1K734

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k73400
3CCQ3 3CCV3 1Q7Y4 1YI23 1K8A4 3CME3 3OW22 1KQS2 1VQN3 3CCM3 2QEX3 3G4S3 1VQK3 1Q864 1VQ53 1VQP3 3CCS3 1VQ63 1NJI4 1KD14 1VQ73 3CCR3 3I563 1YIJ3 2QA43 1W2B2 1YHQ3 1K9M4 1YJ93 1KC84 1YIT3 1VQ43 3CD63 3CCL3 3CPW2 1Q824 1JJ22 1VQM3 1S723 1YJW3 3CC73 1M1K4 1QVG2 3CXC2 1VQ93 3CC23 1VQ83 3G713 3CCE3 3CCU3 3G6E3 1VQO3 3CMA3 1Q814 3CC43 1M904 2OTJ3 3I553 1K734 1YJN3 1QVF2 2OTL3 1VQL3 3CCJ3 1N8R4
chains in the Genus database with same CATH superfamily
2B24B 1Q42A 1NU3A 3S27A 1Q7HA 3ECFA 7GSPA 1IVUA 1T2IA 3EE1A 1Q864 5BXQA 4GL6A 1JZDA 2CG0A 2RSXA 4NHFA 4RNTA 5IERA 1PY3A 1BIRA 3Q2PA 1W5ZA 3DGMA 2SARA 2WOHA 3HOHA 3IPTA 1OUNA 3MG2A 4HVNA 5ELUA 1BRSA 5AEUB 3DM8A 2WGOA 4HM4B 2A15A 1STDA 3BIRA 4LEHA 1JZOA 1PU4A 1RCLA 1OHSA 5AIIA 3G8ZA 3NQZA 1VQO3 4NPBA 3T0UA 3L0RA 4XB5A 1CH0A 2XRXB 1QALA 1EQKA 2STDA 1NDOB 1Z1SA 2PNCA 3DGYA 3JUMA 3AGOA 1TRQA 3EHCA 1TFKA 1A2VA 1JN5A 2IUKA 2E2TA 4HM8B 2Z76A 2UX0A 4WYKB 5KP4A 1VQN3 2W03A 1YNVX 1AQZA 2F86B 3BU4A 3AMOB 4RZMA 4KFFA 4MEIA 1VQ73 1BNGA 5G2GA 5JBSA 4CPKA 4ORLA 2PZVA 5DRVA 1OH0A 4HAAA 4CJNA 4BU4A 3JVCA 3ZG0A 2ML5A 1C7HA 2CH9A 3K7CA 2OOVA 2LYXA 1GMPA 3CNXA 2MF7A 3K63A 1W6YA 3S5CA 2CX0A 4J9AA 1BRHA 1BAOA 3PS8A 1RGCA 1D6ZA 4CCVA 1TFOA 2GEXA 2HMKB 3DXOA 4HM2B 1W4NA 3MSOA 3CCQ3 4BIRA 5EEOA 4O2HA 3UNLA 1BGSA 2BMRB 2I9WA 1RNTA 1VQQA 2Z77A 3LTDA 3V92A 1W6CA 1ZX2A 4LZIA 2B1XB 3PGBA 1RGEA 3NV0B 2H0IA 2UUGC 4MMYB 4G1MB 5IG0A 2XR8B 3CD63 4JF8A 1RGGA 4OVMA 1IQ8A 1RTUA 3AHWA 2IY2A 2W6JH 3I0YA 1MWUA 3KIIA 4HM7B 1R4CA 1R4YA 5AIHA 3MHEA 3Q90A 5A0OB 1ULJB 3G6E3 1ROVA 1SJWA 4HM3B 1OGZA 1W00A 4EBGA 1AVKA 1FGRA 3X3XA 4K1UA 3S67A 1M1XB 3CCV3 3F9SA 3OW22 3DUKA 1JBSA 1GY5A 2P09A 1BNIA 1FUWA 2GU1A 4LSOA 5D83A 4J8TA 2ZA4A 4N6TA 3HIGA 1N5PA 4R1KA 3S28A 1OF5B 2R41A 1KSIA 2QA43 1JB5A 2WGQA 5ELJA 3ER7A 2W56A 4LGQA 3SX1A 1K41A 1YIT3 2W04A 1BNSA 3EB8A 2GBWB 2YFIB 2LQVA 4BTXA 1QMAA 2RFRA 2YX9A 3LOYA 4FMBA 1V58A 1MGRA 3HIIA 7RNTA 1G0TA 5IG5A 1TIJA 1F8NA 3GZXB 3KFQC 5BU4A 5JPUA 3Q3FA 3ROBA 1Q814 3SOAA 4HM0B 1NNVA 5DREA 2HOHA 1G02A 1Q9EA 1U5OA 4FCJA 1KWIA 3NBBA 3UB1A 1IVVA 1L5GB 3RNTA 3N9HA 1I2FA 1PFPA 4IIAA 1OPYA 2C4BA 1N5HA 3KE7A 3URPA 3CCS3 1DVDA 4QWTA 4HJLB 3CCR3 3QK9A 4HZBB 1VQ43 2ZDJA 2CIUA 1Q824 1DETA 1OHOA 2H0GA 3BNDA 4R9LA 3JUQA 1BSDA 2CFKA 3A76A 2K54A 3FZWA 1IQXA 1U8CB 1AR0A 1W7CA 1A90A 3CCU3 1YGWA 3CMA3 3B4PA 3D5GA 1DMMA 1WTHA 4MMXB 4WHAA 3IJEB 2UGIA 3EBTA 1SPUA 1LOWA 1W6GA 1RN4A 3MG1A 1B2XA 3LT9A 3D3LA 1FGMA 3DZLA 4BTWA 1LOYA 2C10A 3OX9A 4EV2A 3SVAA 4OUQA 4LYLB 5STDA 1WQLB 8RNTA 1DMNA 9RNTA 1DE3A 4EC6A 3FG4A 2CWVA 1GY6A 1N8QA 3EX9A 4RNZA 4KT3B 1G96A 1OCVA 1RRHA 2YFJB 2F5MA 1J2BA 1ISKA 1RMSA 2Z6BA 2W9PA 1FUSA 4N6OB 4WYKA 4H3UA 1UI8A 1GD3A 1IVXA 3FKAA 2JDIH 3GWRA 4I4KA 4XBYA 3GZYB 2BHMA 2FNQA 3AMOA 3KKGA 4K61A 1STFI 1JKGA 1ASKA 1RGAA 2RNTA 3F7XA 1IV9A 1I0XA 2INXA 1GOYA 2OTL3 4FMCA 3GZRA 3X3ZA 1K8A4 1RRLA 3NM7A 1K28A 1BNEA 5CXOA 1VQ53 2BT3A 1BNFA 1X1YA 2WO0A 1TRPA 2H0HA 1I0VA 1KC84 1IDPA 2IUJA 5KP1A 4FMAA 3TDGA 2YFLB 3X41A 1YJW3 1JV2B 3PZWA 1UDII 3WOEB 3JUPA 3Q1CA 1WMOA 2OQEC 3CC23 4L7KA 4RNYA 1JNQA 2GXFA 3UJMA 3G713 3AGNA 4XBTA 1I2GA 3WA2X 3CC43 1LQMB 1FYSA 3HI7A 3NV0A 1PYLA 1BSCA 4HYZA 1LNHA 2CHCA 5TGNA 3T8UA 1BRNL 5KP3A 1YI23 1E3VA 3GZBA 3LTBA 3FG3A 3LTCA 2BU4A 4HKVB 4XDVA 5GSPA 3V99A 1BSEA 4DKIA 3J7Yd 3H51A 3G4S3 5AEWB 3T8NA 3CCM3 1VQP3 1US1A 4EW5A 1MWSA 2CC3A 4NREA 6GSPA 3FCSB 4FCMA 2L1SA 2O3OA 2HMLB 2IA7A 2KCDA 2V1LA 3OXAA 3CCL3 3SYUA 4AKYA 3EJVA 1JN5B 3FGYA 1GYBA 3MWZA 3LTAA 1BUJA 4L8OA 1RSNA 1SIHA 1QAFA 2CW9A 1RN7A 3A5EA 1X1WA 4R80A 3FLJA 1M1K4 1UGIA 2W0QA 2F99A 3LXUX 4CDLA 3OV4A 4O02B 2C11A 1HZ1A 2L4VA 2J8XB 3X40A 3WA3A 2OCTA 3EF8A 4GHOA 1TJDA 1EUIC 1BVIA 2BIRA 1Q7Y4 4X2HA 3BNEA 2RGQA 2BO9B 2BMOB 2CK3H 1VQK3 3G16A 5CF1A 3DH2A 3ZFZA 1KD14 3DY5A 4WWUC 3ALAA 1N9EA 3DGOA 2CG1A 1EA2A 1IYYA 1UCKA 1V74A 3N54B 1EEJA 5CK6A 1JB2A 3F8XA 5IF6A 3VF1A 4N6V0 2CFGA 3NBRA 1UCIA 3KN4A 4BL2A 1IT8A 1E97A 3HK4A 3CCE3 1DYUA 4OK0A 1UW1A 3NM2A 2FGTA 1TP6A 1BRGA 4IT7A 3FF2A 6RNTA 4N6UA 1BRKA 3EC9A 3H3HA 4X2OA 5EVHA 1AY7A 1O7NB 3BNCA 1I3IA 1QAKA 1OACA 1AVLA 4TX4A 2QEX3 3MPHA 5D82A 4BTYA 1TTOA 1IV7A 2KXGA 1LNIA 1LOVA 1T2HA 1VZZA 3MG3A 2M7OA 3VGNA 6STDA 1A67A 4RBNA 1IU7A 4BL3A 1S723 5CF2A 1JBRA 3GSPA 1UCLA 5IEOA 1RLSA 1FGOA 3QRDA 2ZHXB 2P0MA 5JPPA 1T5YA 2GU3A 4WFOA 4FCZA 3RDEA 1CEWI 1YGEA 2W56B 5AIFA 1GD4A 1B2SA 5I97A 1B21A 3OWYA 4MJDA 2ML6A 3M8CA 3VSYA 3OWSA 1JBTA 1S5AA 3NBJA 2Z7AA 1YVSA 1E3RA 3EBYA 3N8BA 1B2ZA 1B2UA 3NHXA 3WHOA 4H61A 1FGTA 4HM5B 1OGXA 2HMNB 1X1XA 1GMRA 1K9M4 3EN8A 1I70A 1Q40B 1A2KA 1IQYA 4EXRA 1EG9B 1RN1A 1YJ93 2IMJA 3CNMA 1MNLA 4KFDA 3KCHA 3DMCA 5IG4A 2F56A 1FZUA 2E2VA 3HX8A 1LOXA 2CX1A 3FH1A 1VQ83 4J5GA 2BNGA 4IPBA 1GY7A 1I3FA 1B2MA 4N3VA 5G1LA 4Q53A 3I553 2KF6A 1FGQA 2KF3A 1GMQA 3DGNA 5HOHA 5CLKA 3DGLA 5IEPA 4HM1B 1BSBA 1KQS2 1ZS7A 1ZO2A 2F98A 3PYJA 1W02A 1FW7A 3WR2A 1NB3I 1DVCA 1BNRA 2XF3A 3NXJA 2D42A 4K1VA 3STDA 4STDA 1D6YA 2KRTA 1ULIB 2CWUA 2SBLA 1GSPA 2QGUA 2RBIA 3D4AA 3GRDA 1O7HB 1UUVB 2KF5A 2HMJB 3LH4A 3S29A 2GBXB 2KF4A 1SQWA 4N6LA 1GS3A 2K3DA 1BRJA 2OOVC 3K5TA 1N9JA 3EQQB 1M904 2AADA 1O7GB 1YJN3 1BNJA 4R4KA 5EQLA 1MGWA 2CFDA 1D6UA 2XSOB 3B7CA 1W2B2 1LXEA 1QJGA 2CKFB 2JQ5A 1W01A 1VQ63 1JKGB 2QIYA 2D1WA 5FW5A 1NJI4 3O8YA 2W9QA 3I563 1YHQ3 3F40A 1MOLA 2R4IA 5AYRB 3CPW2 2P0XA 1JJ22 1VQM3 2XFSA 3FF0A 1O7WB 5IENA 2Q07A 1CYUA 1MWRA 1UGHI 1ZGXA 5AI1A 3BLZA 3CXC2 3JUNA 4LMIA 3AHSA 2OQEA 1SIIA 2MC8A 5M18A 1HKXA 4N6NB 2HMMB 1RDSA 5RNTA 4HBRA 3MKIA 3U97A 4HZ9B 3SEDA 1OF5A 1K734 1IVWA 3X42A 4EV5A 3SXXA 4R9KA 3CCJ3 1UUGB 1NB5I 3PCRA 4L8PA 1RGFA 1LQGC 1RGHA 2GEYA 2RCDA 3LT8A 2HMOB 2XEPA 4U13A 1BSAA 1BU4A 3GAXA 3PCSA 1EKMA 1RGLA 2XSHB 2Y74A 4FMDA 1RHLA 4HM6B 5FGOA 1TUHA 3CPOA 1TU5A 3HZPA 3JUOA 1HYFA 1LRAA 3WDGB 1C54A 2GSPA 4KVHA 4KZ1A 4AKZA 1CYVA 2W2CA 3CC73 1B3SA 3KSED 3SLUA 4KFEA 3PXMA 4MMZB 1M9GA 4HOHA 4N6MA 2CWTA 3OWUA 3BB9A 3K0ZA 1RKYA 3FG1A 2ZL8A 5D81A 2OTJ3 3NQYA 1OHPA 3D5IA 3CU3A 3V98A 4J5KA 1VQL3 2Y73A 4GB5A 1O7PB 5IW9A 4XBXA 5BIRA 1BANA 2BMQB 3MYTA 3LZAA 1ROAA 2E2UA 3D9RA 1B20A 1X1UA 3IMAB 1MWTA 3B4OA 4FR9A 2OWPA 1T3BA 3E99A 4PEJA 1GOVA 5M1AA 3NX0A 3WODG 3EN1B 1O7MB 5LC6A 3D79A 3UL5A 1VQ93 3U1WA 3B8LA 4ZM8A 1JB4A 3K9MC 1V57A 1BOXA 4AEQA 1DMQA 1NO3A 1Q40A 1JRQA 1IT7A 4GSPA 4ILFA 8CHOA 7STDA 2XFTA 1B27A 1AV4A 2XGLA 3LYGA 3SOYA 3X3YA 1YIJ3 1WNHA 3WMDA 3CME3 1I8VA 3G0KA 3F8HA 1IK3A 4I5QA 1RNBA 1FUTA 2AAEA 1Y4KA 3WOFB 4EYCA 2XH9A 1I2EA 2F5WA 4WP5A 5G1KA 2FXTA 3NUVA 1UCJA 2K0MA 5HGRA 5LC7A 3LMLA 1HU9A 2P38A 4O3VA 1YVBI 1WMNA 1UI7A 4K90B 1RCKA 3UL6A 3F7SA 4XM4A 4JRFA 2KAAA 2O9UX 1WMPA 3KSPA 5AYSC 1BUQA 2CFWA 1QVG2 3FSDA 3BNBA 4XDWA 5BVBA 4O8SA 1CQSA 5IG3A 3RGAA 1GOUA 3KZTA 2IYJA 3ZG5A 3F14A 1FA3A 1RJOA 2CFLA 5AIGA 5M19A 1SARA 2P05A 1LVNA 2WOFA 2F4YA 2XGNA 1NWWA 1RGKA 1QVF2 1W2ZA 1UUWB 3RGRA 1BRIA 1A2PA 1N8R4
chains in the Genus database with same CATH topology
2B24B 1Q42A 1NU3A 3S27A 3ECFA 1IVUA 3EE1A 1Q864 5BXQA 4GL6A 2CG0A 2RSXA 4NHFA 5IERA 3Q2PA 1W5ZA 3DGMA 2WOHA 3IPTA 1OUNA 3MG2A 4HVNA 5ELUA 5AEUB 3DM8A 2WGOA 4HM4B 2A15A 1STDA 4LEHA 1PU4A 1OHSA 5AIIA 3G8ZA 3NQZA 1VQO3 3T0UA 3L0RA 4XB5A 2XRXB 1QALA 1EQKA 2STDA 1NDOB 1Z1SA 2PNCA 3JUMA 3EHCA 1TFKA 1A2VA 1JN5A 2IUKA 2E2TA 4HM8B 2Z76A 2UX0A 4WYKB 5KP4A 1VQN3 2W03A 2F86B 3AMOB 4RZMA 4KFFA 4MEIA 1VQ73 5G2GA 5JBSA 4ORLA 2PZVA 5DRVA 1OH0A 3JVCA 2ML5A 1C7HA 2CH9A 3K7CA 2OOVA 2LYXA 3CNXA 2MF7A 3K63A 1W6YA 3S5CA 4J9AA 3PS8A 1D6ZA 4CCVA 1TFOA 2GEXA 2HMKB 3DXOA 4HM2B 1W4NA 3MSOA 3CCQ3 5EEOA 4O2HA 3UNLA 2BMRB 2I9WA 2Z77A 3LTDA 3V92A 1W6CA 1ZX2A 4LZIA 2B1XB 3PGBA 3NV0B 5IG0A 4MMYB 4G1MB 2XR8B 3CD63 4JF8A 4OVMA 1IQ8A 2W6JH 3I0YA 3KIIA 4HM7B 1R4CA 5AIHA 3MHEA 3Q90A 5A0OB 1ULJB 3G6E3 1ROVA 1SJWA 4HM3B 1OGZA 1W00A 4EBGA 1AVKA 1FGRA 3X3XA 4K1UA 3S67A 1M1XB 3CCV3 3F9SA 3OW22 3DUKA 1GY5A 2P09A 1FUWA 2GU1A 4LSOA 5D83A 4J8TA 4N6TA 3HIGA 1N5PA 4R1KA 3S28A 1OF5B 2QA43 1KSIA 1W2B2 2WGQA 1JB5A 5ELJA 3ER7A 2W56A 4LGQA 3SX1A 1K41A 1YIT3 2W04A 3EB8A 2YFIB 2GBWB 2LQVA 4BTXA 1QMAA 2RFRA 2YX9A 3LOYA 4FMBA 3HIIA 5IG5A 1TIJA 1F8NA 3GZXB 3KFQC 5JPUA 3ROBA 1Q814 3SOAA 4HM0B 5DREA 1U5OA 4FCJA 1KWIA 3NBBA 3UB1A 1IVVA 1L5GB 3N9HA 1PFPA 4IIAA 1OPYA 3KE7A 1N5HA 3CCS3 1DVDA 4QWTA 4HJLB 3CCR3 3QK9A 4HZBB 1VQ43 2ZDJA 2CIUA 1Q824 1OHOA 3BNDA 4R9LA 3JUQA 2CFKA 3A76A 2K54A 3FZWA 1IQXA 1U8CB 1AR0A 1W7CA 1A90A 3CCU3 3CMA3 3B4PA 1DMMA 1WTHA 4MMXB 4WHAA 3IJEB 3EBTA 1SPUA 1W6GA 3MG1A 3LT9A 3D3LA 1FGMA 3DZLA 4BTWA 2C10A 3OX9A 4EV2A 3SVAA 4OUQA 5STDA 1WQLB 1DMNA 4EC6A 3FG4A 2CWVA 1GY6A 1N8QA 3EX9A 4RNZA 1G96A 1OCVA 1RRHA 2YFJB 1ISKA 2Z6BA 2W9PA 4N6OB 4WYKA 4H3UA 1UI8A 1GD3A 1IVXA 3FKAA 2JDIH 3GWRA 4I4KA 4XBYA 3GZYB 2BHMA 2FNQA 3AMOA 3KKGA 4K61A 1STFI 1JKGA 1ASKA 3F7XA 1IV9A 2INXA 2OTL3 4FMCA 3GZRA 3X3ZA 1K8A4 1RRLA 3NM7A 1K28A 5CXOA 1VQ53 2BT3A 1KC84 1IDPA 2IUJA 5KP1A 4FMAA 3TDGA 2YFLB 3X41A 1YJW3 1JV2B 3PZWA 3WOEB 3JUPA 3Q1CA 1WMOA 2OQEC 3CC23 4L7KA 4RNYA 1JNQA 2GXFA 3UJMA 3G713 4XBTA 3WA2X 3CC43 3HI7A 3NV0A 4HYZA 1LNHA 2CHCA 5TGNA 3T8UA 5KP3A 1YI23 1E3VA 3GZBA 3LTBA 3FG3A 3LTCA 4HKVB 4XDVA 3J7Yd 3V99A 3CCM3 3H51A 3G4S3 5AEWB 3T8NA 1VQP3 1US1A 2CC3A 4NREA 3FCSB 4FCMA 2O3OA 2HMLB 2IA7A 2KCDA 2V1LA 3OXAA 3CCL3 4AKYA 3EJVA 1JN5B 3FGYA 1GYBA 3MWZA 3LTAA 4L8OA 1J2BA 1SIHA 1QAFA 2CW9A 1RN7A 4R80A 1M1K4 3FLJA 2W0QA 3LXUX 2F99A 4CDLA 3OV4A 4O02B 2C11A 2L4VA 3X40A 3WA3A 2OCTA 3EF8A 1Q7Y4 4X2HA 3BNEA 2RGQA 2BO9B 2BMOB 2CK3H 1VQK3 3G16A 5CF1A 1KD14 3DY5A 4WWUC 3ALAA 1N9EA 3DGOA 2CG1A 1EA2A 1V74A 3N54B 5CK6A 1JB2A 3F8XA 5IF6A 3VF1A 4N6V0 2CFGA 3NBRA 3KN4A 1IT8A 1E97A 3HK4A 3CCE3 1DYUA 4OK0A 1UW1A 3NM2A 2FGTA 1TP6A 4IT7A 3FF2A 4N6UA 3EC9A 3H3HA 4X2OA 5EVHA 1O7NB 3BNCA 1QAKA 1OACA 1AVLA 4TX4A 2QEX3 3MPHA 5D82A 4BTYA 1IV7A 2KXGA 3MG3A 1VZZA 3VGNA 1A67A 2M7OA 6STDA 4RBNA 1IU7A 1S723 5CF2A 5IEOA 3QRDA 1FGOA 2P0MA 5JPPA 1T5YA 2GU3A 4WFOA 4FCZA 3RDEA 1CEWI 1YGEA 2W56B 5AIFA 1GD4A 5I97A 3OWYA 4MJDA 2ML6A 3M8CA 3VSYA 3OWSA 1S5AA 3NBJA 2Z7AA 1E3RA 3EBYA 3N8BA 3NHXA 4H61A 1FGTA 4HM5B 1OGXA 2HMNB 1K9M4 3EN8A 1Q40B 1A2KA 1IQYA 4EXRA 1EG9B 1YJ93 2IMJA 3CNMA 1MNLA 4KFDA 3DMCA 5IG4A 2E2VA 3HX8A 1LOXA 3FH1A 1VQ83 2BNGA 4IPBA 1GY7A 4N3VA 4Q53A 3I553 1FGQA 3DGNA 5CLKA 3DGLA 5IEPA 4HM1B 1KQS2 3PYJA 1ZO2A 2F98A 1W02A 1NB3I 1DVCA 3NXJA 2D42A 4K1VA 3STDA 4STDA 1D6YA 2KRTA 1ULIB 2CWUA 2SBLA 2QGUA 3GRDA 1O7HB 1UUVB 2HMJB 3LH4A 3S29A 2GBXB 1SQWA 4N6LA 1GS3A 2OOVC 3K5TA 1N9JA 3EQQB 1M904 1O7GB 1YJN3 4R4KA 5EQLA 2XSOB 2CFDA 1D6UA 3B7CA 1LXEA 1QJGA 2CKFB 2JQ5A 1W01A 1VQ63 1JKGB 2QIYA 2D1WA 5FW5A 1NJI4 3O8YA 2W9QA 3I563 1YHQ3 3F40A 1MOLA 2R4IA 5AYRB 3CPW2 2P0XA 1JJ22 1VQM3 2XFSA 3FF0A 1O7WB 5IENA 2Q07A 1CYUA 5AI1A 3BLZA 3CXC2 3JUNA 4LMIA 2OQEA 1SIIA 2MC8A 1HKXA 4N6NB 2HMMB 4HBRA 3MKIA 3U97A 4HZ9B 3SEDA 1OF5A 1K734 1IVWA 3X42A 4EV5A 3SXXA 4R9KA 3CCJ3 1NB5I 3PCRA 4L8PA 2GEYA 2RCDA 3LT8A 2HMOB 2XEPA 4U13A 3GAXA 3PCSA 4HM6B 1EKMA 2XSHB 2Y74A 4FMDA 5FGOA 1TUHA 3CPOA 1TU5A 3HZPA 3JUOA 3WDGB 4KVHA 4KZ1A 4AKZA 1CYVA 2W2CA 3CC73 3KSED 3SLUA 4KFEA 3PXMA 4MMZB 1M9GA 4N6MA 2CWTA 3OWUA 3BB9A 3K0ZA 1RKYA 3FG1A 2ZL8A 5D81A 2OTJ3 3NQYA 1OHPA 3CU3A 3V98A 1VQL3 2Y73A 4GB5A 1O7PB 5IW9A 4XBXA 2BMQB 3MYTA 3LZAA 1ROAA 2E2UA 3D9RA 3IMAB 3B4OA 4FR9A 2OWPA 3E99A 4PEJA 3NX0A 3WODG 3EN1B 1O7MB 5LC6A 3UL5A 1VQ93 3U1WA 3B8LA 4ZM8A 1JB4A 3K9MC 4AEQA 1DMQA 1NO3A 1Q40A 1JRQA 1IT7A 8CHOA 7STDA 2XFTA 1AV4A 2XGLA 3LYGA 3SOYA 3X3YA 1YIJ3 1WNHA 3WMDA 3CME3 3G0KA 3F8HA 1IK3A 1Y4KA 3WOFB 4EYCA 2XH9A 4WP5A 2FXTA 3NUVA 5HGRA 2K0MA 5LC7A 3LMLA 1HU9A 2P38A 4O3VA 1YVBI 1WMNA 1UI7A 4K90B 3UL6A 3F7SA 4XM4A 4JRFA 2O9UX 1WMPA 3KSPA 5AYSC 1BUQA 2CFWA 1QVG2 3FSDA 3BNBA 4XDWA 5BVBA 4O8SA 1CQSA 5IG3A 3RGAA 3KZTA 3F14A 1FA3A 1RJOA 2CFLA 5AIGA 2P05A 1LVNA 2WOFA 2XGNA 1NWWA 1QVF2 1W2ZA 1UUWB 3RGRA 2WO0A 2XF3A 1N8R4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ 3;  3CCV 3;  1Q7Y 4;  1YI2 3;  1K8A 4;  3CME 3;  3OW2 2;  1KQS 2;  1VQN 3;  3CCM 3;  2QEX 3;  3G4S 3;  1VQK 3;  1Q86 4;  1VQ5 3;  1VQP 3;  3CCS 3;  1VQ6 3;  1NJI 4;  1KD1 4;  1VQ7 3;  3CCR 3;  3I56 3;  1YIJ 3;  2QA4 3;  1W2B 2;  1YHQ 3;  1K9M 4;  1YJ9 3;  1KC8 4;  1YIT 3;  1VQ4 3;  3CD6 3;  3CCL 3;  3CPW 2;  1Q82 4;  1JJ2 2;  1VQM 3;  1S72 3;  1YJW 3;  3CC7 3;  1M1K 4;  1QVG 2;  3CXC 2;  1VQ9 3;  3CC2 3;  1VQ8 3;  3G71 3;  3CCE 3;  3CCU 3;  3G6E 3;  1VQO 3;  3CMA 3;  1Q81 4;  3CC4 3;  1M90 4;  2OTJ 3;  3I55 3;  1K73 4;  1YJN 3;  1QVF 2;  2OTL 3;  1VQL 3;  3CCJ 3;  1N8R 4; 
#chains in the Genus database with same CATH topology
 2B24 B;  1Q42 A;  1NU3 A;  3S27 A;  1Q7H A;  3ECF A;  7GSP A;  1IVU A;  1T2I A;  3EE1 A;  1Q86 4;  5BXQ A;  4GL6 A;  1JZD A;  2CG0 A;  2RSX A;  4NHF A;  4RNT A;  5IER A;  1PY3 A;  1BIR A;  3Q2P A;  1W5Z A;  3DGM A;  2SAR A;  2WOH A;  3HOH A;  3IPT A;  1OUN A;  3MG2 A;  4HVN A;  5ELU A;  1BRS A;  5AEU B;  3DM8 A;  2WGO A;  4HM4 B;  2A15 A;  1STD A;  3BIR A;  4LEH A;  1JZO A;  1PU4 A;  1RCL A;  1OHS A;  5AII A;  3G8Z A;  3NQZ A;  1VQO 3;  4NPB A;  3T0U A;  3L0R A;  4XB5 A;  1CH0 A;  2XRX B;  1QAL A;  1EQK A;  2STD A;  1NDO B;  1Z1S A;  2PNC A;  3DGY A;  3JUM A;  3AGO A;  1TRQ A;  3EHC A;  1TFK A;  1A2V A;  1JN5 A;  2IUK A;  2E2T A;  4HM8 B;  2Z76 A;  2UX0 A;  4WYK B;  5KP4 A;  1VQN 3;  2W03 A;  1YNV X;  1AQZ A;  2F86 B;  3BU4 A;  3AMO B;  4RZM A;  4KFF A;  4MEI A;  1VQ7 3;  1BNG A;  5G2G A;  5JBS A;  4CPK A;  4ORL A;  2PZV A;  5DRV A;  1OH0 A;  4HAA A;  4CJN A;  4BU4 A;  3JVC A;  3ZG0 A;  2ML5 A;  1C7H A;  2CH9 A;  3K7C A;  2OOV A;  2LYX A;  1GMP A;  3CNX A;  2MF7 A;  3K63 A;  1W6Y A;  3S5C A;  2CX0 A;  4J9A A;  1BRH A;  1BAO A;  3PS8 A;  1RGC A;  1D6Z A;  4CCV A;  1TFO A;  2GEX A;  2HMK B;  3DXO A;  4HM2 B;  1W4N A;  3MSO A;  3CCQ 3;  4BIR A;  5EEO A;  4O2H A;  3UNL A;  1BGS A;  2BMR B;  2I9W A;  1RNT A;  1VQQ A;  2Z77 A;  3LTD A;  3V92 A;  1W6C A;  1ZX2 A;  4LZI A;  2B1X B;  3PGB A;  1RGE A;  3NV0 B;  2H0I A;  2UUG C;  4MMY B;  4G1M B;  5IG0 A;  2XR8 B;  3CD6 3;  4JF8 A;  1RGG A;  4OVM A;  1IQ8 A;  1RTU A;  3AHW A;  2IY2 A;  2W6J H;  3I0Y A;  1MWU A;  3KII A;  4HM7 B;  1R4C A;  1R4Y A;  5AIH A;  3MHE A;  3Q90 A;  5A0O B;  1ULJ B;  3G6E 3;  1ROV A;  1SJW A;  4HM3 B;  1OGZ A;  1W00 A;  4EBG A;  1AVK A;  1FGR A;  3X3X A;  4K1U A;  3S67 A;  1M1X B;  3CCV 3;  3F9S A;  3OW2 2;  3DUK A;  1JBS A;  1GY5 A;  2P09 A;  1BNI A;  1FUW A;  2GU1 A;  4LSO A;  5D83 A;  4J8T A;  2ZA4 A;  4N6T A;  3HIG A;  1N5P A;  4R1K A;  3S28 A;  1OF5 B;  2R41 A;  1KSI A;  2QA4 3;  1JB5 A;  2WGQ A;  5ELJ A;  3ER7 A;  2W56 A;  4LGQ A;  3SX1 A;  1K41 A;  1YIT 3;  2W04 A;  1BNS A;  3EB8 A;  2GBW B;  2YFI B;  2LQV A;  4BTX A;  1QMA A;  2RFR A;  2YX9 A;  3LOY A;  4FMB A;  1V58 A;  1MGR A;  3HII A;  7RNT A;  1G0T A;  5IG5 A;  1TIJ A;  1F8N A;  3GZX B;  3KFQ C;  5BU4 A;  5JPU A;  3Q3F A;  3ROB A;  1Q81 4;  3SOA A;  4HM0 B;  1NNV A;  5DRE A;  2HOH A;  1G02 A;  1Q9E A;  1U5O A;  4FCJ A;  1KWI A;  3NBB A;  3UB1 A;  1IVV A;  1L5G B;  3RNT A;  3N9H A;  1I2F A;  1PFP A;  4IIA A;  1OPY A;  2C4B A;  1N5H A;  3KE7 A;  3URP A;  3CCS 3;  1DVD A;  4QWT A;  4HJL B;  3CCR 3;  3QK9 A;  4HZB B;  1VQ4 3;  2ZDJ A;  2CIU A;  1Q82 4;  1DET A;  1OHO A;  2H0G A;  3BND A;  4R9L A;  3JUQ A;  1BSD A;  2CFK A;  3A76 A;  2K54 A;  3FZW A;  1IQX A;  1U8C B;  1AR0 A;  1W7C A;  1A90 A;  3CCU 3;  1YGW A;  3CMA 3;  3B4P A;  3D5G A;  1DMM A;  1WTH A;  4MMX B;  4WHA A;  3IJE B;  2UGI A;  3EBT A;  1SPU A;  1LOW A;  1W6G A;  1RN4 A;  3MG1 A;  1B2X A;  3LT9 A;  3D3L A;  1FGM A;  3DZL A;  4BTW A;  1LOY A;  2C10 A;  3OX9 A;  4EV2 A;  3SVA A;  4OUQ A;  4LYL B;  5STD A;  1WQL B;  8RNT A;  1DMN A;  9RNT A;  1DE3 A;  4EC6 A;  3FG4 A;  2CWV A;  1GY6 A;  1N8Q A;  3EX9 A;  4RNZ A;  4KT3 B;  1G96 A;  1OCV A;  1RRH A;  2YFJ B;  2F5M A;  1J2B A;  1ISK A;  1RMS A;  2Z6B A;  2W9P A;  1FUS A;  4N6O B;  4WYK A;  4H3U A;  1UI8 A;  1GD3 A;  1IVX A;  3FKA A;  2JDI H;  3GWR A;  4I4K A;  4XBY A;  3GZY B;  2BHM A;  2FNQ A;  3AMO A;  3KKG A;  4K61 A;  1STF I;  1JKG A;  1ASK A;  1RGA A;  2RNT A;  3F7X A;  1IV9 A;  1I0X A;  2INX A;  1GOY A;  2OTL 3;  4FMC A;  3GZR A;  3X3Z A;  1K8A 4;  1RRL A;  3NM7 A;  1K28 A;  1BNE A;  5CXO A;  1VQ5 3;  2BT3 A;  1BNF A;  1X1Y A;  2WO0 A;  1TRP A;  2H0H A;  1I0V A;  1KC8 4;  1IDP A;  2IUJ A;  5KP1 A;  4FMA A;  3TDG A;  2YFL B;  3X41 A;  1YJW 3;  1JV2 B;  3PZW A;  1UDI I;  3WOE B;  3JUP A;  3Q1C A;  1WMO A;  2OQE C;  3CC2 3;  4L7K A;  4RNY A;  1JNQ A;  2GXF A;  3UJM A;  3G71 3;  3AGN A;  4XBT A;  1I2G A;  3WA2 X;  3CC4 3;  1LQM B;  1FYS A;  3HI7 A;  3NV0 A;  1PYL A;  1BSC A;  4HYZ A;  1LNH A;  2CHC A;  5TGN A;  3T8U A;  1BRN L;  5KP3 A;  1YI2 3;  1E3V A;  3GZB A;  3LTB A;  3FG3 A;  3LTC A;  2BU4 A;  4HKV B;  4XDV A;  5GSP A;  3V99 A;  1BSE A;  4DKI A;  3J7Y d;  3H51 A;  3G4S 3;  5AEW B;  3T8N A;  3CCM 3;  1VQP 3;  1US1 A;  4EW5 A;  1MWS A;  2CC3 A;  4NRE A;  6GSP A;  3FCS B;  4FCM A;  2L1S A;  2O3O A;  2HML B;  2IA7 A;  2KCD A;  2V1L A;  3OXA A;  3CCL 3;  3SYU A;  4AKY A;  3EJV A;  1JN5 B;  3FGY A;  1GYB A;  3MWZ A;  3LTA A;  1BUJ A;  4L8O A;  1RSN A;  1SIH A;  1QAF A;  2CW9 A;  1RN7 A;  3A5E A;  1X1W A;  4R80 A;  3FLJ A;  1M1K 4;  1UGI A;  2W0Q A;  2F99 A;  3LXU X;  4CDL A;  3OV4 A;  4O02 B;  2C11 A;  1HZ1 A;  2L4V A;  2J8X B;  3X40 A;  3WA3 A;  2OCT A;  3EF8 A;  4GHO A;  1TJD A;  1EUI C;  1BVI A;  2BIR A;  1Q7Y 4;  4X2H A;  3BNE A;  2RGQ A;  2BO9 B;  2BMO B;  2CK3 H;  1VQK 3;  3G16 A;  5CF1 A;  3DH2 A;  3ZFZ A;  1KD1 4;  3DY5 A;  4WWU C;  3ALA A;  1N9E A;  3DGO A;  2CG1 A;  1EA2 A;  1IYY A;  1UCK A;  1V74 A;  3N54 B;  1EEJ A;  5CK6 A;  1JB2 A;  3F8X A;  5IF6 A;  3VF1 A;  4N6V 0;  2CFG A;  3NBR A;  1UCI A;  3KN4 A;  4BL2 A;  1IT8 A;  1E97 A;  3HK4 A;  3CCE 3;  1DYU A;  4OK0 A;  1UW1 A;  3NM2 A;  2FGT A;  1TP6 A;  1BRG A;  4IT7 A;  3FF2 A;  6RNT A;  4N6U A;  1BRK A;  3EC9 A;  3H3H A;  4X2O A;  5EVH A;  1AY7 A;  1O7N B;  3BNC A;  1I3I A;  1QAK A;  1OAC A;  1AVL A;  4TX4 A;  2QEX 3;  3MPH A;  5D82 A;  4BTY A;  1TTO A;  1IV7 A;  2KXG A;  1LNI A;  1LOV A;  1T2H A;  1VZZ A;  3MG3 A;  2M7O A;  3VGN A;  6STD A;  1A67 A;  4RBN A;  1IU7 A;  4BL3 A;  1S72 3;  5CF2 A;  1JBR A;  3GSP A;  1UCL A;  5IEO A;  1RLS A;  1FGO A;  3QRD A;  2ZHX B;  2P0M A;  5JPP A;  1T5Y A;  2GU3 A;  4WFO A;  4FCZ A;  3RDE A;  1CEW I;  1YGE A;  2W56 B;  5AIF A;  1GD4 A;  1B2S A;  5I97 A;  1B21 A;  3OWY A;  4MJD A;  2ML6 A;  3M8C A;  3VSY A;  3OWS A;  1JBT A;  1S5A A;  3NBJ A;  2Z7A A;  1YVS A;  1E3R A;  3EBY A;  3N8B A;  1B2Z A;  1B2U A;  3NHX A;  3WHO A;  4H61 A;  1FGT A;  4HM5 B;  1OGX A;  2HMN B;  1X1X A;  1GMR A;  1K9M 4;  3EN8 A;  1I70 A;  1Q40 B;  1A2K A;  1IQY A;  4EXR A;  1EG9 B;  1RN1 A;  1YJ9 3;  2IMJ A;  3CNM A;  1MNL A;  4KFD A;  3KCH A;  3DMC A;  5IG4 A;  2F56 A;  1FZU A;  2E2V A;  3HX8 A;  1LOX A;  2CX1 A;  3FH1 A;  1VQ8 3;  4J5G A;  2BNG A;  4IPB A;  1GY7 A;  1I3F A;  1B2M A;  4N3V A;  5G1L A;  4Q53 A;  3I55 3;  2KF6 A;  1FGQ A;  2KF3 A;  1GMQ A;  3DGN A;  5HOH A;  5CLK A;  3DGL A;  5IEP A;  4HM1 B;  1BSB A;  1KQS 2;  1ZS7 A;  1ZO2 A;  2F98 A;  3PYJ A;  1W02 A;  1FW7 A;  3WR2 A;  1NB3 I;  1DVC A;  1BNR A;  2XF3 A;  3NXJ A;  2D42 A;  4K1V A;  3STD A;  4STD A;  1D6Y A;  2KRT A;  1ULI B;  2CWU A;  2SBL A;  1GSP A;  2QGU A;  2RBI A;  3D4A A;  3GRD A;  1O7H B;  1UUV B;  2KF5 A;  2HMJ B;  3LH4 A;  3S29 A;  2GBX B;  2KF4 A;  1SQW A;  4N6L A;  1GS3 A;  2K3D A;  1BRJ A;  2OOV C;  3K5T A;  1N9J A;  3EQQ B;  1M90 4;  2AAD A;  1O7G B;  1YJN 3;  1BNJ A;  4R4K A;  5EQL A;  1MGW A;  2CFD A;  1D6U A;  2XSO B;  3B7C A;  1W2B 2;  1LXE A;  1QJG A;  2CKF B;  2JQ5 A;  1W01 A;  1VQ6 3;  1JKG B;  2QIY A;  2D1W A;  5FW5 A;  1NJI 4;  3O8Y A;  2W9Q A;  3I56 3;  1YHQ 3;  3F40 A;  1MOL A;  2R4I A;  5AYR B;  3CPW 2;  2P0X A;  1JJ2 2;  1VQM 3;  2XFS A;  3FF0 A;  1O7W B;  5IEN A;  2Q07 A;  1CYU A;  1MWR A;  1UGH I;  1ZGX A;  5AI1 A;  3BLZ A;  3CXC 2;  3JUN A;  4LMI A;  3AHS A;  2OQE A;  1SII A;  2MC8 A;  5M18 A;  1HKX A;  4N6N B;  2HMM B;  1RDS A;  5RNT A;  4HBR A;  3MKI A;  3U97 A;  4HZ9 B;  3SED A;  1OF5 A;  1K73 4;  1IVW A;  3X42 A;  4EV5 A;  3SXX A;  4R9K A;  3CCJ 3;  1UUG B;  1NB5 I;  3PCR A;  4L8P A;  1RGF A;  1LQG C;  1RGH A;  2GEY A;  2RCD A;  3LT8 A;  2HMO B;  2XEP A;  4U13 A;  1BSA A;  1BU4 A;  3GAX A;  3PCS A;  1EKM A;  1RGL A;  2XSH B;  2Y74 A;  4FMD A;  1RHL A;  4HM6 B;  5FGO A;  1TUH A;  3CPO A;  1TU5 A;  3HZP A;  3JUO A;  1HYF A;  1LRA A;  3WDG B;  1C54 A;  2GSP A;  4KVH A;  4KZ1 A;  4AKZ A;  1CYV A;  2W2C A;  3CC7 3;  1B3S A;  3KSE D;  3SLU A;  4KFE A;  3PXM A;  4MMZ B;  1M9G A;  4HOH A;  4N6M A;  2CWT A;  3OWU A;  3BB9 A;  3K0Z A;  1RKY A;  3FG1 A;  2ZL8 A;  5D81 A;  2OTJ 3;  3NQY A;  1OHP A;  3D5I A;  3CU3 A;  3V98 A;  4J5K A;  1VQL 3;  2Y73 A;  4GB5 A;  1O7P B;  5IW9 A;  4XBX A;  5BIR A;  1BAN A;  2BMQ B;  3MYT A;  3LZA A;  1ROA A;  2E2U A;  3D9R A;  1B20 A;  1X1U A;  3IMA B;  1MWT A;  3B4O A;  4FR9 A;  2OWP A;  1T3B A;  3E99 A;  4PEJ A;  1GOV A;  5M1A A;  3NX0 A;  3WOD G;  3EN1 B;  1O7M B;  5LC6 A;  3D79 A;  3UL5 A;  1VQ9 3;  3U1W A;  3B8L A;  4ZM8 A;  1JB4 A;  3K9M C;  1V57 A;  1BOX A;  4AEQ A;  1DMQ A;  1NO3 A;  1Q40 A;  1JRQ A;  1IT7 A;  4GSP A;  4ILF A;  8CHO A;  7STD A;  2XFT A;  1B27 A;  1AV4 A;  2XGL A;  3LYG A;  3SOY A;  3X3Y A;  1YIJ 3;  1WNH A;  3WMD A;  3CME 3;  1I8V A;  3G0K A;  3F8H A;  1IK3 A;  4I5Q A;  1RNB A;  1FUT A;  2AAE A;  1Y4K A;  3WOF B;  4EYC A;  2XH9 A;  1I2E A;  2F5W A;  4WP5 A;  5G1K A;  2FXT A;  3NUV A;  1UCJ A;  2K0M A;  5HGR A;  5LC7 A;  3LML A;  1HU9 A;  2P38 A;  4O3V A;  1YVB I;  1WMN A;  1UI7 A;  4K90 B;  1RCK A;  3UL6 A;  3F7S A;  4XM4 A;  4JRF A;  2KAA A;  2O9U X;  1WMP A;  3KSP A;  5AYS C;  1BUQ A;  2CFW A;  1QVG 2;  3FSD A;  3BNB A;  4XDW A;  5BVB A;  4O8S A;  1CQS A;  5IG3 A;  3RGA A;  1GOU A;  3KZT A;  2IYJ A;  3ZG5 A;  3F14 A;  1FA3 A;  1RJO A;  2CFL A;  5AIG A;  5M19 A;  1SAR A;  2P05 A;  1LVN A;  2WOF A;  2F4Y A;  2XGN A;  1NWW A;  1RGK A;  1QVF 2;  1W2Z A;  1UUW B;  3RGR A;  1BRI A;  1A2P A;  1N8R 4; 
#chains in the Genus database with same CATH homology
 2B24 B;  1Q42 A;  1NU3 A;  3S27 A;  3ECF A;  1IVU A;  3EE1 A;  1Q86 4;  5BXQ A;  4GL6 A;  2CG0 A;  2RSX A;  4NHF A;  5IER A;  3Q2P A;  1W5Z A;  3DGM A;  2WOH A;  3IPT A;  1OUN A;  3MG2 A;  4HVN A;  5ELU A;  5AEU B;  3DM8 A;  2WGO A;  4HM4 B;  2A15 A;  1STD A;  4LEH A;  1PU4 A;  1OHS A;  5AII A;  3G8Z A;  3NQZ A;  1VQO 3;  3T0U A;  3L0R A;  4XB5 A;  2XRX B;  1QAL A;  1EQK A;  2STD A;  1NDO B;  1Z1S A;  2PNC A;  3JUM A;  3EHC A;  1TFK A;  1A2V A;  1JN5 A;  2IUK A;  2E2T A;  4HM8 B;  2Z76 A;  2UX0 A;  4WYK B;  5KP4 A;  1VQN 3;  2W03 A;  2F86 B;  3AMO B;  4RZM A;  4KFF A;  4MEI A;  1VQ7 3;  5G2G A;  5JBS A;  4ORL A;  2PZV A;  5DRV A;  1OH0 A;  3JVC A;  2ML5 A;  1C7H A;  2CH9 A;  3K7C A;  2OOV A;  2LYX A;  3CNX A;  2MF7 A;  3K63 A;  1W6Y A;  3S5C A;  4J9A A;  3PS8 A;  1D6Z A;  4CCV A;  1TFO A;  2GEX A;  2HMK B;  3DXO A;  4HM2 B;  1W4N A;  3MSO A;  3CCQ 3;  5EEO A;  4O2H A;  3UNL A;  2BMR B;  2I9W A;  2Z77 A;  3LTD A;  3V92 A;  1W6C A;  1ZX2 A;  4LZI A;  2B1X B;  3PGB A;  3NV0 B;  5IG0 A;  4MMY B;  4G1M B;  2XR8 B;  3CD6 3;  4JF8 A;  4OVM A;  1IQ8 A;  2W6J H;  3I0Y A;  3KII A;  4HM7 B;  1R4C A;  5AIH A;  3MHE A;  3Q90 A;  5A0O B;  1ULJ B;  3G6E 3;  1ROV A;  1SJW A;  4HM3 B;  1OGZ A;  1W00 A;  4EBG A;  1AVK A;  1FGR A;  3X3X A;  4K1U A;  3S67 A;  1M1X B;  3CCV 3;  3F9S A;  3OW2 2;  3DUK A;  1GY5 A;  2P09 A;  1FUW A;  2GU1 A;  4LSO A;  5D83 A;  4J8T A;  4N6T A;  3HIG A;  1N5P A;  4R1K A;  3S28 A;  1OF5 B;  2QA4 3;  1KSI A;  1W2B 2;  2WGQ A;  1JB5 A;  5ELJ A;  3ER7 A;  2W56 A;  4LGQ A;  3SX1 A;  1K41 A;  1YIT 3;  2W04 A;  3EB8 A;  2YFI B;  2GBW B;  2LQV A;  4BTX A;  1QMA A;  2RFR A;  2YX9 A;  3LOY A;  4FMB A;  3HII A;  5IG5 A;  1TIJ A;  1F8N A;  3GZX B;  3KFQ C;  5JPU A;  3ROB A;  1Q81 4;  3SOA A;  4HM0 B;  5DRE A;  1U5O A;  4FCJ A;  1KWI A;  3NBB A;  3UB1 A;  1IVV A;  1L5G B;  3N9H A;  1PFP A;  4IIA A;  1OPY A;  3KE7 A;  1N5H A;  3CCS 3;  1DVD A;  4QWT A;  4HJL B;  3CCR 3;  3QK9 A;  4HZB B;  1VQ4 3;  2ZDJ A;  2CIU A;  1Q82 4;  1OHO A;  3BND A;  4R9L A;  3JUQ A;  2CFK A;  3A76 A;  2K54 A;  3FZW A;  1IQX A;  1U8C B;  1AR0 A;  1W7C A;  1A90 A;  3CCU 3;  3CMA 3;  3B4P A;  1DMM A;  1WTH A;  4MMX B;  4WHA A;  3IJE B;  3EBT A;  1SPU A;  1W6G A;  3MG1 A;  3LT9 A;  3D3L A;  1FGM A;  3DZL A;  4BTW A;  2C10 A;  3OX9 A;  4EV2 A;  3SVA A;  4OUQ A;  5STD A;  1WQL B;  1DMN A;  4EC6 A;  3FG4 A;  2CWV A;  1GY6 A;  1N8Q A;  3EX9 A;  4RNZ A;  1G96 A;  1OCV A;  1RRH A;  2YFJ B;  1ISK A;  2Z6B A;  2W9P A;  4N6O B;  4WYK A;  4H3U A;  1UI8 A;  1GD3 A;  1IVX A;  3FKA A;  2JDI H;  3GWR A;  4I4K A;  4XBY A;  3GZY B;  2BHM A;  2FNQ A;  3AMO A;  3KKG A;  4K61 A;  1STF I;  1JKG A;  1ASK A;  3F7X A;  1IV9 A;  2INX A;  2OTL 3;  4FMC A;  3GZR A;  3X3Z A;  1K8A 4;  1RRL A;  3NM7 A;  1K28 A;  5CXO A;  1VQ5 3;  2BT3 A;  1KC8 4;  1IDP A;  2IUJ A;  5KP1 A;  4FMA A;  3TDG A;  2YFL B;  3X41 A;  1YJW 3;  1JV2 B;  3PZW A;  3WOE B;  3JUP A;  3Q1C A;  1WMO A;  2OQE C;  3CC2 3;  4L7K A;  4RNY A;  1JNQ A;  2GXF A;  3UJM A;  3G71 3;  4XBT A;  3WA2 X;  3CC4 3;  3HI7 A;  3NV0 A;  4HYZ A;  1LNH A;  2CHC A;  5TGN A;  3T8U A;  5KP3 A;  1YI2 3;  1E3V A;  3GZB A;  3LTB A;  3FG3 A;  3LTC A;  4HKV B;  4XDV A;  3J7Y d;  3V99 A;  3CCM 3;  3H51 A;  3G4S 3;  5AEW B;  3T8N A;  1VQP 3;  1US1 A;  2CC3 A;  4NRE A;  3FCS B;  4FCM A;  2O3O A;  2HML B;  2IA7 A;  2KCD A;  2V1L A;  3OXA A;  3CCL 3;  4AKY A;  3EJV A;  1JN5 B;  3FGY A;  1GYB A;  3MWZ A;  3LTA A;  4L8O A;  1J2B A;  1SIH A;  1QAF A;  2CW9 A;  1RN7 A;  4R80 A;  1M1K 4;  3FLJ A;  2W0Q A;  3LXU X;  2F99 A;  4CDL A;  3OV4 A;  4O02 B;  2C11 A;  2L4V A;  3X40 A;  3WA3 A;  2OCT A;  3EF8 A;  1Q7Y 4;  4X2H A;  3BNE A;  2RGQ A;  2BO9 B;  2BMO B;  2CK3 H;  1VQK 3;  3G16 A;  5CF1 A;  1KD1 4;  3DY5 A;  4WWU C;  3ALA A;  1N9E A;  3DGO A;  2CG1 A;  1EA2 A;  1V74 A;  3N54 B;  5CK6 A;  1JB2 A;  3F8X A;  5IF6 A;  3VF1 A;  4N6V 0;  2CFG A;  3NBR A;  3KN4 A;  1IT8 A;  1E97 A;  3HK4 A;  3CCE 3;  1DYU A;  4OK0 A;  1UW1 A;  3NM2 A;  2FGT A;  1TP6 A;  4IT7 A;  3FF2 A;  4N6U A;  3EC9 A;  3H3H A;  4X2O A;  5EVH A;  1O7N B;  3BNC A;  1QAK A;  1OAC A;  1AVL A;  4TX4 A;  2QEX 3;  3MPH A;  5D82 A;  4BTY A;  1IV7 A;  2KXG A;  3MG3 A;  1VZZ A;  3VGN A;  1A67 A;  2M7O A;  6STD A;  4RBN A;  1IU7 A;  1S72 3;  5CF2 A;  5IEO A;  3QRD A;  1FGO A;  2P0M A;  5JPP A;  1T5Y A;  2GU3 A;  4WFO A;  4FCZ A;  3RDE A;  1CEW I;  1YGE A;  2W56 B;  5AIF A;  1GD4 A;  5I97 A;  3OWY A;  4MJD A;  2ML6 A;  3M8C A;  3VSY A;  3OWS A;  1S5A A;  3NBJ A;  2Z7A A;  1E3R A;  3EBY A;  3N8B A;  3NHX A;  4H61 A;  1FGT A;  4HM5 B;  1OGX A;  2HMN B;  1K9M 4;  3EN8 A;  1Q40 B;  1A2K A;  1IQY A;  4EXR A;  1EG9 B;  1YJ9 3;  2IMJ A;  3CNM A;  1MNL A;  4KFD A;  3DMC A;  5IG4 A;  2E2V A;  3HX8 A;  1LOX A;  3FH1 A;  1VQ8 3;  2BNG A;  4IPB A;  1GY7 A;  4N3V A;  4Q53 A;  3I55 3;  1FGQ A;  3DGN A;  5CLK A;  3DGL A;  5IEP A;  4HM1 B;  1KQS 2;  3PYJ A;  1ZO2 A;  2F98 A;  1W02 A;  1NB3 I;  1DVC A;  3NXJ A;  2D42 A;  4K1V A;  3STD A;  4STD A;  1D6Y A;  2KRT A;  1ULI B;  2CWU A;  2SBL A;  2QGU A;  3GRD A;  1O7H B;  1UUV B;  2HMJ B;  3LH4 A;  3S29 A;  2GBX B;  1SQW A;  4N6L A;  1GS3 A;  2OOV C;  3K5T A;  1N9J A;  3EQQ B;  1M90 4;  1O7G B;  1YJN 3;  4R4K A;  5EQL A;  2XSO B;  2CFD A;  1D6U A;  3B7C A;  1LXE A;  1QJG A;  2CKF B;  2JQ5 A;  1W01 A;  1VQ6 3;  1JKG B;  2QIY A;  2D1W A;  5FW5 A;  1NJI 4;  3O8Y A;  2W9Q A;  3I56 3;  1YHQ 3;  3F40 A;  1MOL A;  2R4I A;  5AYR B;  3CPW 2;  2P0X A;  1JJ2 2;  1VQM 3;  2XFS A;  3FF0 A;  1O7W B;  5IEN A;  2Q07 A;  1CYU A;  5AI1 A;  3BLZ A;  3CXC 2;  3JUN A;  4LMI A;  2OQE A;  1SII A;  2MC8 A;  1HKX A;  4N6N B;  2HMM B;  4HBR A;  3MKI A;  3U97 A;  4HZ9 B;  3SED A;  1OF5 A;  1K73 4;  1IVW A;  3X42 A;  4EV5 A;  3SXX A;  4R9K A;  3CCJ 3;  1NB5 I;  3PCR A;  4L8P A;  2GEY A;  2RCD A;  3LT8 A;  2HMO B;  2XEP A;  4U13 A;  3GAX A;  3PCS A;  4HM6 B;  1EKM A;  2XSH B;  2Y74 A;  4FMD A;  5FGO A;  1TUH A;  3CPO A;  1TU5 A;  3HZP A;  3JUO A;  3WDG B;  4KVH A;  4KZ1 A;  4AKZ A;  1CYV A;  2W2C A;  3CC7 3;  3KSE D;  3SLU A;  4KFE A;  3PXM A;  4MMZ B;  1M9G A;  4N6M A;  2CWT A;  3OWU A;  3BB9 A;  3K0Z A;  1RKY A;  3FG1 A;  2ZL8 A;  5D81 A;  2OTJ 3;  3NQY A;  1OHP A;  3CU3 A;  3V98 A;  1VQL 3;  2Y73 A;  4GB5 A;  1O7P B;  5IW9 A;  4XBX A;  2BMQ B;  3MYT A;  3LZA A;  1ROA A;  2E2U A;  3D9R A;  3IMA B;  3B4O A;  4FR9 A;  2OWP A;  3E99 A;  4PEJ A;  3NX0 A;  3WOD G;  3EN1 B;  1O7M B;  5LC6 A;  3UL5 A;  1VQ9 3;  3U1W A;  3B8L A;  4ZM8 A;  1JB4 A;  3K9M C;  4AEQ A;  1DMQ A;  1NO3 A;  1Q40 A;  1JRQ A;  1IT7 A;  8CHO A;  7STD A;  2XFT A;  1AV4 A;  2XGL A;  3LYG A;  3SOY A;  3X3Y A;  1YIJ 3;  1WNH A;  3WMD A;  3CME 3;  3G0K A;  3F8H A;  1IK3 A;  1Y4K A;  3WOF B;  4EYC A;  2XH9 A;  4WP5 A;  2FXT A;  3NUV A;  5HGR A;  2K0M A;  5LC7 A;  3LML A;  1HU9 A;  2P38 A;  4O3V A;  1YVB I;  1WMN A;  1UI7 A;  4K90 B;  3UL6 A;  3F7S A;  4XM4 A;  4JRF A;  2O9U X;  1WMP A;  3KSP A;  5AYS C;  1BUQ A;  2CFW A;  1QVG 2;  3FSD A;  3BNB A;  4XDW A;  5BVB A;  4O8S A;  1CQS A;  5IG3 A;  3RGA A;  3KZT A;  3F14 A;  1FA3 A;  1RJO A;  2CFL A;  5AIG A;  2P05 A;  1LVN A;  2WOF A;  2XGN A;  1NWW A;  1QVF 2;  1W2Z A;  1UUW B;  3RGR A;  2WO0 A;  2XF3 A;  1N8R 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...