1K734

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k73400
3G6E3 3CCR3 1Q7Y4 1Q824 2QEX3 1YJN3 3CC73 1S723 3CXC2 3CC43 3CCE3 1YIT3 1QVF2 1VQ63 1VQ43 1M904 1VQL3 1K8A4 1VQ53 1VQO3 1N8R4 3CCM3 1VQK3 1YIJ3 3OW22 3CCV3 1VQM3 1JJ22 3CD63 1VQN3 1VQP3 3G713 1VQ93 1QVG2 3I553 1K734 1NJI4 3CCL3 3CCS3 2OTJ3 3I563 2OTL3 1M1K4 3CCU3 1YHQ3 2QA43 1VQ83 1KC84 1K9M4 3CCJ3 1KQS2 3CPW2 3CMA3 1W2B2 3CC23 1YI23 1VQ73 1Q814 1Q864 1KD14 1YJ93 3CCQ3 1YJW3 3CME3 3G4S3
chains in the Genus database with same CATH superfamily
2P38A 4XM4A 4KFDA 5AEUB 1FW7A 2WGOA 3VGNA 4HOHA 4EW5A 2C10A 2CFGA 4Q53A 5AIFA 1OH0A 3JUOA 3K7CA 3F7SA 3KCHA 2BMOB 1CYUA 2UUGC 3GSPA 4K1UA 2WO0A 1IV7A 1GS3A 3FG1A 3H51A 1JJ22 7RNTA 1VQ93 1N8QA 3IJEB 4WYKB 1BNFA 2E2VA 5AIGA 3KE7A 1MGWA 1IVWA 1N5HA 1I0VA 1NDOB 3KIIA 4BTWA 3FLJA 5CF1A 4HJLB 1M1K4 3PCRA 3UNLA 4HM4B 5IG0A 1DETA 4X2HA 4EC6A 1B2ZA 2RBIA 2D1WA 5HGRA 3GZBA 3LOYA 1DE3A 4WWUC 3RGRA 4MMXB 3SEDA 2PNCA 2AADA 1I2EA 3CC43 2PZVA 1DYUA 2CG0A 3WR2A 2XSHB 1RJOA 4NHFA 2CHCA 4BL3A 2ZDJA 2BNGA 3TDGA 3OW22 1TP6A 1GOYA 2WOHA 3OWUA 4HM7B 1QAKA 1K41A 4K90B 5AEWB 1J2BA 3FSDA 3S5CA 3NX0A 1I3IA 1DVDA 1FGMA 1YGWA 3QK9A 2CFLA 1NNVA 1RKYA 1WMPA 1LOVA 2K54A 5IEOA 1IVXA 2B1XB 1OPYA 4GHOA 3CCU3 3EC9A 1QAFA 3D79A 2LYXA 1LOXA 2OOVC 1UUWB 2INXA 1NWWA 3HX8A 1KD14 1Q814 1WMOA 1JBRA 1SJWA 1RRHA 3MG1A 5IF6A 2ZL8A 1SIIA 1X1UA 3CNXA 1B2SA 1B2XA 3BNCA 1E97A 3SOAA 1GY5A 4N3VA 5AYSC 1IU7A 3HOHA 4GB5A 1VQM3 1BRIA 2J8XB 3T8UA 5AYRB 1FGTA 2JQ5A 1FUTA 3DGYA 2CX0A 4QWTA 3DUKA 1OGXA 3BU4A 3LXUX 1EUIC 2GBXB 1W4NA 3AGNA 3HK4A 5EVHA 1IDPA 2CIUA 1IQYA 1VZZA 3LH4A 4HM6B 1EA2A 3B8LA 3H3HA 4HM0B 4BTYA 1W5ZA 3PS8A 7GSPA 4R9LA 2KXGA 1Q7Y4 2XRXB 1WMNA 3F14A 1D6UA 5IENA 3ZG5A 6RNTA 4R4KA 4L7KA 1RGHA 1F8NA 5KP3A 2CH9A 3PYJA 4L8PA 3U1WA 1B3SA 1TU5A 2W0QA 1O7GB 1GY6A 1RGLA 1WTHA 4KVHA 1V57A 2MF7A 1SQWA 1TFKA 3CCL3 1W6YA 2JDIH 1OCVA 3HZPA 3Q1CA 4OK0A 2RGQA 1BIRA 3CPOA 3LTDA 4RNTA 3NBRA 3ZFZA 1RCLA 1B27A 1CYVA 1KC84 1K9M4 2Z7AA 1W00A 5STDA 1LOYA 1MGRA 3K9MC 1JBSA 3JVCA 3Q3FA 1NB5I 3NM2A 3GWRA 5LC7A 1RGAA 3UB1A 2FNQA 2XR8B 1YJN3 1LOWA 2HMKB 2AAEA 4N6V0 3N8BA 3NHXA 3OX9A 1JZOA 1D6YA 1UGIA 4MJDA 5I97A 5RNTA 5AIIA 3X42A 3G8ZA 4KZ1A 4ORLA 3ZG0A 3DY5A 3IMAB 3GZYB 4ILFA 3B4PA 1ZO2A 1A2KA 1JN5A 1W6GA 1RDSA 3EQQB 4J5KA 4N6MA 1E3VA 3BB9A 4OUQA 2P0MA 5TGNA 2XEPA 1OHSA 5IG4A 1R4CA 1BNJA 4KFFA 4N6LA 1KQS2 1BUQA 2A15A 4O2HA 5IW9A 2I9WA 3OV4A 1RSNA 1VQ73 4STDA 2KF5A 1US1A 2H0HA 2OQEA 2CWTA 1Z1SA 2W56A 3B4OA 3BNDA 1GSPA 1I2FA 7STDA 5JPPA 1JN5B 1JV2B 1TUHA 2BT3A 1K8A4 1VQ53 1VQL3 1CQSA 2CWUA 5IERA 1AR0A 4N6OB 1RNBA 3E99A 1AVKA 4BU4A 1GD3A 2W6JH 3MG2A 4AEQA 3KN4A 1NJI4 4J5GA 3EX9A 2E2UA 1B2UA 2LQVA 1GD4A 2W56B 1EKMA 1TJDA 5CXOA 1JNQA 1RGCA 1BRNL 5JBSA 2ML5A 3O8YA 1U5OA 1T2IA 5EQLA 1NB3I 4I4KA 4HM1B 3OWYA 3CC23 3WDGB 2XFTA 2KF6A 3GAXA 1CEWI 2F56A 4G1MB 3G6E3 4HAAA 3FF2A 4O8SA 5GSPA 4CJNA 1SIHA 2Q07A 1UCJA 3FCSB 3WA3A 2IUKA 4GL6A 4R1KA 1FA3A 3EB8A 1GMRA 3WOEB 3MPHA 9RNTA 1Q7HA 1LQMB 1RN7A 1IYYA 2HMNB 1HU9A 2E2TA 3FGYA 1A2PA 3FH1A 1GYBA 5KP1A 2IUJA 1Q40A 1M9GA 3FG3A 4HYZA 1OF5A 2KF3A 3KSED 3AMOA 3WA2X 1BRKA 3X3YA 1QVF2 1BRJA 1QMAA 2F4YA 3B7CA 3J7Yd 1FYSA 4U13A 3G16A 1Q824 3MHEA 1UCIA 3CU3A 4PEJA 1EEJA 1VQ43 3RGAA 1T2HA 1JB5A 5BVBA 3KKGA 4IT7A 1NO3A 4N6TA 4LEHA 1OACA 4LMIA 4R80A 1Q40B 6STDA 4ZM8A 1RTUA 4LSOA 8RNTA 1TIJA 1OF5B 1Q9EA 3NQZA 1PYLA 3AMOB 4LGQA 3V98A 2BHMA 1B2MA 1DMNA 3V99A 3K5TA 4HVNA 4FMBA 3LYGA 4EXRA 5BXQA 1R4YA 3D4AA 4EYCA 5ELUA 1O7PB 4N6UA 2F5WA 1W2ZA 2GSPA 3EN1B 3WODG 3SXXA 3LT9A 2P09A 4RZMA 1BRSA 1RGEA 2C4BA 1OUNA 1YVSA 1I2GA 4MEIA 1A90A 1GMPA 1YI23 3F8HA 3F7XA 4WFOA 3CCQ3 1I70A 3JUMA 3X3XA 4BTXA 3CME3 1YJ93 1VQN3 1LNHA 4EV2A 2QEX3 5DRVA 3DGMA 5A0OB 1YIT3 1VQ63 5M1AA 1I0XA 3UL5A 3EHCA 3CCM3 1UGHI 2GEXA 4JF8A 1BUJA 2B24B 1IVUA 3K63A 1I8VA 3EE1A 2BMRB 1AVLA 4KT3B 4K61A 1QJGA 1IK3A 1A67A 4O02B 3SX1A 1RGGA 1TFOA 1OHOA 1ZX2A 1IQ8A 3NBJA 1MNLA 3X3ZA 1G96A 3RNTA 2SBLA 4CPKA 1BSDA 1EG9B 8CHOA 3A76A 2CX1A 1TRPA 4EV5A 1UCLA 3MSOA 4BIRA 1TRQA 1RNTA 2Z76A 2CWVA 2IYJA 3DGOA 5G2GA 3CMA3 4FCJA 5D81A 1STDA 3PCSA 2OOVA 4XBXA 1UUGB 4WHAA 3S29A 1Q864 1N5PA 2XGLA 5AI1A 1V58A 4X2OA 1S723 1OGZA 2Y74A 1LVNA 1BNEA 3MYTA 4TX4A 3NXJA 1O7HB 2L4VA 3DZLA 1VQO3 1UI8A 3GRDA 1YIJ3 3D5GA 3URPA 3F8XA 2XFSA 3GZRA 1YGEA 1BNGA 1PY3A 3JUNA 3DMCA 1KSIA 5JPUA 1BU4A 1NU3A 4J8TA 5BIRA 3G0KA 1WQLB 1TTOA 3SLUA 1RHLA 1E3RA 1OHPA 2HOHA 1IV9A 3L0RA 3EBTA 5BU4A 2FXTA 1C54A 1RMSA 3CCJ3 1RLSA 3T8NA 3DGLA 3IPTA 3EN8A 1CH0A 5CLKA 1IT8A 1SARA 1JKGA 2W04A 1A2VA 3N9HA 1FUWA 2FGTA 3V92A 5IG3A 5FW5A 2XH9A 5EEOA 3OXAA 3ECFA 2YX9A 4FCZA 4K1VA 1N8R4 3HI7A 3AHWA 4OVMA 1JB4A 4NPBA 1Q42A 2F5MA 2Y73A 4FMAA 3FG4A 1RGKA 2HMJB 1W02A 2IMJA 1QVG2 5CK6A 1JKGB 2GU1A 2KCDA 3ER7A 4HBRA 3SOYA 3CCS3 1BNRA 1JB2A 1W7CA 1B20A 3F40A 1FGOA 3BIRA 1MWTA 4CDLA 1LNIA 1RN1A 1X1WA 1X1XA 2F99A 4NREA 1VQ83 1GY7A 1MWUA 1G02A 1W2B2 3MG3A 1PU4A 3G4S3 3S28A 4EBGA 2SARA 2BO9B 1BNSA 2XF3A 3CC73 4MMYB 2MC8A 1AY7A 1BVIA 1UUVB 1VQQA 2K3DA 1O7MB 4XBTA 1M904 2RNTA 3X40A 1SPUA 1WNHA 4IIAA 1RRLA 2CC3A 4XDWA 2GBWB 4N6NB 3Q90A 3K0ZA 2H0IA 1FUSA 3LZAA 2HMMB 1I3FA 2C11A 3I0YA 3I553 1K734 2OTJ3 1FZUA 2H0GA 2KF4A 4R9KA 2O3OA 2K0MA 2RCDA 2W9QA 4RNZA 5AIHA 2QIYA 2YFIB 1N9EA 1G0TA 3N54B 1W01A 3NV0A 3DM8A 4FMDA 1JZDA 1BRHA 1UDII 1ULJB 2CFKA 2P0XA 1QALA 1K28A 3CCR3 1YNVX 2GU3A 4XDVA 1V74A 3FKAA 2Z6BA 3EBYA 4H3UA 5HOHA 1BAOA 1RN4A 4MMZB 4XBYA 3NV0B 1UW1A 4RNYA 1AQZA 3NUVA 1VQP3 4GSPA 3G713 1B21A 2F98A 3X41A 3SVAA 2BIRA 2ZHXB 3HIIA 2UGIA 4HZ9B 2OTL3 1BOXA 2BMQB 1IVVA 1O7NB 3S67A 5ELJA 3CPW2 2OWPA 3ALAA 5FGOA 1FGQA 5D83A 1ASKA 1BSCA 3Q2PA 3LT8A 3UL6A 1UCKA 3D3LA 1ZGXA 1T3BA 2L1SA 1JRQA 4FR9A 3D9RA 3RDEA 3CNMA 4KFEA 3VF1A 1RGFA 2XSOB 4I5QA 2CG1A 3DH2A 1KWIA 3A5EA 3LTAA 2QGUA 2YFLB 5M18A 5IEPA 1S5AA 1GOVA 2UX0A 3BNBA 1Y4KA 3ROBA 4RBNA 3EF8A 3T0UA 3NM7A 1LXEA 2CFWA 2RFRA 4HZBB 4L8OA 3PXMA 1O7WB 3S27A 3VSYA 2D42A 2V1LA 2CFDA 3MKIA 3WMDA 4AKZA 2ZA4A 4HM3B 2STDA 2QA43 2HMLB 5IG5A 4HM5B 4XB5A 1HKXA 2WOFA 2OQEC 3NQYA 2HMOB 2ML6A 3BLZA 3JUPA 1BRGA 1C7HA 1HZ1A 2CW9A 4J9AA 2XGNA 3KZTA 1T5YA 4LYLB 4HM2B 3CXC2 3DGNA 1MOLA 2KRTA 3CCE3 3CCV3 3LMLA 3UJMA 1U8CB 1VQK3 4CCVA 4FMCA 2M7OA 1ISKA 1ROVA 1STFI 2IY2A 1ZS7A 3KFQC 3LTCA 4H61A 1MWSA 1BNIA 4FCMA 4HKVB 2R4IA 2KAAA 1YVBI 1AV4A 1L5GB 2P05A 1W6CA 3BNEA 5G1LA 1HYFA 2GXFA 3OWSA 4BL2A 1YHQ3 2R41A 1RCKA 3F9SA 1UI7A 1X1YA 1N9JA 1JBTA 1BGSA 2O9UX 2F86B 2YFJB 1YJW3 3PGBA 4DKIA 1BSAA 4LZIA 4AKYA 6GSPA 1DMQA 1MWRA 2W2CA 2RSXA 4WP5A 1LRAA 3JUQA 2W03A 1GMQA 1M1XB 3DXOA 1DMMA 3HIGA 3WHOA 3LTBA 1FGRA 2BU4A 2Z77A 2CKFB 4IPBA 5LC6A 5D82A 3NBBA 2W9PA 2IA7A 3D5IA 1D6ZA 4JRFA 3AGOA 3CD63 3WOFB 1ULIB 1ROAA 5M19A 1GOUA 5DREA 1IQXA 3AHSA 3FZWA 2GEYA 3SYUA 5KP4A 3KSPA 4HM8B 1IT7A 2CK3H 3PZWA 3I563 1EQKA 4O3VA 3M8CA 5G1KA 1BANA 3QRDA 1BSEA 1BSBA 2OCTA 1DVCA 3GZXB 3EJVA 3U97A 2WGQA 3STDA 3MWZA 1LQGC 3FF0A 5CF2A 4WYKA 1PFPA
chains in the Genus database with same CATH topology
2P38A 4XM4A 4KFDA 5AEUB 2WGOA 3VGNA 2C10A 2CFGA 4Q53A 5AIFA 1OH0A 3JUOA 3K7CA 3F7SA 2BMOB 1CYUA 4K1UA 2WO0A 1IV7A 1GS3A 3FG1A 3H51A 1VQ93 1N8QA 3IJEB 4WYKB 2E2VA 5AIGA 3KE7A 1NDOB 1IVWA 1N5HA 3KIIA 4BTWA 3FLJA 5CF1A 4HJLB 1M1K4 3PCRA 3UNLA 4HM4B 5IG0A 4X2HA 4EC6A 5HGRA 2D1WA 3GZBA 3LOYA 4WWUC 3RGRA 4MMXB 3SEDA 2PNCA 3CC43 2PZVA 1DYUA 2CG0A 2XSHB 1RJOA 4NHFA 2CHCA 2ZDJA 2BNGA 3TDGA 3OW22 1TP6A 3OWUA 2WOHA 4HM7B 1QAKA 1K41A 4K90B 5AEWB 1J2BA 3FSDA 3S5CA 3NX0A 1DVDA 1FGMA 3QK9A 2CFLA 1RKYA 1WMPA 2K54A 5IEOA 1IVXA 2B1XB 1OPYA 3CCU3 3EC9A 1QAFA 2LYXA 1LOXA 2OOVC 1UUWB 2INXA 1NWWA 3HX8A 1KD14 1Q814 1WMOA 1SJWA 1RRHA 3MG1A 5IF6A 2ZL8A 1SIIA 3CNXA 3BNCA 1E97A 3SOAA 1GY5A 4N3VA 5AYSC 1IU7A 4GB5A 1VQM3 3T8UA 5AYRB 1FGTA 2JQ5A 4QWTA 3DUKA 1OGXA 3LXUX 2GBXB 1W4NA 3HK4A 5EVHA 1IDPA 2CIUA 1IQYA 1VZZA 3LH4A 4HM6B 1EA2A 3B8LA 3H3HA 4HM0B 4BTYA 1W5ZA 3PS8A 4R9LA 2KXGA 1Q7Y4 2XRXB 1WMNA 3F14A 1D6UA 5IENA 4R4KA 4L7KA 1F8NA 5KP3A 2CH9A 3PYJA 4L8PA 3U1WA 1TU5A 2W0QA 1O7GB 1GY6A 1WTHA 4KVHA 3CCL3 2MF7A 1SQWA 1TFKA 1W6YA 2JDIH 1OCVA 3HZPA 3Q1CA 4OK0A 2RGQA 3CPOA 3LTDA 3NBRA 1CYVA 1KC84 1K9M4 2Z7AA 1W00A 5STDA 3K9MC 3JVCA 3NM2A 3GWRA 5LC7A 3UB1A 2FNQA 2XR8B 1YJN3 2HMKB 4N6V0 3N8BA 3NHXA 3OX9A 1D6YA 4MJDA 5I97A 5AIIA 3X42A 3G8ZA 4KZ1A 4ORLA 3DY5A 3IMAB 3GZYB 3B4PA 1ZO2A 1A2KA 1JN5A 1W6GA 3EQQB 4N6MA 1E3VA 3BB9A 4OUQA 2P0MA 5TGNA 2XEPA 1OHSA 5IG4A 1R4CA 4KFFA 1KQS2 4N6LA 1BUQA 2A15A 4O2HA 5IW9A 2I9WA 3OV4A 1VQ73 4STDA 1US1A 2OQEA 2CWTA 1Z1SA 2W56A 3B4OA 3BNDA 5JPPA 7STDA 1JN5B 1JV2B 1TUHA 2BT3A 1K8A4 1VQ53 1VQL3 1CQSA 2CWUA 5IERA 1AR0A 4N6OB 3E99A 1AVKA 1GD3A 2W6JH 3MG2A 4AEQA 3KN4A 1NJI4 3EX9A 2E2UA 2LQVA 1GD4A 2W56B 1EKMA 5CXOA 1JNQA 5JBSA 2ML5A 3O8YA 1U5OA 5EQLA 1NB3I 4I4KA 4HM1B 3OWYA 3CC23 3WDGB 2XFTA 3GAXA 3G6E3 1CEWI 4G1MB 3FF2A 4O8SA 1SIHA 2Q07A 3FCSB 3WA3A 2IUKA 4GL6A 4R1KA 1FA3A 3EB8A 3WOEB 3MPHA 1RN7A 2HMNB 1HU9A 2E2TA 3FGYA 3FH1A 1GYBA 5KP1A 2IUJA 1Q40A 1M9GA 3FG3A 4HYZA 1OF5A 3KSED 3AMOA 3WA2X 3X3YA 1QVF2 1QMAA 3B7CA 3J7Yd 4U13A 3G16A 1Q824 3MHEA 3CU3A 4PEJA 1VQ43 3RGAA 1JB5A 5BVBA 3KKGA 4IT7A 1NO3A 4N6TA 4LEHA 1OACA 4LMIA 4R80A 1Q40B 6STDA 4ZM8A 4LSOA 1JJ22 1TIJA 1OF5B 3NQZA 3V98A 3AMOB 4LGQA 2BHMA 1DMNA 3V99A 3K5TA 4HVNA 4FMBA 3LYGA 4EXRA 5BXQA 4EYCA 5ELUA 1O7PB 4N6UA 1W2ZA 3EN1B 3WODG 3SXXA 3LT9A 2P09A 4RZMA 1OUNA 4MEIA 1A90A 1YI23 3F8HA 3F7XA 4WFOA 3CCQ3 3JUMA 3X3XA 4BTXA 3CME3 1YJ93 1VQN3 1LNHA 4EV2A 2QEX3 5DRVA 3DGMA 5A0OB 1YIT3 1VQ63 3UL5A 3EHCA 3CCM3 4JF8A 2GEXA 2B24B 1IVUA 3K63A 3EE1A 2BMRB 1AVLA 4K61A 1QJGA 1IK3A 1A67A 4O02B 3SX1A 1TFOA 1OHOA 1ZX2A 1IQ8A 3NBJA 1MNLA 3X3ZA 1G96A 2SBLA 8CHOA 1EG9B 3A76A 4EV5A 3MSOA 2Z76A 2CWVA 3DGOA 5G2GA 3CMA3 4FCJA 5D81A 1STDA 3PCSA 2OOVA 4XBXA 4WHAA 3S29A 1Q864 1NB5I 1N5PA 2XGLA 5AI1A 4X2OA 1S723 1OGZA 2Y74A 1LVNA 3MYTA 4TX4A 3NXJA 1O7HB 2L4VA 3DZLA 1VQO3 1UI8A 3GRDA 1YIJ3 3F8XA 2XFSA 3GZRA 1YGEA 3JUNA 3DMCA 1KSIA 5JPUA 1NU3A 4J8TA 3G0KA 1WQLB 3SLUA 1E3RA 1OHPA 1IV9A 3L0RA 3EBTA 2FXTA 3CCJ3 3T8NA 3DGLA 3IPTA 3EN8A 5CLKA 1IT8A 2W04A 1JKGA 1A2VA 3N9HA 1FUWA 2FGTA 3V92A 5IG3A 5FW5A 2XH9A 5EEOA 3OXAA 3ECFA 2YX9A 4FCZA 4K1VA 1N8R4 3HI7A 4OVMA 1JB4A 1Q42A 2Y73A 4FMAA 3FG4A 2HMJB 1W02A 2IMJA 1QVG2 5CK6A 1JKGB 2GU1A 2KCDA 3ER7A 4HBRA 3SOYA 3CCS3 1JB2A 1W7CA 3F40A 1FGOA 4CDLA 2F99A 4NREA 1VQ83 1GY7A 1W2B2 3MG3A 1PU4A 3G4S3 3S28A 4EBGA 2BO9B 2XF3A 3CC73 4MMYB 2MC8A 1UUVB 1M904 1O7MB 4XBTA 3X40A 1SPUA 1WNHA 4IIAA 1RRLA 2CC3A 4XDWA 2GBWB 4N6NB 3Q90A 3K0ZA 3LZAA 2HMMB 2C11A 3I0YA 3I553 1K734 2OTJ3 4R9KA 2O3OA 2K0MA 2RCDA 2W9QA 4RNZA 5AIHA 2QIYA 2YFIB 1N9EA 3N54B 1W01A 3NV0A 3DM8A 4FMDA 1ULJB 2CFKA 2P0XA 1QALA 1K28A 3CCR3 2GU3A 4XDVA 1V74A 3FKAA 2Z6BA 3EBYA 4H3UA 4MMZB 4XBYA 3NV0B 1UW1A 4RNYA 3NUVA 1VQP3 3G713 2F98A 3X41A 3SVAA 3HIIA 4HZ9B 2OTL3 2BMQB 1IVVA 1O7NB 3S67A 5ELJA 3CPW2 2OWPA 3ALAA 5FGOA 1FGQA 5D83A 1ASKA 3Q2PA 3LT8A 3UL6A 3D3LA 1JRQA 4FR9A 3D9RA 3RDEA 3CNMA 4KFEA 3VF1A 2XSOB 2CG1A 1KWIA 3LTAA 2QGUA 2YFLB 5IEPA 1S5AA 2UX0A 3ROBA 3BNBA 1Y4KA 4RBNA 3EF8A 3T0UA 3NM7A 1LXEA 2CFWA 2RFRA 4HZBB 4L8OA 3PXMA 1O7WB 3S27A 3VSYA 2D42A 2V1LA 2CFDA 3MKIA 3WMDA 4AKZA 4HM3B 2STDA 2QA43 2HMLB 5IG5A 4HM5B 4XB5A 1HKXA 2WOFA 2OQEC 3NQYA 2HMOB 2ML6A 3BLZA 3JUPA 1C7HA 2CW9A 4J9AA 2XGNA 3KZTA 1T5YA 3CXC2 4HM2B 3CCE3 3DGNA 1MOLA 2KRTA 3CCV3 3LMLA 3UJMA 1U8CB 1VQK3 4CCVA 4FMCA 2M7OA 1ISKA 1ROVA 1STFI 3KFQC 4H61A 3LTCA 4HKVB 4FCMA 2R4IA 1YVBI 1AV4A 1L5GB 2P05A 1W6CA 3BNEA 2GXFA 3OWSA 1YHQ3 3F9SA 1UI7A 1N9JA 2O9UX 2F86B 2YFJB 1YJW3 3PGBA 4LZIA 4AKYA 1DMQA 2W2CA 2RSXA 4WP5A 3JUQA 2W03A 1M1XB 3DXOA 3HIGA 1DMMA 3LTBA 1FGRA 2Z77A 2CKFB 4IPBA 5LC6A 5D82A 3NBBA 2W9PA 2IA7A 4JRFA 1D6ZA 3CD63 3WOFB 1ULIB 1ROAA 5DREA 1IQXA 3FZWA 2GEYA 5KP4A 3KSPA 4HM8B 1IT7A 2CK3H 3PZWA 3I563 1EQKA 4O3VA 3M8CA 3QRDA 2OCTA 1DVCA 3GZXB 3EJVA 3U97A 2WGQA 3STDA 3MWZA 3FF0A 5CF2A 4WYKA 1PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E 3;  3CCR 3;  1Q7Y 4;  1Q82 4;  2QEX 3;  1YJN 3;  3CC7 3;  1S72 3;  3CXC 2;  3CC4 3;  3CCE 3;  1YIT 3;  1QVF 2;  1VQ6 3;  1VQ4 3;  1M90 4;  1VQL 3;  1K8A 4;  1VQ5 3;  1VQO 3;  1N8R 4;  3CCM 3;  1VQK 3;  1YIJ 3;  3OW2 2;  3CCV 3;  1VQM 3;  1JJ2 2;  3CD6 3;  1VQN 3;  1VQP 3;  3G71 3;  1VQ9 3;  1QVG 2;  3I55 3;  1K73 4;  1NJI 4;  3CCL 3;  3CCS 3;  2OTJ 3;  3I56 3;  2OTL 3;  1M1K 4;  3CCU 3;  1YHQ 3;  2QA4 3;  1VQ8 3;  1KC8 4;  1K9M 4;  3CCJ 3;  1KQS 2;  3CPW 2;  3CMA 3;  1W2B 2;  3CC2 3;  1YI2 3;  1VQ7 3;  1Q81 4;  1Q86 4;  1KD1 4;  1YJ9 3;  3CCQ 3;  1YJW 3;  3CME 3;  3G4S 3; 
#chains in the Genus database with same CATH topology
 2P38 A;  4XM4 A;  4KFD A;  5AEU B;  1FW7 A;  2WGO A;  3VGN A;  4HOH A;  4EW5 A;  2C10 A;  2CFG A;  4Q53 A;  5AIF A;  1OH0 A;  3JUO A;  3K7C A;  3F7S A;  3KCH A;  2BMO B;  1CYU A;  2UUG C;  3GSP A;  4K1U A;  2WO0 A;  1IV7 A;  1GS3 A;  3FG1 A;  3H51 A;  1JJ2 2;  7RNT A;  1VQ9 3;  1N8Q A;  3IJE B;  4WYK B;  1BNF A;  2E2V A;  5AIG A;  3KE7 A;  1MGW A;  1IVW A;  1N5H A;  1I0V A;  1NDO B;  3KII A;  4BTW A;  3FLJ A;  5CF1 A;  4HJL B;  1M1K 4;  3PCR A;  3UNL A;  4HM4 B;  5IG0 A;  1DET A;  4X2H A;  4EC6 A;  1B2Z A;  2RBI A;  2D1W A;  5HGR A;  3GZB A;  3LOY A;  1DE3 A;  4WWU C;  3RGR A;  4MMX B;  3SED A;  2PNC A;  2AAD A;  1I2E A;  3CC4 3;  2PZV A;  1DYU A;  2CG0 A;  3WR2 A;  2XSH B;  1RJO A;  4NHF A;  2CHC A;  4BL3 A;  2ZDJ A;  2BNG A;  3TDG A;  3OW2 2;  1TP6 A;  1GOY A;  2WOH A;  3OWU A;  4HM7 B;  1QAK A;  1K41 A;  4K90 B;  5AEW B;  1J2B A;  3FSD A;  3S5C A;  3NX0 A;  1I3I A;  1DVD A;  1FGM A;  1YGW A;  3QK9 A;  2CFL A;  1NNV A;  1RKY A;  1WMP A;  1LOV A;  2K54 A;  5IEO A;  1IVX A;  2B1X B;  1OPY A;  4GHO A;  3CCU 3;  3EC9 A;  1QAF A;  3D79 A;  2LYX A;  1LOX A;  2OOV C;  1UUW B;  2INX A;  1NWW A;  3HX8 A;  1KD1 4;  1Q81 4;  1WMO A;  1JBR A;  1SJW A;  1RRH A;  3MG1 A;  5IF6 A;  2ZL8 A;  1SII A;  1X1U A;  3CNX A;  1B2S A;  1B2X A;  3BNC A;  1E97 A;  3SOA A;  1GY5 A;  4N3V A;  5AYS C;  1IU7 A;  3HOH A;  4GB5 A;  1VQM 3;  1BRI A;  2J8X B;  3T8U A;  5AYR B;  1FGT A;  2JQ5 A;  1FUT A;  3DGY A;  2CX0 A;  4QWT A;  3DUK A;  1OGX A;  3BU4 A;  3LXU X;  1EUI C;  2GBX B;  1W4N A;  3AGN A;  3HK4 A;  5EVH A;  1IDP A;  2CIU A;  1IQY A;  1VZZ A;  3LH4 A;  4HM6 B;  1EA2 A;  3B8L A;  3H3H A;  4HM0 B;  4BTY A;  1W5Z A;  3PS8 A;  7GSP A;  4R9L A;  2KXG A;  1Q7Y 4;  2XRX B;  1WMN A;  3F14 A;  1D6U A;  5IEN A;  3ZG5 A;  6RNT A;  4R4K A;  4L7K A;  1RGH A;  1F8N A;  5KP3 A;  2CH9 A;  3PYJ A;  4L8P A;  3U1W A;  1B3S A;  1TU5 A;  2W0Q A;  1O7G B;  1GY6 A;  1RGL A;  1WTH A;  4KVH A;  1V57 A;  2MF7 A;  1SQW A;  1TFK A;  3CCL 3;  1W6Y A;  2JDI H;  1OCV A;  3HZP A;  3Q1C A;  4OK0 A;  2RGQ A;  1BIR A;  3CPO A;  3LTD A;  4RNT A;  3NBR A;  3ZFZ A;  1RCL A;  1B27 A;  1CYV A;  1KC8 4;  1K9M 4;  2Z7A A;  1W00 A;  5STD A;  1LOY A;  1MGR A;  3K9M C;  1JBS A;  3JVC A;  3Q3F A;  1NB5 I;  3NM2 A;  3GWR A;  5LC7 A;  1RGA A;  3UB1 A;  2FNQ A;  2XR8 B;  1YJN 3;  1LOW A;  2HMK B;  2AAE A;  4N6V 0;  3N8B A;  3NHX A;  3OX9 A;  1JZO A;  1D6Y A;  1UGI A;  4MJD A;  5I97 A;  5RNT A;  5AII A;  3X42 A;  3G8Z A;  4KZ1 A;  4ORL A;  3ZG0 A;  3DY5 A;  3IMA B;  3GZY B;  4ILF A;  3B4P A;  1ZO2 A;  1A2K A;  1JN5 A;  1W6G A;  1RDS A;  3EQQ B;  4J5K A;  4N6M A;  1E3V A;  3BB9 A;  4OUQ A;  2P0M A;  5TGN A;  2XEP A;  1OHS A;  5IG4 A;  1R4C A;  1BNJ A;  4KFF A;  4N6L A;  1KQS 2;  1BUQ A;  2A15 A;  4O2H A;  5IW9 A;  2I9W A;  3OV4 A;  1RSN A;  1VQ7 3;  4STD A;  2KF5 A;  1US1 A;  2H0H A;  2OQE A;  2CWT A;  1Z1S A;  2W56 A;  3B4O A;  3BND A;  1GSP A;  1I2F A;  7STD A;  5JPP A;  1JN5 B;  1JV2 B;  1TUH A;  2BT3 A;  1K8A 4;  1VQ5 3;  1VQL 3;  1CQS A;  2CWU A;  5IER A;  1AR0 A;  4N6O B;  1RNB A;  3E99 A;  1AVK A;  4BU4 A;  1GD3 A;  2W6J H;  3MG2 A;  4AEQ A;  3KN4 A;  1NJI 4;  4J5G A;  3EX9 A;  2E2U A;  1B2U A;  2LQV A;  1GD4 A;  2W56 B;  1EKM A;  1TJD A;  5CXO A;  1JNQ A;  1RGC A;  1BRN L;  5JBS A;  2ML5 A;  3O8Y A;  1U5O A;  1T2I A;  5EQL A;  1NB3 I;  4I4K A;  4HM1 B;  3OWY A;  3CC2 3;  3WDG B;  2XFT A;  2KF6 A;  3GAX A;  1CEW I;  2F56 A;  4G1M B;  3G6E 3;  4HAA A;  3FF2 A;  4O8S A;  5GSP A;  4CJN A;  1SIH A;  2Q07 A;  1UCJ A;  3FCS B;  3WA3 A;  2IUK A;  4GL6 A;  4R1K A;  1FA3 A;  3EB8 A;  1GMR A;  3WOE B;  3MPH A;  9RNT A;  1Q7H A;  1LQM B;  1RN7 A;  1IYY A;  2HMN B;  1HU9 A;  2E2T A;  3FGY A;  1A2P A;  3FH1 A;  1GYB A;  5KP1 A;  2IUJ A;  1Q40 A;  1M9G A;  3FG3 A;  4HYZ A;  1OF5 A;  2KF3 A;  3KSE D;  3AMO A;  3WA2 X;  1BRK A;  3X3Y A;  1QVF 2;  1BRJ A;  1QMA A;  2F4Y A;  3B7C A;  3J7Y d;  1FYS A;  4U13 A;  3G16 A;  1Q82 4;  3MHE A;  1UCI A;  3CU3 A;  4PEJ A;  1EEJ A;  1VQ4 3;  3RGA A;  1T2H A;  1JB5 A;  5BVB A;  3KKG A;  4IT7 A;  1NO3 A;  4N6T A;  4LEH A;  1OAC A;  4LMI A;  4R80 A;  1Q40 B;  6STD A;  4ZM8 A;  1RTU A;  4LSO A;  8RNT A;  1TIJ A;  1OF5 B;  1Q9E A;  3NQZ A;  1PYL A;  3AMO B;  4LGQ A;  3V98 A;  2BHM A;  1B2M A;  1DMN A;  3V99 A;  3K5T A;  4HVN A;  4FMB A;  3LYG A;  4EXR A;  5BXQ A;  1R4Y A;  3D4A A;  4EYC A;  5ELU A;  1O7P B;  4N6U A;  2F5W A;  1W2Z A;  2GSP A;  3EN1 B;  3WOD G;  3SXX A;  3LT9 A;  2P09 A;  4RZM A;  1BRS A;  1RGE A;  2C4B A;  1OUN A;  1YVS A;  1I2G A;  4MEI A;  1A90 A;  1GMP A;  1YI2 3;  3F8H A;  3F7X A;  4WFO A;  3CCQ 3;  1I70 A;  3JUM A;  3X3X A;  4BTX A;  3CME 3;  1YJ9 3;  1VQN 3;  1LNH A;  4EV2 A;  2QEX 3;  5DRV A;  3DGM A;  5A0O B;  1YIT 3;  1VQ6 3;  5M1A A;  1I0X A;  3UL5 A;  3EHC A;  3CCM 3;  1UGH I;  2GEX A;  4JF8 A;  1BUJ A;  2B24 B;  1IVU A;  3K63 A;  1I8V A;  3EE1 A;  2BMR B;  1AVL A;  4KT3 B;  4K61 A;  1QJG A;  1IK3 A;  1A67 A;  4O02 B;  3SX1 A;  1RGG A;  1TFO A;  1OHO A;  1ZX2 A;  1IQ8 A;  3NBJ A;  1MNL A;  3X3Z A;  1G96 A;  3RNT A;  2SBL A;  4CPK A;  1BSD A;  1EG9 B;  8CHO A;  3A76 A;  2CX1 A;  1TRP A;  4EV5 A;  1UCL A;  3MSO A;  4BIR A;  1TRQ A;  1RNT A;  2Z76 A;  2CWV A;  2IYJ A;  3DGO A;  5G2G A;  3CMA 3;  4FCJ A;  5D81 A;  1STD A;  3PCS A;  2OOV A;  4XBX A;  1UUG B;  4WHA A;  3S29 A;  1Q86 4;  1N5P A;  2XGL A;  5AI1 A;  1V58 A;  4X2O A;  1S72 3;  1OGZ A;  2Y74 A;  1LVN A;  1BNE A;  3MYT A;  4TX4 A;  3NXJ A;  1O7H B;  2L4V A;  3DZL A;  1VQO 3;  1UI8 A;  3GRD A;  1YIJ 3;  3D5G A;  3URP A;  3F8X A;  2XFS A;  3GZR A;  1YGE A;  1BNG A;  1PY3 A;  3JUN A;  3DMC A;  1KSI A;  5JPU A;  1BU4 A;  1NU3 A;  4J8T A;  5BIR A;  3G0K A;  1WQL B;  1TTO A;  3SLU A;  1RHL A;  1E3R A;  1OHP A;  2HOH A;  1IV9 A;  3L0R A;  3EBT A;  5BU4 A;  2FXT A;  1C54 A;  1RMS A;  3CCJ 3;  1RLS A;  3T8N A;  3DGL A;  3IPT A;  3EN8 A;  1CH0 A;  5CLK A;  1IT8 A;  1SAR A;  1JKG A;  2W04 A;  1A2V A;  3N9H A;  1FUW A;  2FGT A;  3V92 A;  5IG3 A;  5FW5 A;  2XH9 A;  5EEO A;  3OXA A;  3ECF A;  2YX9 A;  4FCZ A;  4K1V A;  1N8R 4;  3HI7 A;  3AHW A;  4OVM A;  1JB4 A;  4NPB A;  1Q42 A;  2F5M A;  2Y73 A;  4FMA A;  3FG4 A;  1RGK A;  2HMJ B;  1W02 A;  2IMJ A;  1QVG 2;  5CK6 A;  1JKG B;  2GU1 A;  2KCD A;  3ER7 A;  4HBR A;  3SOY A;  3CCS 3;  1BNR A;  1JB2 A;  1W7C A;  1B20 A;  3F40 A;  1FGO A;  3BIR A;  1MWT A;  4CDL A;  1LNI A;  1RN1 A;  1X1W A;  1X1X A;  2F99 A;  4NRE A;  1VQ8 3;  1GY7 A;  1MWU A;  1G02 A;  1W2B 2;  3MG3 A;  1PU4 A;  3G4S 3;  3S28 A;  4EBG A;  2SAR A;  2BO9 B;  1BNS A;  2XF3 A;  3CC7 3;  4MMY B;  2MC8 A;  1AY7 A;  1BVI A;  1UUV B;  1VQQ A;  2K3D A;  1O7M B;  4XBT A;  1M90 4;  2RNT A;  3X40 A;  1SPU A;  1WNH A;  4IIA A;  1RRL A;  2CC3 A;  4XDW A;  2GBW B;  4N6N B;  3Q90 A;  3K0Z A;  2H0I A;  1FUS A;  3LZA A;  2HMM B;  1I3F A;  2C11 A;  3I0Y A;  3I55 3;  1K73 4;  2OTJ 3;  1FZU A;  2H0G A;  2KF4 A;  4R9K A;  2O3O A;  2K0M A;  2RCD A;  2W9Q A;  4RNZ A;  5AIH A;  2QIY A;  2YFI B;  1N9E A;  1G0T A;  3N54 B;  1W01 A;  3NV0 A;  3DM8 A;  4FMD A;  1JZD A;  1BRH A;  1UDI I;  1ULJ B;  2CFK A;  2P0X A;  1QAL A;  1K28 A;  3CCR 3;  1YNV X;  2GU3 A;  4XDV A;  1V74 A;  3FKA A;  2Z6B A;  3EBY A;  4H3U A;  5HOH A;  1BAO A;  1RN4 A;  4MMZ B;  4XBY A;  3NV0 B;  1UW1 A;  4RNY A;  1AQZ A;  3NUV A;  1VQP 3;  4GSP A;  3G71 3;  1B21 A;  2F98 A;  3X41 A;  3SVA A;  2BIR A;  2ZHX B;  3HII A;  2UGI A;  4HZ9 B;  2OTL 3;  1BOX A;  2BMQ B;  1IVV A;  1O7N B;  3S67 A;  5ELJ A;  3CPW 2;  2OWP A;  3ALA A;  5FGO A;  1FGQ A;  5D83 A;  1ASK A;  1BSC A;  3Q2P A;  3LT8 A;  3UL6 A;  1UCK A;  3D3L A;  1ZGX A;  1T3B A;  2L1S A;  1JRQ A;  4FR9 A;  3D9R A;  3RDE A;  3CNM A;  4KFE A;  3VF1 A;  1RGF A;  2XSO B;  4I5Q A;  2CG1 A;  3DH2 A;  1KWI A;  3A5E A;  3LTA A;  2QGU A;  2YFL B;  5M18 A;  5IEP A;  1S5A A;  1GOV A;  2UX0 A;  3BNB A;  1Y4K A;  3ROB A;  4RBN A;  3EF8 A;  3T0U A;  3NM7 A;  1LXE A;  2CFW A;  2RFR A;  4HZB B;  4L8O A;  3PXM A;  1O7W B;  3S27 A;  3VSY A;  2D42 A;  2V1L A;  2CFD A;  3MKI A;  3WMD A;  4AKZ A;  2ZA4 A;  4HM3 B;  2STD A;  2QA4 3;  2HML B;  5IG5 A;  4HM5 B;  4XB5 A;  1HKX A;  2WOF A;  2OQE C;  3NQY A;  2HMO B;  2ML6 A;  3BLZ A;  3JUP A;  1BRG A;  1C7H A;  1HZ1 A;  2CW9 A;  4J9A A;  2XGN A;  3KZT A;  1T5Y A;  4LYL B;  4HM2 B;  3CXC 2;  3DGN A;  1MOL A;  2KRT A;  3CCE 3;  3CCV 3;  3LML A;  3UJM A;  1U8C B;  1VQK 3;  4CCV A;  4FMC A;  2M7O A;  1ISK A;  1ROV A;  1STF I;  2IY2 A;  1ZS7 A;  3KFQ C;  3LTC A;  4H61 A;  1MWS A;  1BNI A;  4FCM A;  4HKV B;  2R4I A;  2KAA A;  1YVB I;  1AV4 A;  1L5G B;  2P05 A;  1W6C A;  3BNE A;  5G1L A;  1HYF A;  2GXF A;  3OWS A;  4BL2 A;  1YHQ 3;  2R41 A;  1RCK A;  3F9S A;  1UI7 A;  1X1Y A;  1N9J A;  1JBT A;  1BGS A;  2O9U X;  2F86 B;  2YFJ B;  1YJW 3;  3PGB A;  4DKI A;  1BSA A;  4LZI A;  4AKY A;  6GSP A;  1DMQ A;  1MWR A;  2W2C A;  2RSX A;  4WP5 A;  1LRA A;  3JUQ A;  2W03 A;  1GMQ A;  1M1X B;  3DXO A;  1DMM A;  3HIG A;  3WHO A;  3LTB A;  1FGR A;  2BU4 A;  2Z77 A;  2CKF B;  4IPB A;  5LC6 A;  5D82 A;  3NBB A;  2W9P A;  2IA7 A;  3D5I A;  1D6Z A;  4JRF A;  3AGO A;  3CD6 3;  3WOF B;  1ULI B;  1ROA A;  5M19 A;  1GOU A;  5DRE A;  1IQX A;  3AHS A;  3FZW A;  2GEY A;  3SYU A;  5KP4 A;  3KSP A;  4HM8 B;  1IT7 A;  2CK3 H;  3PZW A;  3I56 3;  1EQK A;  4O3V A;  3M8C A;  5G1K A;  1BAN A;  3QRD A;  1BSE A;  1BSB A;  2OCT A;  1DVC A;  3GZX B;  3EJV A;  3U97 A;  2WGQ A;  3STD A;  3MWZ A;  1LQG C;  3FF0 A;  5CF2 A;  4WYK A;  1PFP A; 
#chains in the Genus database with same CATH homology
 2P38 A;  4XM4 A;  4KFD A;  5AEU B;  2WGO A;  3VGN A;  2C10 A;  2CFG A;  4Q53 A;  5AIF A;  1OH0 A;  3JUO A;  3K7C A;  3F7S A;  2BMO B;  1CYU A;  4K1U A;  2WO0 A;  1IV7 A;  1GS3 A;  3FG1 A;  3H51 A;  1VQ9 3;  1N8Q A;  3IJE B;  4WYK B;  2E2V A;  5AIG A;  3KE7 A;  1NDO B;  1IVW A;  1N5H A;  3KII A;  4BTW A;  3FLJ A;  5CF1 A;  4HJL B;  1M1K 4;  3PCR A;  3UNL A;  4HM4 B;  5IG0 A;  4X2H A;  4EC6 A;  5HGR A;  2D1W A;  3GZB A;  3LOY A;  4WWU C;  3RGR A;  4MMX B;  3SED A;  2PNC A;  3CC4 3;  2PZV A;  1DYU A;  2CG0 A;  2XSH B;  1RJO A;  4NHF A;  2CHC A;  2ZDJ A;  2BNG A;  3TDG A;  3OW2 2;  1TP6 A;  3OWU A;  2WOH A;  4HM7 B;  1QAK A;  1K41 A;  4K90 B;  5AEW B;  1J2B A;  3FSD A;  3S5C A;  3NX0 A;  1DVD A;  1FGM A;  3QK9 A;  2CFL A;  1RKY A;  1WMP A;  2K54 A;  5IEO A;  1IVX A;  2B1X B;  1OPY A;  3CCU 3;  3EC9 A;  1QAF A;  2LYX A;  1LOX A;  2OOV C;  1UUW B;  2INX A;  1NWW A;  3HX8 A;  1KD1 4;  1Q81 4;  1WMO A;  1SJW A;  1RRH A;  3MG1 A;  5IF6 A;  2ZL8 A;  1SII A;  3CNX A;  3BNC A;  1E97 A;  3SOA A;  1GY5 A;  4N3V A;  5AYS C;  1IU7 A;  4GB5 A;  1VQM 3;  3T8U A;  5AYR B;  1FGT A;  2JQ5 A;  4QWT A;  3DUK A;  1OGX A;  3LXU X;  2GBX B;  1W4N A;  3HK4 A;  5EVH A;  1IDP A;  2CIU A;  1IQY A;  1VZZ A;  3LH4 A;  4HM6 B;  1EA2 A;  3B8L A;  3H3H A;  4HM0 B;  4BTY A;  1W5Z A;  3PS8 A;  4R9L A;  2KXG A;  1Q7Y 4;  2XRX B;  1WMN A;  3F14 A;  1D6U A;  5IEN A;  4R4K A;  4L7K A;  1F8N A;  5KP3 A;  2CH9 A;  3PYJ A;  4L8P A;  3U1W A;  1TU5 A;  2W0Q A;  1O7G B;  1GY6 A;  1WTH A;  4KVH A;  3CCL 3;  2MF7 A;  1SQW A;  1TFK A;  1W6Y A;  2JDI H;  1OCV A;  3HZP A;  3Q1C A;  4OK0 A;  2RGQ A;  3CPO A;  3LTD A;  3NBR A;  1CYV A;  1KC8 4;  1K9M 4;  2Z7A A;  1W00 A;  5STD A;  3K9M C;  3JVC A;  3NM2 A;  3GWR A;  5LC7 A;  3UB1 A;  2FNQ A;  2XR8 B;  1YJN 3;  2HMK B;  4N6V 0;  3N8B A;  3NHX A;  3OX9 A;  1D6Y A;  4MJD A;  5I97 A;  5AII A;  3X42 A;  3G8Z A;  4KZ1 A;  4ORL A;  3DY5 A;  3IMA B;  3GZY B;  3B4P A;  1ZO2 A;  1A2K A;  1JN5 A;  1W6G A;  3EQQ B;  4N6M A;  1E3V A;  3BB9 A;  4OUQ A;  2P0M A;  5TGN A;  2XEP A;  1OHS A;  5IG4 A;  1R4C A;  4KFF A;  1KQS 2;  4N6L A;  1BUQ A;  2A15 A;  4O2H A;  5IW9 A;  2I9W A;  3OV4 A;  1VQ7 3;  4STD A;  1US1 A;  2OQE A;  2CWT A;  1Z1S A;  2W56 A;  3B4O A;  3BND A;  5JPP A;  7STD A;  1JN5 B;  1JV2 B;  1TUH A;  2BT3 A;  1K8A 4;  1VQ5 3;  1VQL 3;  1CQS A;  2CWU A;  5IER A;  1AR0 A;  4N6O B;  3E99 A;  1AVK A;  1GD3 A;  2W6J H;  3MG2 A;  4AEQ A;  3KN4 A;  1NJI 4;  3EX9 A;  2E2U A;  2LQV A;  1GD4 A;  2W56 B;  1EKM A;  5CXO A;  1JNQ A;  5JBS A;  2ML5 A;  3O8Y A;  1U5O A;  5EQL A;  1NB3 I;  4I4K A;  4HM1 B;  3OWY A;  3CC2 3;  3WDG B;  2XFT A;  3GAX A;  3G6E 3;  1CEW I;  4G1M B;  3FF2 A;  4O8S A;  1SIH A;  2Q07 A;  3FCS B;  3WA3 A;  2IUK A;  4GL6 A;  4R1K A;  1FA3 A;  3EB8 A;  3WOE B;  3MPH A;  1RN7 A;  2HMN B;  1HU9 A;  2E2T A;  3FGY A;  3FH1 A;  1GYB A;  5KP1 A;  2IUJ A;  1Q40 A;  1M9G A;  3FG3 A;  4HYZ A;  1OF5 A;  3KSE D;  3AMO A;  3WA2 X;  3X3Y A;  1QVF 2;  1QMA A;  3B7C A;  3J7Y d;  4U13 A;  3G16 A;  1Q82 4;  3MHE A;  3CU3 A;  4PEJ A;  1VQ4 3;  3RGA A;  1JB5 A;  5BVB A;  3KKG A;  4IT7 A;  1NO3 A;  4N6T A;  4LEH A;  1OAC A;  4LMI A;  4R80 A;  1Q40 B;  6STD A;  4ZM8 A;  4LSO A;  1JJ2 2;  1TIJ A;  1OF5 B;  3NQZ A;  3V98 A;  3AMO B;  4LGQ A;  2BHM A;  1DMN A;  3V99 A;  3K5T A;  4HVN A;  4FMB A;  3LYG A;  4EXR A;  5BXQ A;  4EYC A;  5ELU A;  1O7P B;  4N6U A;  1W2Z A;  3EN1 B;  3WOD G;  3SXX A;  3LT9 A;  2P09 A;  4RZM A;  1OUN A;  4MEI A;  1A90 A;  1YI2 3;  3F8H A;  3F7X A;  4WFO A;  3CCQ 3;  3JUM A;  3X3X A;  4BTX A;  3CME 3;  1YJ9 3;  1VQN 3;  1LNH A;  4EV2 A;  2QEX 3;  5DRV A;  3DGM A;  5A0O B;  1YIT 3;  1VQ6 3;  3UL5 A;  3EHC A;  3CCM 3;  4JF8 A;  2GEX A;  2B24 B;  1IVU A;  3K63 A;  3EE1 A;  2BMR B;  1AVL A;  4K61 A;  1QJG A;  1IK3 A;  1A67 A;  4O02 B;  3SX1 A;  1TFO A;  1OHO A;  1ZX2 A;  1IQ8 A;  3NBJ A;  1MNL A;  3X3Z A;  1G96 A;  2SBL A;  8CHO A;  1EG9 B;  3A76 A;  4EV5 A;  3MSO A;  2Z76 A;  2CWV A;  3DGO A;  5G2G A;  3CMA 3;  4FCJ A;  5D81 A;  1STD A;  3PCS A;  2OOV A;  4XBX A;  4WHA A;  3S29 A;  1Q86 4;  1NB5 I;  1N5P A;  2XGL A;  5AI1 A;  4X2O A;  1S72 3;  1OGZ A;  2Y74 A;  1LVN A;  3MYT A;  4TX4 A;  3NXJ A;  1O7H B;  2L4V A;  3DZL A;  1VQO 3;  1UI8 A;  3GRD A;  1YIJ 3;  3F8X A;  2XFS A;  3GZR A;  1YGE A;  3JUN A;  3DMC A;  1KSI A;  5JPU A;  1NU3 A;  4J8T A;  3G0K A;  1WQL B;  3SLU A;  1E3R A;  1OHP A;  1IV9 A;  3L0R A;  3EBT A;  2FXT A;  3CCJ 3;  3T8N A;  3DGL A;  3IPT A;  3EN8 A;  5CLK A;  1IT8 A;  2W04 A;  1JKG A;  1A2V A;  3N9H A;  1FUW A;  2FGT A;  3V92 A;  5IG3 A;  5FW5 A;  2XH9 A;  5EEO A;  3OXA A;  3ECF A;  2YX9 A;  4FCZ A;  4K1V A;  1N8R 4;  3HI7 A;  4OVM A;  1JB4 A;  1Q42 A;  2Y73 A;  4FMA A;  3FG4 A;  2HMJ B;  1W02 A;  2IMJ A;  1QVG 2;  5CK6 A;  1JKG B;  2GU1 A;  2KCD A;  3ER7 A;  4HBR A;  3SOY A;  3CCS 3;  1JB2 A;  1W7C A;  3F40 A;  1FGO A;  4CDL A;  2F99 A;  4NRE A;  1VQ8 3;  1GY7 A;  1W2B 2;  3MG3 A;  1PU4 A;  3G4S 3;  3S28 A;  4EBG A;  2BO9 B;  2XF3 A;  3CC7 3;  4MMY B;  2MC8 A;  1UUV B;  1M90 4;  1O7M B;  4XBT A;  3X40 A;  1SPU A;  1WNH A;  4IIA A;  1RRL A;  2CC3 A;  4XDW A;  2GBW B;  4N6N B;  3Q90 A;  3K0Z A;  3LZA A;  2HMM B;  2C11 A;  3I0Y A;  3I55 3;  1K73 4;  2OTJ 3;  4R9K A;  2O3O A;  2K0M A;  2RCD A;  2W9Q A;  4RNZ A;  5AIH A;  2QIY A;  2YFI B;  1N9E A;  3N54 B;  1W01 A;  3NV0 A;  3DM8 A;  4FMD A;  1ULJ B;  2CFK A;  2P0X A;  1QAL A;  1K28 A;  3CCR 3;  2GU3 A;  4XDV A;  1V74 A;  3FKA A;  2Z6B A;  3EBY A;  4H3U A;  4MMZ B;  4XBY A;  3NV0 B;  1UW1 A;  4RNY A;  3NUV A;  1VQP 3;  3G71 3;  2F98 A;  3X41 A;  3SVA A;  3HII A;  4HZ9 B;  2OTL 3;  2BMQ B;  1IVV A;  1O7N B;  3S67 A;  5ELJ A;  3CPW 2;  2OWP A;  3ALA A;  5FGO A;  1FGQ A;  5D83 A;  1ASK A;  3Q2P A;  3LT8 A;  3UL6 A;  3D3L A;  1JRQ A;  4FR9 A;  3D9R A;  3RDE A;  3CNM A;  4KFE A;  3VF1 A;  2XSO B;  2CG1 A;  1KWI A;  3LTA A;  2QGU A;  2YFL B;  5IEP A;  1S5A A;  2UX0 A;  3ROB A;  3BNB A;  1Y4K A;  4RBN A;  3EF8 A;  3T0U A;  3NM7 A;  1LXE A;  2CFW A;  2RFR A;  4HZB B;  4L8O A;  3PXM A;  1O7W B;  3S27 A;  3VSY A;  2D42 A;  2V1L A;  2CFD A;  3MKI A;  3WMD A;  4AKZ A;  4HM3 B;  2STD A;  2QA4 3;  2HML B;  5IG5 A;  4HM5 B;  4XB5 A;  1HKX A;  2WOF A;  2OQE C;  3NQY A;  2HMO B;  2ML6 A;  3BLZ A;  3JUP A;  1C7H A;  2CW9 A;  4J9A A;  2XGN A;  3KZT A;  1T5Y A;  3CXC 2;  4HM2 B;  3CCE 3;  3DGN A;  1MOL A;  2KRT A;  3CCV 3;  3LML A;  3UJM A;  1U8C B;  1VQK 3;  4CCV A;  4FMC A;  2M7O A;  1ISK A;  1ROV A;  1STF I;  3KFQ C;  4H61 A;  3LTC A;  4HKV B;  4FCM A;  2R4I A;  1YVB I;  1AV4 A;  1L5G B;  2P05 A;  1W6C A;  3BNE A;  2GXF A;  3OWS A;  1YHQ 3;  3F9S A;  1UI7 A;  1N9J A;  2O9U X;  2F86 B;  2YFJ B;  1YJW 3;  3PGB A;  4LZI A;  4AKY A;  1DMQ A;  2W2C A;  2RSX A;  4WP5 A;  3JUQ A;  2W03 A;  1M1X B;  3DXO A;  3HIG A;  1DMM A;  3LTB A;  1FGR A;  2Z77 A;  2CKF B;  4IPB A;  5LC6 A;  5D82 A;  3NBB A;  2W9P A;  2IA7 A;  4JRF A;  1D6Z A;  3CD6 3;  3WOF B;  1ULI B;  1ROA A;  5DRE A;  1IQX A;  3FZW A;  2GEY A;  5KP4 A;  3KSP A;  4HM8 B;  1IT7 A;  2CK3 H;  3PZW A;  3I56 3;  1EQK A;  4O3V A;  3M8C A;  3QRD A;  2OCT A;  1DVC A;  3GZX B;  3EJV A;  3U97 A;  2WGQ A;  3STD A;  3MWZ A;  3FF0 A;  5CF2 A;  4WYK A;  1PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...