2M A;  1GMQ A;  4J5K A;  1JBR A;  1T2I A;  1BRG A;  1BGS A;  1RHL A;  1LOW A;  1I0V A;  3A5E A;  1BRN L;  1HYF A;  1BSA A;  3AHW A;  1BRS A;  1PY3 A;  3BU4 A;  1SAR A;  1RSN A;  1BRH A;  3AHS A;  1B20 A; 
#chains in the Genus database with same CATH topology
 4H61 A;  3DY5 A;  1VQ4 3;  8RNT A;  3MG1 A;  1I8V A;  1Z1S A;  1GD3 A;  1A2V A;  1TIJ A;  1X1X A;  5KP4 A;  1RN4 A;  5AEU B;  5AYS C;  3CXC 2;  2BMR B;  1BSB A;  2SBL A;  3K63 A;  2RFR A;  1K73 4;  5IER A;  3F14 A;  4KZ1 A;  1J2B A;  3GSP A;  1RMS A;  3DGL A;  3LH4 A;  3RDE A;  4BU4 A;  3NUV A;  3HOH A;  4HM4 B;  3S27 A;  2AAE A;  4LGQ A;  2WO0 A;  1ULI B;  5EVH A;  4WFO A;  5ELJ A;  3HII A;  5M19 A;  1BNF A;  1B3S A;  4XM4 A;  1V74 A;  5A0O B;  1JB4 A;  4R1K A;  2Z76 A;  3JUM A;  3MSO A;  1M1X B;  2IA7 A;  4HM3 B;  3G8Z A;  1NU3 A;  2F86 B;  3SYU A;  1YJN 3;  5LC6 A;  3EJV A;  3E99 A;  3HI7 A;  1K9M 4;  1JBS A;  2F98 A;  1QMA A;  2UX0 A;  3IPT A;  3CMA 3;  1AVL A;  1NWW A;  1OAC A;  2XH9 A;  3CCV 3;  2KF6 A;  1BU4 A;  2OTJ 3;  3ER7 A;  2CFG A;  3RNT A;  3CPO A;  5AEW B;  4KT3 B;  4GB5 A;  4HOH A;  1FUW A;  4R9K A;  4RNY A;  1KD1 4;  4WWU C;  1HKX A;  5D82 A;  3EB8 A;  2ZDJ A;  3BND A;  3X3X A;  3F8H A;  4N6T A;  3SLU A;  1FGO A;  2RNT A;  3VSY A;  3Q2P A;  2A15 A;  4GSP A;  4HM1 B;  1ZGX A;  1WTH A;  4IIA A;  1AQZ A;  4BL2 A;  1C54 A;  1IVU A;  4EV5 A;  4WP5 A;  5ELU A;  3MKI A;  1QVF 2;  1SQW A;  3FF2 A;  3UNL A;  3X3Y A;  1AVK A;  3CME 3;  1VQL 3;  3FLJ A;  1U8C B;  3GWR A;  3CCU 3;  2XFT A;  5EEO A;  1A67 A;  4X2H A;  5IEN A;  3LT8 A;  3UJM A;  2BU4 A;  1MWT A;  3LTB A;  2E2U A;  1YIT 3;  2OCT A;  2YX9 A;  4O02 B;  3NQY A;  3UL5 A;  4XBT A;  1X1W A;  2W9P A;  3PZW A;  1GD4 A;  3NBB A;  4GL6 A;  1A2K A;  3CC7 3;  1I2F A;  2XF3 A;  2WOH A;  3B8L A;  3JUQ A;  1BRK A;  1V58 A;  1GYB A;  3X3Z A;  3CCS 3;  2BHM A;  1AY7 A;  1GOV A;  1WMN A;  2YFJ B;  4K1V A;  5FW5 A;  1VQK 3;  4K1U A;  2RBI A;  3WOF B;  3L0R A;  2P38 A;  2MF7 A;  2O3O A;  4J8T A;  3WOE B;  1RGE A;  1I2E A;  1RCL A;  1MNL A;  3RGA A;  2PNC A;  3OV4 A;  1N5H A;  5IEO A;  1MGR A;  1WMP A;  2QA4 3;  5KP3 A;  1FUS A;  4HJL B;  3ZG0 A;  1JZO A;  1UCI A;  4FMB A;  1UUW B;  1BNS A;  3SXX A;  1BAN A;  3WHO A;  3KSE D;  1BVI A;  4HBR A;  3OXA A;  4JF8 A;  1IDP A;  4HYZ A;  4LZI A;  1B2M A;  3HX8 A;  3FCS B;  3FG3 A;  2Y73 A;  1JB5 A;  1BGS A;  5JPP A;  1VQN 3;  1FGR A;  3K9M C;  3ROB A;  3LZA A;  1I0V A;  1YJW 3;  4BTX A;  4XDV A;  3SVA A;  1OHS A;  1KWI A;  1JB2 A;  1ROV A;  1RRH A;  1DE3 A;  5IG0 A;  2BO9 B;  2CFW A;  1KSI A;  1MOL A;  2CW9 A;  4R80 A;  4RNZ A;  1I70 A;  1SII A;  4FMD A;  1TRQ A;  3CCE 3;  3CCR 3;  2F4Y A;  3BIR A;  1N8Q A;  2CKF B;  1AR0 A;  2HMK B;  4PEJ A;  2CFK A;  4OK0 A;  1RGH A;  1W02 A;  1YVS A;  2QGU A;  2BNG A;  3GAX A;  4LYL B;  3D5I A;  1TU5 A;  1M9G A;  1N9J A;  2H0G A;  1W5Z A;  3I56 3;  1IVX A;  3D3L A;  3MWZ A;  1MGW A;  3FH1 A;  3HIG A;  3TDG A;  1FGM A;  1UCK A;  1B2S A;  2CWV A;  2HMO B;  1OF5 B;  1QAL A;  3KN4 A;  3X40 A;  8CHO A;  3CC2 3;  2SAR A;  2CG1 A;  3LML A;  3NX0 A;  4J9A A;  2W6J H;  3OWU A;  2WGO A;  4HM7 B;  4MMX B;  1VQO 3;  1DMQ A;  5JPU A;  1UCJ A;  1EUI C;  1E3V A;  3CU3 A;  4Q53 A;  1W00 A;  3NXJ A;  2AAD A;  2Z6B A;  3K5T A;  1CYU A;  1R4Y A;  1S5A A;  5AI1 A;  5IG3 A;  2F5M A;  2JDI H;  2K54 A;  3LTD A;  4K61 A;  5G1L A;  2BIR A;  1JKG B;  1F8N A;  3NQZ A;  3M8C A;  3JVC A;  3QRD A;  2C10 A;  1FGT A;  3FF0 A;  4FMC A;  3V99 A;  2GSP A;  1LXE A;  2YFI B;  1D6Y A;  1IV9 A;  3AGN A;  3IJE B;  1RGA A;  1OGZ A;  4NHF A;  4LMI A;  1B2Z A;  1UI7 A;  3WA2 X;  1JNQ A;  2M7O A;  1GY6 A;  3DGY A;  9RNT A;  5AIG A;  2W56 B;  2LYX A;  2XEP A;  3WDG B;  1SJW A;  2F5W A;  4G1M B;  4L8P A;  4FMA A;  1MWU A;  4XB5 A;  3X41 A;  2PZV A;  1GS3 A;  1O7N B;  1WQL B;  4R9L A;  1BSE A;  1W7C A;  1OHO A;  2KF5 A;  3G16 A;  2JQ5 A;  3PS8 A;  1IK3 A;  1IU7 A;  1BSD A;  4CJN A;  1I3I A;  3GZY B;  5AII A;  3T8N A;  2HMN B;  3N8B A;  3HK4 A;  1RGC A;  2GEX A;  4LSO A;  3F7S A;  5AIH A;  5IG4 A;  4N6O B;  2XSH B;  4KFF A;  4HM5 B;  2WGQ A;  1EEJ A;  1W2B 2;  1NB3 I;  3AMO B;  4WYK A;  1TFK A;  3PCS A;  1WNH A;  3LT9 A;  4OVM A;  2IYJ A;  2OTL 3;  3NBR A;  2STD A;  1GOU A;  1UGH I;  4BTW A;  1BAO A;  2QIY A;  3EBT A;  3FG4 A;  3D5G A;  2FXT A;  3CNM A;  3DGM A;  5HOH A;  1FZU A;  3O8Y A;  4MJD A;  1RKY A;  1VQ9 3;  4RNT A;  4O3V A;  1ULJ B;  1RN1 A;  5G2G A;  1QVG 2;  4N6V 0;  2J8X B;  1O7M B;  2KRT A;  1JBR A;  5IEP A;  3BNE A;  1BRG A;  1O7W B;  1QAK A;  2LQV A;  5I97 A;  1VQ8 3;  3LOY A;  2E2V A;  3BB9 A;  1UW1 A;  1OF5 A;  1Q82 4;  2L4V A;  1LOX A;  1NNV A;  1HYF A;  1DMM A;  2L1S A;  1T3B A;  3ZFZ A;  1BRS A;  4HM2 B;  1O7P B;  5HGR A;  1DMN A;  4BL3 A;  4CCV A;  3CNX A;  2BMO B;  1SAR A;  4K90 B;  1A90 A;  2ML6 A;  1FA3 A;  2B1X B;  5DRV A;  2GBW B;  1GSP A;  1OPY A;  1GY5 A;  3Q90 A;  5STD A;  3ZG5 A;  2FGT A;  1IT7 A;  3NBJ A;  4N6N B;  3I0Y A;  1KC8 4;  1VQ5 3;  5IF6 A;  4DKI A;  4ZM8 A;  2IY2 A;  1A2P A;  3JUP A;  4N6L A;  4OUQ A;  4BTY A;  3OW2 2;  1G96 A;  3FSD A;  1S72 3;  2KF3 A;  3G71 3;  3NHX A;  1ISK A;  5CF1 A;  3F7X A;  5TGN A;  4MMY B;  4CDL A;  2CH9 A;  1YHQ 3;  3K0Z A;  1DYU A;  3V92 A;  3B7C A;  3MG2 A;  2C11 A;  3G4S 3;  1JN5 B;  3LTA A;  4O2H A;  1QJG A;  2RCD A;  1YGW A;  2GU1 A;  4FCJ A;  1LVN A;  3D4A A;  1RGF A;  5KP1 A;  2IMJ A;  7STD A;  1SPU A;  1Y4K A;  2YFL B;  3DZL A;  4TX4 A;  2CC3 A;  1VQM 3;  1R4C A;  3HZP A;  4HM6 B;  4J5G A;  3S29 A;  1BUQ A;  1Q42 A;  1K8A 4;  1G02 A;  3V98 A;  3Q1C A;  3H51 A;  2CFD A;  1W01 A;  2O9U X;  3U1W A;  1IQ8 A;  3GZR A;  3PGB A;  5CK6 A;  1BNE A;  1VQQ A;  6GSP A;  1IQX A;  3STD A;  2CK3 H;  1EQK A;  3X42 A;  1CH0 A;  1Q40 B;  2OOV A;  4IT7 A;  1EA2 A;  3URP A;  1Q81 4;  5IG5 A;  3NV0 B;  1JRQ A;  1TUH A;  5CLK A;  2GEY A;  1DVC A;  1GY7 A;  2CG0 A;  1Q7H A;  3N54 B;  4NPB A;  1E3R A;  3FG1 A;  3KII A;  2CX1 A;  3SED A;  1NB5 I;  3CPW 2;  5EQL A;  2INX A;  2XSO B;  5G1K A;  3AMO A;  2K3D A;  2XGN A;  1X1U A;  3WMD A;  3EE1 A;  4XDW A;  1AV4 A;  1RGK A;  3GZB A;  3KZT A;  3KCH A;  1NDO B;  3UL6 A;  1M1K 4;  1Q86 4;  4I5Q A;  3GRD A;  1UUG B;  3LYG A;  2CIU A;  1RCK A;  5D81 A;  4BIR A;  3B4P A;  2RSX A;  1G0T A;  4GHO A;  3OX9 A;  1LQG C;  1UUV B;  2F99 A;  4L7K A;  4AEQ A;  3A76 A;  2D42 A;  2Y74 A;  4NRE A;  3N9H A;  3D9R A;  3CD6 3;  1O7G B;  1TRP A;  2UGI A;  1T2H A;  2W9Q A;  3EN8 A;  4H3U A;  4N6U A;  1W6Y A;  1CQS A;  4KVH A;  3DH2 A;  1N9E A;  2V1L A;  2CWT A;  1UDI I;  1MWR A;  1FYS A;  3SOY A;  4STD A;  1Q9E A;  7RNT A;  3QK9 A;  3MPH A;  1L5G B;  1IVV A;  3CCQ 3;  2H0I A;  2MC8 A;  3SX1 A;  3CCM 3;  2R4I A;  1W4N A;  1RGG A;  4FR9 A;  1BRI A;  3T8U A;  4EC6 A;  1JBT A;  1I3F A;  3EX9 A;  1SIH A;  4QWT A;  4I4K A;  1STF I;  2HML B;  3CCJ 3;  1VQ7 3;  3J7Y d;  1GMP A;  1IVW A;  1QAF A;  1V57 A;  3FGY A;  3WA3 A;  2P0M A;  3KSP A;  3T0U A;  5GSP A;  1EG9 B;  1E97 A;  2P05 A;  1T5Y A;  4N3V A;  1TJD A;  2XFS A;  4IPB A;  3S67 A;  3EBY A;  1T2I A;  4X2O A;  1RHL A;  4KFD A;  1JN5 A;  1FGQ A;  3F9S A;  1WMO A;  1NJI 4;  1W2Z A;  1K41 A;  4R4K A;  1VQP 3;  1CYV A;  3G0K A;  1YI2 3;  1BSA A;  3AHW A;  5DRE A;  4CPK A;  1PY3 A;  1ZS7 A;  4XBX A;  3I55 3;  4EBG A;  2D1W A;  1RSN A;  1B20 A;  3JUO A;  3DGN A;  2ZL8 A;  1MWS A;  1I0X A;  2ZA4 A;  4EV2 A;  4WHA A;  3BNB A;  2XR8 B;  3BLZ A;  1OGX A;  3MG3 A;  1RNT A;  3PXM A;  2P0X A;  4MEI A;  2Q07 A;  2P09 A;  1B2X A;  3FKA A;  2KCD A;  1BOX A;  2BMQ B;  3EN1 B;  1Q40 A;  1FW7 A;  3K7C A;  4HZB B;  3MYT A;  3KKG A;  1KQS 2;  1YNV X;  3NV0 A;  1U5O A;  4KFE A;  4AKZ A;  1JZD A;  4JRF A;  1YJ9 3;  1GMR A;  1OUN A;  2K0M A;  3WR2 A;  2KAA A;  1Q7Y 4;  1IYY A;  1BNG A;  3RGR A;  3LXU X;  1M90 4;  1RGL A;  3AGO A;  6STD A;  1LNH A;  3LTC A;  5RNT A;  3H3H A;  4HM0 B;  1B2U A;  3WOD G;  1RJO A;  2F56 A;  1BUJ A;  1IQY A;  2H0H A;  1BSC A;  3DXO A;  2WOF A;  1RTU A;  2BT3 A;  2Z77 A;  2W04 A;  2OQE C;  1ZX2 A;  1B27 A;  2IUK A;  3ALA A;  3PCR A;  1JJ2 2;  1D6U A;  2XRX B;  2IUJ A;  1FUT A;  1DVD A;  1LOY A;  2ZHX B;  2HMJ B;  1EKM A;  3ECF A;  4ILF A;  2CHC A;  5CXO A;  5IW9 A;  2KXG A;  4ORL A;  1BNR A;  1US1 A;  3IMA B;  1HU9 A;  2ML5 A;  1JKG A;  1PFP A;  3S5C A;  2OOV C;  5BVB A;  1IV7 A;  1VQ6 3;  1RN7 A;  1LNI A;  2QEX 3;  4LEH A;  4XBY A;  5M18 A;  1CEW I;  3SOA A;  4U13 A;  1YIJ 3;  1PU4 A;  1HZ1 A;  2CWU A;  2GU3 A;  1D6Z A;  1DET A;  1UGI A;  3S28 A;  1YVB I;  3NM2 A;  2C4B A;  1VZZ A;  3OWS A;  5BXQ A;  4HZ9 B;  1OCV A;  1TTO A;  2OQE A;  2W56 A;  2UUG C;  1BIR A;  1RDS A;  3FZW A;  3NM7 A;  3CCL 3;  3KFQ C;  1ASK A;  1N5P A;  3DMC A;  5BU4 A;  1NO3 A;  1BNJ A;  6RNT A;  2GXF A;  1STD A;  2W0Q A;  3U97 A;  1LQM B;  2FNQ A;  2W03 A;  3JUN A;  4MMZ B;  1GOY A;  3GZX B;  4FCM A;  2I9W A;  2R41 A;  4EW5 A;  5BIR A;  2HMM B;  2W2C A;  2XGL A;  3D79 A;  1X1Y A;  1N8R 4;  5D83 A;  5FGO A;  1IT8 A;  2B24 B;  1I2G A;  1TFO A;  3MHE A;  1BNI A;  4L8O A;  4RZM A;  3OWY A;  4RBN A;  4WYK B;  7GSP A;  1JV2 B;  2KF4 A;  2HOH A;  1B21 A;  3B4O A;  1YGE A;  2CFL A;  3Q3F A;  3UB1 A;  1UI8 A;  1ZO2 A;  4HVN A;  1RLS A;  4HAA A;  1C7H A;  3DM8 A;  4HM8 B;  5LC7 A;  5M1A A;  1OH0 A;  3EC9 A;  3VF1 A;  1RNB A;  5CF2 A;  1LRA A;  1LOV A;  4FCZ A;  3EQQ B;  2GBX B;  1PYL A;  5AIF A;  1BRJ A;  1TP6 A;  1W6G A;  3DUK A;  3VGN A;  3BNC A;  2CX0 A;  3DGO A;  1RRL A;  1UCL A;  4AKY A;  2E2T A;  3CC4 3;  4HKV B;  1W6C A;  1GMQ A;  1O7H B;  4J5K A;  2Z7A A;  1OHP A;  5JBS A;  1ROA A;  5AYR B;  1LOW A;  3EF8 A;  4N6M A;  4O8S A;  4EXR A;  3A5E A;  3F40 A;  1BRN L;  4EYC A;  3G6E 3;  3PYJ A;  1K28 A;  2OWP A;  3EHC A;  3BU4 A;  3KE7 A;  3F8X A;  1BRH A;  2RGQ A;  3AHS A; 
#chains in the Genus database with same CATH homology
 1GSP A;  8RNT A;  1I70 A;  1I8V A;  1I0X A;  1TRQ A;  1X1X A;  2ZA4 A;  2F4Y A;  1RN4 A;  3BIR A;  1RNT A;  1A2P A;  1BSB A;  1RGH A;  1YVS A;  1B2X A;  2KF3 A;  1BOX A;  3D5I A;  1FW7 A;  3GSP A;  1RMS A;  1YNV X;  4BU4 A;  1GMR A;  1MGW A;  3HOH A;  2AAE A;  3WR2 A;  2KAA A;  1UCK A;  1IYY A;  1B2S A;  1BNG A;  1YGW A;  1BNF A;  1B3S A;  3D4A A;  1RGF A;  1RGL A;  3AGO A;  3SYU A;  5RNT A;  2SAR A;  1JBS A;  1B2U A;  4J5G A;  2F56 A;  1BUJ A;  1BSC A;  1G02 A;  1RTU A;  1UCJ A;  1B27 A;  1FUT A;  2AAD A;  1BU4 A;  1BNE A;  1LOY A;  2KF6 A;  6GSP A;  3RNT A;  1R4Y A;  1DE3 A;  1CH0 A;  2F5M A;  4HOH A;  1BNR A;  2BIR A;  3URP A;  1LNI A;  2GSP A;  2RNT A;  3AGN A;  1RGA A;  1HZ1 A;  4GSP A;  1B2Z A;  1ZGX A;  1DET A;  1AQZ A;  1C54 A;  1X1U A;  2C4B A;  1RGK A;  3KCH A;  3DGY A;  9RNT A;  1TTO A;  2F5W A;  1RCK A;  1BIR A;  1RDS A;  4BIR A;  4GHO A;  5BU4 A;  2BU4 A;  1BNJ A;  6RNT A;  1BSE A;  2KF5 A;  1BSD A;  1GOY A;  1X1W A;  1I3I A;  1I2F A;  5BIR A;  1TRP A;  1BRK A;  1RGC A;  1T2H A;  1X1Y A;  3DH2 A;  1AY7 A;  1GOV A;  1I2G A;  1FYS A;  2RBI A;  1BNI A;  1Q9E A;  7GSP A;  7RNT A;  2KF4 A;  2HOH A;  1B21 A;  1RGE A;  1RCL A;  1I2E A;  3Q3F A;  1RLS A;  1MGR A;  1GOU A;  1RGG A;  1BRI A;  1BAO A;  4HAA A;  1JBT A;  1FUS A;  1I3F A;  3D5G A;  1RNB A;  1LRA A;  1LOV A;  5HOH A;  1UCI A;  1FZU A;  1GMP A;  1BNS A;  1BAN A;  1PYL A;  4RNT A;  1BRJ A;  3WHO A;  1BVI A;  5GSP A;  1UCL A;  1RN1 A;  1B2M A;  1GMQ A;  4J5K A;  1JBR A;  1T2I A;  1BRG A;  1BGS A;  1RHL A;  1LOW A;  1I0V A;  3A5E A;  1BRN L;  1HYF A;  1BSA A;  3AHW A;  1BRS A;  1PY3 A;  3BU4 A;  1SAR A;  1RSN A;  1BRH A;  3AHS A;  1B20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...