1K734

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k73400
3I553 3CCM3 1QVG2 1YHQ3 1K734 1K9M4 1VQ53 1VQP3 2OTJ3 3CPW2 1JJ22 2OTL3 1VQ93 1QVF2 1YJN3 3CC43 1VQ63 3G713 1KQS2 3CCV3 3I563 1YJ93 1Q814 3CCL3 1W2B2 1VQ73 3CMA3 3CD63 3CCJ3 1VQ83 1VQK3 1YJW3 3OW22 1KC84 1M904 1S723 1Q864 3CC23 3CME3 1YIJ3 3CCE3 3CCU3 1KD14 1Q7Y4 1NJI4 1VQL3 3CXC2 1K8A4 1VQN3 3CCQ3 3G4S3 2QA43 1N8R4 3G6E3 1VQ43 1VQO3 1M1K4 3CC73 1YIT3 3CCS3 1YI23 1VQM3 1Q824 2QEX3 3CCR3
chains in the Genus database with same CATH superfamily
1ULJB 4N6NB 2P09A 5GSPA 1GY7A 3KSPA 1BNIA 2JDIH 4O8SA 4AKYA 1QVF2 2YFLB 1WMNA 1DVDA 3NM2A 5G1LA 4N3VA 1OGZA 3NM7A 3UL5A 5BVBA 1GYBA 2Q07A 1OHPA 2O9UX 5D82A 2CFDA 2XRXB 1M1XB 5KP1A 2QIYA 2GSPA 1G96A 1EA2A 4STDA 3X40A 1QJGA 1US1A 1RGEA 4KVHA 2MF7A 2STDA 4EV5A 1OACA 3WDGB 4AEQA 2XGLA 4IPBA 4HOHA 1N9EA 1RN1A 2PZVA 2SARA 4J5KA 1V58A 1FUWA 2ZHXB 3UJMA 3CME3 1IQYA 1BNFA 1YHQ3 2W56B 2C4BA 3FF0A 2PNCA 1S5AA 4LGQA 1BNEA 4HM7B 2IYJA 3I0YA 1RDSA 1BRKA 4KFFA 2V1LA 5IG4A 2XSHB 3OXAA 2W6JH 1JB4A 4N6TA 4HM6B 5CF2A 1NB5I 1TFOA 1NDOB 1W02A 4Q53A 4RBNA 7STDA 5BU4A 4NPBA 2IUKA 3DGOA 4QWTA 1LOVA 1OH0A 4O02B 1JBRA 2QA43 2A15A 3NBJA 4OUQA 2W2CA 1YIT3 2K54A 1RSNA 2W03A 1FA3A 1AR0A 3CNMA 1VQQA 1W6YA 1IVUA 1JZOA 3PGBA 4RNZA 3PZWA 4EC6A 1JN5B 5EEOA 1WNHA 3CC43 1BNRA 1O7NB 5G2GA 2Z77A 3K63A 3NHXA 2W56A 2XEPA 5LC6A 1M904 1OHSA 1OUNA 2GBWB 3DH2A 1ZO2A 1PU4A 1K28A 2B24B 3BNCA 4MMYB 5D83A 4BL3A 2MC8A 3CCU3 3GZBA 1LQMB 4HZ9B 5STDA 1PYLA 4HJLB 3DGMA 3NXJA 2YFJB 1YGEA 3OWYA 3FKAA 2BHMA 2GEYA 2INXA 1D6ZA 2IY2A 5FGOA 1RJOA 1UUGB 1SIIA 2OWPA 5AEUB 1BNSA 1UUWB 1BUQA 1SPUA 3DM8A 1EQKA 1YVBI 5G1KA 2P0XA 3WMDA 4WYKB 3NQYA 1F8NA 3FG3A 1RGCA 4X2OA 3IMAB 2KF6A 2BT3A 2R4IA 1WTHA 3K7CA 1IK3A 1B2MA 1FGOA 1AQZA 1BRGA 2BMOB 1JN5A 1UI8A 2C10A 3MHEA 2P38A 2BNGA 3B4OA 3D5IA 3KN4A 4U13A 1RHLA 3FG1A 3OW22 1JB5A 3TDGA 1A67A 3FH1A 3OWUA 1KD14 1R4YA 1ZX2A 2WOFA 1BU4A 2HMJB 2LYXA 1MNLA 1M1K4 3WOEB 1C7HA 2CKFB 1TUHA 3JUPA 4HYZA 1AY7A 4JF8A 1OPYA 4IIAA 5IW9A 4LYLB 3AHWA 1DE3A 4HKVB 3SOYA 2XR8B 3BNEA 2F56A 2HMLB 2ML5A 2OQEC 5IEOA 1PY3A 3ALAA 3A5EA 2CW9A 4EW5A 4WYKA 2XSOB 3SOAA 3CD63 1O7WB 1OGXA 3JUOA 1X1XA 1GMRA 4FMCA 3K0ZA 1BOXA 2O3OA 5A0OB 3K5TA 4EXRA 2FXTA 2UGIA 1GOVA 4FCZA 3DXOA 5ELUA 1JNQA 3ROBA 1IYYA 3HIGA 1UCLA 4K1UA 2LQVA 1AVKA 3G4S3 1N8R4 4K61A 1QAFA 6GSPA 2CFWA 4EV2A 3G6E3 1TFKA 1RMSA 1T5YA 5AIFA 1ZS7A 3NV0B 2RGQA 3EE1A 1TTOA 2B1XB 4O2HA 4EBGA 1JKGB 2ZDJA 1STDA 9RNTA 3WA3A 1K9M4 1O7PB 2BMRB 3NUVA 3CPW2 5M1AA 3KCHA 3U1WA 1BSDA 1KSIA 2FGTA 1M9GA 5EQLA 3X3YA 2H0HA 3HK4A 1B2SA 4HM8B 4LSOA 1I2GA 1Q814 1IT7A 4BTWA 1LNIA 1Y4KA 4I4KA 4WHAA 2BU4A 3OWSA 1RNTA 4R80A 1ROVA 1YIJ3 1G0TA 1MGWA 3B4PA 3JUMA 4HVNA 3AGNA 1JB2A 3LH4A 1BRHA 1I8VA 1NJI4 2IMJA 1LOYA 4BU4A 2GBXB 2CFGA 3X3ZA 3G8ZA 1Q9EA 5CF1A 2RBIA 2XFSA 7RNTA 2UX0A 1GD4A 2KF4A 3JUNA 2CWTA 3VF1A 1TIJA 3AMOB 5FW5A 1Q7Y4 1DETA 3A76A 2OTJ3 5JPPA 3STDA 1AV4A 1NU3A 3D5GA 3NV0A 1MGRA 3Q2PA 5AIHA 5HGRA 1I2EA 1V57A 1VQ93 1BRJA 1RGHA 3K9MC 1O7GB 3CCL3 1STFI 1UI7A 1VQ73 3SVAA 1I3FA 1KC84 1BSCA 2H0IA 4HM1B 5DREA 3HX8A 3T8NA 3EC9A 3CCE3 5JPUA 5M19A 3F8XA 2F5MA 4BL2A 1B2UA 4R4KA 4RNTA 1QAKA 3T0UA 4ORLA 4BTXA 1V74A 2HOHA 3MSOA 1D6UA 1RCLA 2CFLA 2F98A 4EYCA 1E97A 1EUIC 1PFPA 3V98A 3BB9A 1RKYA 1A2KA 5CXOA 3KIIA 3PCSA 2QEX3 2F5WA 3PCRA 2HMNB 1OCVA 2K0MA 3U97A 1VQ53 5RNTA 1Q42A 4MMZB 1FGTA 2HMMB 3DGYA 1L5GB 2RFRA 1CH0A 2RSXA 2FNQA 3X3XA 7GSPA 3Q3FA 1K41A 1MWUA 1RRLA 2P05A 3DGLA 4TX4A 3LXUX 4NREA 4MEIA 5AI1A 2CWUA 1MOLA 4XM4A 1WQLB 2KXGA 2WOHA 3GSPA 3EBTA 1FGMA 2H0GA 4RNYA 2E2VA 3J7Yd 3H3HA 4GL6A 3MG2A 8CHOA 4O3VA 3LMLA 3AGOA 2CC3A 4OVMA 5LC7A 3S27A 3WHOA 1JRQA 4BIRA 1YNVX 2GEXA 4L8PA 2IUJA 3RNTA 3DY5A 1BSBA 5KP4A 1UCJA 2E2TA 1VZZA 1QALA 1QMAA 3DUKA 3WODG 1K734 4I5QA 2OOVA 1N9JA 1DVCA 3L0RA 3ZG0A 2XF3A 1SARA 1FGRA 1AVLA 1KWIA 1RRHA 1Z1SA 4HM3B 3KZTA 3EB8A 1B2XA 2M7OA 1YJW3 2AADA 3BU4A 4HM5B 2BO9B 2OQEA 3E99A 4LMIA 3S67A 1W01A 4CCVA 2QGUA 3GAXA 1B2ZA 1VQL3 6RNTA 3MG3A 2Z7AA 3N9HA 1N5HA 4FCJA 1HYFA 3SEDA 3T8UA 3CCQ3 4HAAA 1W00A 1W6CA 2OOVC 5EVHA 4OK0A 5HOHA 1GMPA 3CPOA 1TRPA 3GZRA 1K8A4 3PS8A 1VQ63 1W6GA 3BNDA 3X42A 3ER7A 1D6YA 3GRDA 4CJNA 4N6V0 1JBSA 4BTYA 5BXQA 1RGGA 1BSAA 1RCKA 1DMQA 1RGAA 2GXFA 5CLKA 5IERA 3Q1CA 1LOXA 6STDA 2CHCA 1Q40B 5AIIA 2HMOB 5AYSC 1BVIA 4LEHA 3F7XA 1TJDA 1UUVB 2HMKB 3FG4A 1EEJA 3SYUA 4DKIA 2L1SA 5IG3A 3EN1B 2R41A 1LNHA 3KSED 3X41A 1ZGXA 5D81A 1IU7A 3WR2A 3SX1A 5JBSA 1EG9B 1IQXA 1UDII 2CX1A 2F99A 2WO0A 1EKMA 3CCS3 3V99A 4XBTA 3CCR3 3G16A 3NBRA 2CX0A 1JJ22 5ELJA 3MWZA 8RNTA 2F86B 4PEJA 3KE7A 3FZWA 3HIIA 4N6UA 1O7HB 3CCV3 3I563 1CYUA 2CG0A 1G02A 2SBLA 3FCSB 1W2B2 4FMAA 4ILFA 3CCJ3 1NWWA 4CDLA 3F8HA 1Q40A 1R4CA 1E3VA 3DGNA 4G1MB 1SQWA 1GOYA 1IVXA 1Q7HA 2W9QA 1RGLA 3FLJA 4R9LA 4RZMA 1LOWA 4HM2B 3F14A 1JV2B 2RCDA 3B7CA 1RLSA 1YVSA 4K90B 4LZIA 4NHFA 1RNBA 4H61A 1BNGA 1IV7A 1W2ZA 3Q90A 1BSEA 1X1YA 3F40A 4FCMA 4XBXA 1MWTA 2IA7A 3I553 4HBRA 4WWUC 3S5CA 3CCM3 3WOFB 1SIHA 1U8CB 3BIRA 1YJN3 2GU1A 1BGSA 1GY5A 1I0XA 1LXEA 3G713 1MWRA 1JKGA 5TGNA 3BLZA 3GWRA 1NNVA 1UCIA 3QK9A 3LT9A 3EBYA 1GS3A 1BAOA 3S28A 1B27A 4X2HA 1BRSA 2BIRA 2E2UA 1X1UA 1N5PA 3MKIA 2I9WA 1DMMA 3GZYB 1CYVA 3HOHA 1JBTA 1WMOA 3D79A 3S29A 4N6LA 4N6MA 2CIUA 4XB5A 3UL6A 5M18A 3IJEB 3OV4A 1VQM3 5IEPA 3QRDA 1GOUA 1IV9A 2WGOA 2W04A 3SXXA 1B20A 1BIRA 2P0MA 4XDVA 5IF6A 2Y74A 1W7CA 4KFDA 1ISKA 2D42A 2CWVA 3F7SA 1UGIA 3SLUA 1FYSA 3O8YA 4MJDA 1KQS2 1RN7A 4CPKA 3AMOA 2YX9A 1MWSA 3G0KA 1TU5A 3KFQC 1X1WA 3RGAA 4H3UA 1B21A 2KF5A 4FMBA 1VQK3 1RGFA 3H51A 4N6OB 1BRNL 1UW1A 4J9AA 3UB1A 3KKGA 2F4YA 3M8CA 3BNBA 3PYJA 3EJVA 1I3IA 1RN4A 2CFKA 1VQN3 2CG1A 2K3DA 2XGNA 2W0QA 3GZXB 1I0VA 1GSPA 1VQO3 1IVVA 1FUTA 3PXMA 3CC73 1FGQA 3FF2A 3HZPA 3HI7A 3LT8A 3OX9A 3MG1A 3ZFZA 1GD3A 1SJWA 1LQGC 3UNLA 1GMQA 1T2IA 1RGKA 1A90A 1J2BA 4HM4B 4FMDA 3VSYA 1FUSA 4KT3B 4L8OA 1ROAA 2BMQB 2Z6BA 3LTCA 3V92A 1S723 2OCTA 3B8LA 2WGQA 1TP6A 3NX0A 5AIGA 2YFIB 1E3RA 2ML6A 1RTUA 4WFOA 4GHOA 5BIRA 4IT7A 4GSPA 4XDWA 3CXC2 1C54A 3N8BA 2ZL8A 1LRAA 1DMNA 5IG5A 1ULIB 1CQSA 1B3SA 2RNTA 4K1VA 1JZDA 1YI23 1UGHI 1CEWI 3MYTA 1Q824 3WA2X 3NBBA 1DYUA 1A2VA 1UCKA 2C11A 2KCDA 4L7KA 2KRTA 3D9RA 3IPTA 5CK6A 5KP3A 3LOYA 2OTL3 1ASKA 4R9KA 1HU9A 3EX9A 1OF5B 2D1WA 5IG0A 5AYRB 3RDEA 1YJ93 4FR9A 1BUJA 1IQ8A 1T2HA 1VQ83 1NO3A 1T3BA 3AHSA 3CC23 1FW7A 1N8QA 3D4AA 5I97A 3LYGA 2CH9A 3CNXA 4ZM8A 3F9SA 4GB5A 1HZ1A 3EQQB 1YGWA 3CU3A 3EHCA 1GY6A 3LTDA 2KAAA 4KZ1A 2XH9A 2AAEA 3LTBA 3ZG5A 1VQ43 4R1KA 3RGRA 3JVCA 1U5OA 2ZA4A 5IENA 3VGNA 3NQZA 4J8TA 4HM0B 1BANA 1QVG2 2CK3H 3URPA 2L4VA 1VQP3 3DMCA 1BNJA 2GU3A 1BRIA 2KF3A 3MPHA 4MMXB 2UUGC 4KFEA 1A2PA 4HZBB 1W5ZA 3EF8A 1LVNA 3CMA3 1WMPA 5DRVA 1OHOA 5AEWB 2Z76A 1IT8A 1OF5A 1O7MB 2J8XB 1Q864 1I2FA 3EN8A 1FZUA 1IDPA 1W4NA 3D3LA 1IVWA 3LZAA 4XBYA 1I70A 1TRQA 2JQ5A 2W9PA 1HKXA 3ECFA 3FGYA 3FSDA 4JRFA 4AKZA 3DZLA 4J5GA 2Y73A 4WP5A 1NB3I 3JUQA 3LTAA 3N54B 2XFTA
chains in the Genus database with same CATH topology
1ULJB 4N6NB 2P09A 1GY7A 3KSPA 2JDIH 4O8SA 4AKYA 1QVF2 2YFLB 1WMNA 1DVDA 3NM2A 4N3VA 1OGZA 3NM7A 3UL5A 5BVBA 1GYBA 2Q07A 1OHPA 2O9UX 5D82A 2CFDA 2XRXB 1M1XB 5KP1A 2QIYA 1G96A 1EA2A 4STDA 3X40A 1QJGA 1US1A 4KVHA 2MF7A 2STDA 4EV5A 1OACA 3WDGB 4AEQA 2XGLA 4IPBA 1N9EA 2PZVA 1FUWA 3UJMA 3CME3 1IQYA 1YHQ3 2W56B 3FF0A 2PNCA 1S5AA 4LGQA 4HM7B 3I0YA 4KFFA 2V1LA 5IG4A 2XSHB 3OXAA 2W6JH 1JB4A 4N6TA 4HM6B 5CF2A 1NB5I 1TFOA 1NDOB 1W02A 4Q53A 4RBNA 7STDA 2IUKA 3DGOA 4QWTA 1OH0A 4O02B 2QA43 2A15A 3NBJA 4OUQA 2W2CA 1YIT3 2K54A 2W03A 1FA3A 1AR0A 3CNMA 1W6YA 1IVUA 4RNZA 3PGBA 3PZWA 4EC6A 1JN5B 5EEOA 1WNHA 3CC43 1O7NB 5G2GA 2Z77A 3K63A 3NHXA 2W56A 2XEPA 5LC6A 1M904 1OHSA 1OUNA 2GBWB 1ZO2A 1PU4A 1K28A 2B24B 3BNCA 4MMYB 5D83A 3CCU3 2MC8A 3GZBA 4HZ9B 5STDA 4HJLB 3DGMA 3NXJA 2YFJB 1YGEA 3OWYA 3FKAA 2BHMA 2GEYA 2INXA 1D6ZA 5FGOA 1RJOA 1SIIA 2OWPA 5AEUB 1UUWB 1BUQA 1SPUA 3DM8A 1EQKA 1YVBI 2P0XA 3WMDA 4WYKB 3NQYA 1F8NA 3FG3A 4X2OA 3IMAB 2BT3A 2R4IA 1WTHA 3K7CA 1IK3A 1FGOA 2C10A 2BMOB 3MHEA 1JN5A 1UI8A 3RDEA 2P38A 3B4OA 2BNGA 3KN4A 4U13A 3OW22 3FG1A 1JB5A 3TDGA 1A67A 3FH1A 3OWUA 1KD14 1ZX2A 2WOFA 2HMJB 2LYXA 1MNLA 1M1K4 3WOEB 1C7HA 2CKFB 1TUHA 3JUPA 4HYZA 4JF8A 1OPYA 4IIAA 5IW9A 4HKVB 3SOYA 2XR8B 3BNEA 5IEOA 2HMLB 2ML5A 2OQEC 3ALAA 2CW9A 4WYKA 2XSOB 3SOAA 3CD63 1O7WB 1OGXA 3JUOA 4FMCA 3K0ZA 5A0OB 2O3OA 3K5TA 4EXRA 2FXTA 4FCZA 3DXOA 5ELUA 1JNQA 3ROBA 3HIGA 4K1UA 2LQVA 1AVKA 3G4S3 1N8R4 4K61A 1QAFA 3G6E3 2CFWA 4EV2A 1TFKA 1T5YA 5AIFA 3NV0B 2RGQA 3EE1A 2B1XB 4O2HA 4EBGA 1JKGB 2ZDJA 1STDA 3WA3A 1K9M4 1O7PB 2BMRB 3NUVA 3CPW2 3U1WA 1KSIA 2FGTA 1M9GA 5EQLA 3X3YA 3HK4A 4HM8B 4LSOA 1Q814 1IT7A 4BTWA 1Y4KA 4I4KA 4WHAA 3OWSA 4R80A 1ROVA 1YIJ3 3B4PA 3JUMA 4HVNA 1JB2A 3LH4A 1NJI4 2IMJA 2GBXB 2CFGA 3X3ZA 3G8ZA 5CF1A 2XFSA 2UX0A 1GD4A 3JUNA 2CWTA 3VF1A 1TIJA 3AMOB 5FW5A 1Q7Y4 3A76A 2OTJ3 5JPPA 3STDA 1AV4A 1NU3A 3Q2PA 3NV0A 5AIHA 5HGRA 1VQ93 3K9MC 1O7GB 3CCL3 1STFI 1UI7A 1VQ73 3SVAA 1KC84 4HM1B 5DREA 3HX8A 3T8NA 3EC9A 3CCE3 5JPUA 3F8XA 4R4KA 1QAKA 3T0UA 4ORLA 4BTXA 1V74A 3MSOA 1D6UA 2CFLA 2F98A 4EYCA 1E97A 1PFPA 3V98A 3BB9A 1RKYA 1A2KA 5CXOA 3KIIA 3PCSA 2QEX3 3PCRA 2HMNB 1OCVA 2K0MA 3U97A 1VQ53 1Q42A 4MMZB 1FGTA 2HMMB 1L5GB 2RFRA 2RSXA 2FNQA 3X3XA 4TX4A 1K41A 2P05A 1RRLA 3DGLA 3LXUX 4NREA 4MEIA 5AI1A 2CWUA 1MOLA 4XM4A 1WQLB 2KXGA 2WOHA 3EBTA 1FGMA 4RNYA 2E2VA 3J7Yd 3H3HA 4GL6A 3MG2A 8CHOA 4O3VA 3LMLA 4OVMA 2CC3A 5LC7A 3S27A 1JRQA 2GEXA 4L8PA 2IUJA 3DY5A 5KP4A 2E2TA 1VZZA 1QALA 1QMAA 3DUKA 3WODG 1K734 2OOVA 1N9JA 1DVCA 3L0RA 2XF3A 1FGRA 1AVLA 1KWIA 1RRHA 1Z1SA 4HM3B 3KZTA 3EB8A 2M7OA 1YJW3 4HM5B 2BO9B 2OQEA 3E99A 4LMIA 3S67A 1W01A 4CCVA 2QGUA 3GAXA 1VQL3 3MG3A 2Z7AA 3N9HA 1N5HA 4FCJA 3SEDA 3T8UA 3CCQ3 1W00A 1W6CA 2OOVC 5EVHA 4OK0A 3CPOA 3GZRA 1K8A4 3PS8A 1VQ63 1W6GA 3BNDA 3X42A 3ER7A 1D6YA 3GRDA 4N6V0 4BTYA 5BXQA 5IERA 1DMQA 2GXFA 5CLKA 3Q1CA 1LOXA 6STDA 2CHCA 1Q40B 5AIIA 2HMOB 5AYSC 4LEHA 3F7XA 1UUVB 2HMKB 3FG4A 5IG3A 3EN1B 1LNHA 3KSED 3X41A 5D81A 1IU7A 5JBSA 3SX1A 1EG9B 1IQXA 2F99A 2WO0A 1EKMA 3CCS3 3V99A 4XBTA 3CCR3 3G16A 3NBRA 1JJ22 5ELJA 3MWZA 2F86B 4PEJA 3KE7A 3FZWA 3HIIA 4N6UA 1O7HB 3CCV3 3I563 1CYUA 2CG0A 2SBLA 3FCSB 1W2B2 4FMAA 3CCJ3 1NWWA 4CDLA 3F8HA 1Q40A 1R4CA 1E3VA 3DGNA 4G1MB 1SQWA 2W9QA 1IVXA 3FLJA 4R9LA 4RZMA 4HM2B 3F14A 1JV2B 2RCDA 3B7CA 4K90B 4LZIA 4NHFA 4H61A 1IV7A 1W2ZA 3Q90A 3F40A 4FCMA 4XBXA 2IA7A 3I553 4HBRA 4WWUC 3S5CA 3CCM3 3WOFB 1SIHA 1U8CB 1YJN3 2GU1A 1GY5A 1LXEA 3G713 1JKGA 5TGNA 3BLZA 3GWRA 3QK9A 3LT9A 3EBYA 1GS3A 3S28A 4X2HA 2E2UA 1N5PA 3MKIA 2I9WA 1DMMA 3GZYB 1CYVA 1WMOA 3S29A 4N6LA 4N6MA 2CIUA 4XB5A 3UL6A 3IJEB 3OV4A 1VQM3 5IEPA 3QRDA 2WGOA 1IV9A 3SXXA 2W04A 4XDVA 2P0MA 5IF6A 2Y74A 1W7CA 4KFDA 1ISKA 2D42A 2CWVA 3F7SA 3SLUA 3O8YA 4MJDA 1KQS2 1RN7A 3AMOA 2YX9A 3G0KA 1TU5A 3KFQC 3RGAA 4H3UA 4FMBA 1VQK3 4N6OB 3H51A 1UW1A 4J9AA 3UB1A 3KKGA 3M8CA 3BNBA 3PYJA 3EJVA 2CFKA 1VQN3 2CG1A 2XGNA 2W0QA 3GZXB 1VQO3 1IVVA 3PXMA 3CC73 1FGQA 3FF2A 3HZPA 3HI7A 3LT8A 3OX9A 3MG1A 1GD3A 1SJWA 3UNLA 1A90A 1J2BA 4HM4B 4FMDA 3VSYA 4L8OA 1ROAA 2BMQB 2Z6BA 3LTCA 3V92A 1S723 2OCTA 3B8LA 2WGQA 1TP6A 3NX0A 5AIGA 2YFIB 1E3RA 2ML6A 4WFOA 4IT7A 4XDWA 3CXC2 3N8BA 2ZL8A 1DMNA 5IG5A 1ULIB 1CQSA 4K1VA 1YI23 3MYTA 1CEWI 1Q824 3WA2X 3NBBA 1DYUA 1A2VA 2C11A 2KCDA 4L7KA 2KRTA 3D9RA 3IPTA 5CK6A 5KP3A 3LOYA 2OTL3 1ASKA 4R9KA 1HU9A 3EX9A 1OF5B 2D1WA 5IG0A 5AYRB 1YJ93 4FR9A 1IQ8A 1VQ83 1NO3A 3CC23 1N8QA 5I97A 3LYGA 2CH9A 3CNXA 4ZM8A 3F9SA 4GB5A 3EQQB 3CU3A 3EHCA 1GY6A 3LTDA 4KZ1A 2XH9A 3LTBA 1VQ43 4R1KA 3RGRA 3JVCA 1U5OA 5IENA 3VGNA 3NQZA 4J8TA 4HM0B 1QVG2 2CK3H 1VQP3 2L4VA 3DMCA 2GU3A 3MPHA 4MMXB 4KFEA 4HZBB 1W5ZA 3EF8A 1LVNA 3CMA3 1WMPA 5DRVA 1OHOA 5AEWB 2Z76A 1IT8A 1OF5A 1O7MB 1Q864 3EN8A 1IDPA 1W4NA 3D3LA 1IVWA 3LZAA 4XBYA 2JQ5A 2W9PA 1HKXA 3ECFA 3FGYA 3FSDA 4JRFA 4AKZA 3DZLA 2Y73A 4WP5A 1NB3I 3JUQA 3LTAA 3N54B 2XFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 3;  3CCM 3;  1QVG 2;  1YHQ 3;  1K73 4;  1K9M 4;  1VQ5 3;  1VQP 3;  2OTJ 3;  3CPW 2;  1JJ2 2;  2OTL 3;  1VQ9 3;  1QVF 2;  1YJN 3;  3CC4 3;  1VQ6 3;  3G71 3;  1KQS 2;  3CCV 3;  3I56 3;  1YJ9 3;  1Q81 4;  3CCL 3;  1W2B 2;  1VQ7 3;  3CMA 3;  3CD6 3;  3CCJ 3;  1VQ8 3;  1VQK 3;  1YJW 3;  3OW2 2;  1KC8 4;  1M90 4;  1S72 3;  1Q86 4;  3CC2 3;  3CME 3;  1YIJ 3;  3CCE 3;  3CCU 3;  1KD1 4;  1Q7Y 4;  1NJI 4;  1VQL 3;  3CXC 2;  1K8A 4;  1VQN 3;  3CCQ 3;  3G4S 3;  2QA4 3;  1N8R 4;  3G6E 3;  1VQ4 3;  1VQO 3;  1M1K 4;  3CC7 3;  1YIT 3;  3CCS 3;  1YI2 3;  1VQM 3;  1Q82 4;  2QEX 3;  3CCR 3; 
#chains in the Genus database with same CATH topology
 1ULJ B;  4N6N B;  2P09 A;  5GSP A;  1GY7 A;  3KSP A;  1BNI A;  2JDI H;  4O8S A;  4AKY A;  1QVF 2;  2YFL B;  1WMN A;  1DVD A;  3NM2 A;  5G1L A;  4N3V A;  1OGZ A;  3NM7 A;  3UL5 A;  5BVB A;  1GYB A;  2Q07 A;  1OHP A;  2O9U X;  5D82 A;  2CFD A;  2XRX B;  1M1X B;  5KP1 A;  2QIY A;  2GSP A;  1G96 A;  1EA2 A;  4STD A;  3X40 A;  1QJG A;  1US1 A;  1RGE A;  4KVH A;  2MF7 A;  2STD A;  4EV5 A;  1OAC A;  3WDG B;  4AEQ A;  2XGL A;  4IPB A;  4HOH A;  1N9E A;  1RN1 A;  2PZV A;  2SAR A;  4J5K A;  1V58 A;  1FUW A;  2ZHX B;  3UJM A;  3CME 3;  1IQY A;  1BNF A;  1YHQ 3;  2W56 B;  2C4B A;  3FF0 A;  2PNC A;  1S5A A;  4LGQ A;  1BNE A;  4HM7 B;  2IYJ A;  3I0Y A;  1RDS A;  1BRK A;  4KFF A;  2V1L A;  5IG4 A;  2XSH B;  3OXA A;  2W6J H;  1JB4 A;  4N6T A;  4HM6 B;  5CF2 A;  1NB5 I;  1TFO A;  1NDO B;  1W02 A;  4Q53 A;  4RBN A;  7STD A;  5BU4 A;  4NPB A;  2IUK A;  3DGO A;  4QWT A;  1LOV A;  1OH0 A;  4O02 B;  1JBR A;  2QA4 3;  2A15 A;  3NBJ A;  4OUQ A;  2W2C A;  1YIT 3;  2K54 A;  1RSN A;  2W03 A;  1FA3 A;  1AR0 A;  3CNM A;  1VQQ A;  1W6Y A;  1IVU A;  1JZO A;  3PGB A;  4RNZ A;  3PZW A;  4EC6 A;  1JN5 B;  5EEO A;  1WNH A;  3CC4 3;  1BNR A;  1O7N B;  5G2G A;  2Z77 A;  3K63 A;  3NHX A;  2W56 A;  2XEP A;  5LC6 A;  1M90 4;  1OHS A;  1OUN A;  2GBW B;  3DH2 A;  1ZO2 A;  1PU4 A;  1K28 A;  2B24 B;  3BNC A;  4MMY B;  5D83 A;  4BL3 A;  2MC8 A;  3CCU 3;  3GZB A;  1LQM B;  4HZ9 B;  5STD A;  1PYL A;  4HJL B;  3DGM A;  3NXJ A;  2YFJ B;  1YGE A;  3OWY A;  3FKA A;  2BHM A;  2GEY A;  2INX A;  1D6Z A;  2IY2 A;  5FGO A;  1RJO A;  1UUG B;  1SII A;  2OWP A;  5AEU B;  1BNS A;  1UUW B;  1BUQ A;  1SPU A;  3DM8 A;  1EQK A;  1YVB I;  5G1K A;  2P0X A;  3WMD A;  4WYK B;  3NQY A;  1F8N A;  3FG3 A;  1RGC A;  4X2O A;  3IMA B;  2KF6 A;  2BT3 A;  2R4I A;  1WTH A;  3K7C A;  1IK3 A;  1B2M A;  1FGO A;  1AQZ A;  1BRG A;  2BMO B;  1JN5 A;  1UI8 A;  2C10 A;  3MHE A;  2P38 A;  2BNG A;  3B4O A;  3D5I A;  3KN4 A;  4U13 A;  1RHL A;  3FG1 A;  3OW2 2;  1JB5 A;  3TDG A;  1A67 A;  3FH1 A;  3OWU A;  1KD1 4;  1R4Y A;  1ZX2 A;  2WOF A;  1BU4 A;  2HMJ B;  2LYX A;  1MNL A;  1M1K 4;  3WOE B;  1C7H A;  2CKF B;  1TUH A;  3JUP A;  4HYZ A;  1AY7 A;  4JF8 A;  1OPY A;  4IIA A;  5IW9 A;  4LYL B;  3AHW A;  1DE3 A;  4HKV B;  3SOY A;  2XR8 B;  3BNE A;  2F56 A;  2HML B;  2ML5 A;  2OQE C;  5IEO A;  1PY3 A;  3ALA A;  3A5E A;  2CW9 A;  4EW5 A;  4WYK A;  2XSO B;  3SOA A;  3CD6 3;  1O7W B;  1OGX A;  3JUO A;  1X1X A;  1GMR A;  4FMC A;  3K0Z A;  1BOX A;  2O3O A;  5A0O B;  3K5T A;  4EXR A;  2FXT A;  2UGI A;  1GOV A;  4FCZ A;  3DXO A;  5ELU A;  1JNQ A;  3ROB A;  1IYY A;  3HIG A;  1UCL A;  4K1U A;  2LQV A;  1AVK A;  3G4S 3;  1N8R 4;  4K61 A;  1QAF A;  6GSP A;  2CFW A;  4EV2 A;  3G6E 3;  1TFK A;  1RMS A;  1T5Y A;  5AIF A;  1ZS7 A;  3NV0 B;  2RGQ A;  3EE1 A;  1TTO A;  2B1X B;  4O2H A;  4EBG A;  1JKG B;  2ZDJ A;  1STD A;  9RNT A;  3WA3 A;  1K9M 4;  1O7P B;  2BMR B;  3NUV A;  3CPW 2;  5M1A A;  3KCH A;  3U1W A;  1BSD A;  1KSI A;  2FGT A;  1M9G A;  5EQL A;  3X3Y A;  2H0H A;  3HK4 A;  1B2S A;  4HM8 B;  4LSO A;  1I2G A;  1Q81 4;  1IT7 A;  4BTW A;  1LNI A;  1Y4K A;  4I4K A;  4WHA A;  2BU4 A;  3OWS A;  1RNT A;  4R80 A;  1ROV A;  1YIJ 3;  1G0T A;  1MGW A;  3B4P A;  3JUM A;  4HVN A;  3AGN A;  1JB2 A;  3LH4 A;  1BRH A;  1I8V A;  1NJI 4;  2IMJ A;  1LOY A;  4BU4 A;  2GBX B;  2CFG A;  3X3Z A;  3G8Z A;  1Q9E A;  5CF1 A;  2RBI A;  2XFS A;  7RNT A;  2UX0 A;  1GD4 A;  2KF4 A;  3JUN A;  2CWT A;  3VF1 A;  1TIJ A;  3AMO B;  5FW5 A;  1Q7Y 4;  1DET A;  3A76 A;  2OTJ 3;  5JPP A;  3STD A;  1AV4 A;  1NU3 A;  3D5G A;  3NV0 A;  1MGR A;  3Q2P A;  5AIH A;  5HGR A;  1I2E A;  1V57 A;  1VQ9 3;  1BRJ A;  1RGH A;  3K9M C;  1O7G B;  3CCL 3;  1STF I;  1UI7 A;  1VQ7 3;  3SVA A;  1I3F A;  1KC8 4;  1BSC A;  2H0I A;  4HM1 B;  5DRE A;  3HX8 A;  3T8N A;  3EC9 A;  3CCE 3;  5JPU A;  5M19 A;  3F8X A;  2F5M A;  4BL2 A;  1B2U A;  4R4K A;  4RNT A;  1QAK A;  3T0U A;  4ORL A;  4BTX A;  1V74 A;  2HOH A;  3MSO A;  1D6U A;  1RCL A;  2CFL A;  2F98 A;  4EYC A;  1E97 A;  1EUI C;  1PFP A;  3V98 A;  3BB9 A;  1RKY A;  1A2K A;  5CXO A;  3KII A;  3PCS A;  2QEX 3;  2F5W A;  3PCR A;  2HMN B;  1OCV A;  2K0M A;  3U97 A;  1VQ5 3;  5RNT A;  1Q42 A;  4MMZ B;  1FGT A;  2HMM B;  3DGY A;  1L5G B;  2RFR A;  1CH0 A;  2RSX A;  2FNQ A;  3X3X A;  7GSP A;  3Q3F A;  1K41 A;  1MWU A;  1RRL A;  2P05 A;  3DGL A;  4TX4 A;  3LXU X;  4NRE A;  4MEI A;  5AI1 A;  2CWU A;  1MOL A;  4XM4 A;  1WQL B;  2KXG A;  2WOH A;  3GSP A;  3EBT A;  1FGM A;  2H0G A;  4RNY A;  2E2V A;  3J7Y d;  3H3H A;  4GL6 A;  3MG2 A;  8CHO A;  4O3V A;  3LML A;  3AGO A;  2CC3 A;  4OVM A;  5LC7 A;  3S27 A;  3WHO A;  1JRQ A;  4BIR A;  1YNV X;  2GEX A;  4L8P A;  2IUJ A;  3RNT A;  3DY5 A;  1BSB A;  5KP4 A;  1UCJ A;  2E2T A;  1VZZ A;  1QAL A;  1QMA A;  3DUK A;  3WOD G;  1K73 4;  4I5Q A;  2OOV A;  1N9J A;  1DVC A;  3L0R A;  3ZG0 A;  2XF3 A;  1SAR A;  1FGR A;  1AVL A;  1KWI A;  1RRH A;  1Z1S A;  4HM3 B;  3KZT A;  3EB8 A;  1B2X A;  2M7O A;  1YJW 3;  2AAD A;  3BU4 A;  4HM5 B;  2BO9 B;  2OQE A;  3E99 A;  4LMI A;  3S67 A;  1W01 A;  4CCV A;  2QGU A;  3GAX A;  1B2Z A;  1VQL 3;  6RNT A;  3MG3 A;  2Z7A A;  3N9H A;  1N5H A;  4FCJ A;  1HYF A;  3SED A;  3T8U A;  3CCQ 3;  4HAA A;  1W00 A;  1W6C A;  2OOV C;  5EVH A;  4OK0 A;  5HOH A;  1GMP A;  3CPO A;  1TRP A;  3GZR A;  1K8A 4;  3PS8 A;  1VQ6 3;  1W6G A;  3BND A;  3X42 A;  3ER7 A;  1D6Y A;  3GRD A;  4CJN A;  4N6V 0;  1JBS A;  4BTY A;  5BXQ A;  1RGG A;  1BSA A;  1RCK A;  1DMQ A;  1RGA A;  2GXF A;  5CLK A;  5IER A;  3Q1C A;  1LOX A;  6STD A;  2CHC A;  1Q40 B;  5AII A;  2HMO B;  5AYS C;  1BVI A;  4LEH A;  3F7X A;  1TJD A;  1UUV B;  2HMK B;  3FG4 A;  1EEJ A;  3SYU A;  4DKI A;  2L1S A;  5IG3 A;  3EN1 B;  2R41 A;  1LNH A;  3KSE D;  3X41 A;  1ZGX A;  5D81 A;  1IU7 A;  3WR2 A;  3SX1 A;  5JBS A;  1EG9 B;  1IQX A;  1UDI I;  2CX1 A;  2F99 A;  2WO0 A;  1EKM A;  3CCS 3;  3V99 A;  4XBT A;  3CCR 3;  3G16 A;  3NBR A;  2CX0 A;  1JJ2 2;  5ELJ A;  3MWZ A;  8RNT A;  2F86 B;  4PEJ A;  3KE7 A;  3FZW A;  3HII A;  4N6U A;  1O7H B;  3CCV 3;  3I56 3;  1CYU A;  2CG0 A;  1G02 A;  2SBL A;  3FCS B;  1W2B 2;  4FMA A;  4ILF A;  3CCJ 3;  1NWW A;  4CDL A;  3F8H A;  1Q40 A;  1R4C A;  1E3V A;  3DGN A;  4G1M B;  1SQW A;  1GOY A;  1IVX A;  1Q7H A;  2W9Q A;  1RGL A;  3FLJ A;  4R9L A;  4RZM A;  1LOW A;  4HM2 B;  3F14 A;  1JV2 B;  2RCD A;  3B7C A;  1RLS A;  1YVS A;  4K90 B;  4LZI A;  4NHF A;  1RNB A;  4H61 A;  1BNG A;  1IV7 A;  1W2Z A;  3Q90 A;  1BSE A;  1X1Y A;  3F40 A;  4FCM A;  4XBX A;  1MWT A;  2IA7 A;  3I55 3;  4HBR A;  4WWU C;  3S5C A;  3CCM 3;  3WOF B;  1SIH A;  1U8C B;  3BIR A;  1YJN 3;  2GU1 A;  1BGS A;  1GY5 A;  1I0X A;  1LXE A;  3G71 3;  1MWR A;  1JKG A;  5TGN A;  3BLZ A;  3GWR A;  1NNV A;  1UCI A;  3QK9 A;  3LT9 A;  3EBY A;  1GS3 A;  1BAO A;  3S28 A;  1B27 A;  4X2H A;  1BRS A;  2BIR A;  2E2U A;  1X1U A;  1N5P A;  3MKI A;  2I9W A;  1DMM A;  3GZY B;  1CYV A;  3HOH A;  1JBT A;  1WMO A;  3D79 A;  3S29 A;  4N6L A;  4N6M A;  2CIU A;  4XB5 A;  3UL6 A;  5M18 A;  3IJE B;  3OV4 A;  1VQM 3;  5IEP A;  3QRD A;  1GOU A;  1IV9 A;  2WGO A;  2W04 A;  3SXX A;  1B20 A;  1BIR A;  2P0M A;  4XDV A;  5IF6 A;  2Y74 A;  1W7C A;  4KFD A;  1ISK A;  2D42 A;  2CWV A;  3F7S A;  1UGI A;  3SLU A;  1FYS A;  3O8Y A;  4MJD A;  1KQS 2;  1RN7 A;  4CPK A;  3AMO A;  2YX9 A;  1MWS A;  3G0K A;  1TU5 A;  3KFQ C;  1X1W A;  3RGA A;  4H3U A;  1B21 A;  2KF5 A;  4FMB A;  1VQK 3;  1RGF A;  3H51 A;  4N6O B;  1BRN L;  1UW1 A;  4J9A A;  3UB1 A;  3KKG A;  2F4Y A;  3M8C A;  3BNB A;  3PYJ A;  3EJV A;  1I3I A;  1RN4 A;  2CFK A;  1VQN 3;  2CG1 A;  2K3D A;  2XGN A;  2W0Q A;  3GZX B;  1I0V A;  1GSP A;  1VQO 3;  1IVV A;  1FUT A;  3PXM A;  3CC7 3;  1FGQ A;  3FF2 A;  3HZP A;  3HI7 A;  3LT8 A;  3OX9 A;  3MG1 A;  3ZFZ A;  1GD3 A;  1SJW A;  1LQG C;  3UNL A;  1GMQ A;  1T2I A;  1RGK A;  1A90 A;  1J2B A;  4HM4 B;  4FMD A;  3VSY A;  1FUS A;  4KT3 B;  4L8O A;  1ROA A;  2BMQ B;  2Z6B A;  3LTC A;  3V92 A;  1S72 3;  2OCT A;  3B8L A;  2WGQ A;  1TP6 A;  3NX0 A;  5AIG A;  2YFI B;  1E3R A;  2ML6 A;  1RTU A;  4WFO A;  4GHO A;  5BIR A;  4IT7 A;  4GSP A;  4XDW A;  3CXC 2;  1C54 A;  3N8B A;  2ZL8 A;  1LRA A;  1DMN A;  5IG5 A;  1ULI B;  1CQS A;  1B3S A;  2RNT A;  4K1V A;  1JZD A;  1YI2 3;  1UGH I;  1CEW I;  3MYT A;  1Q82 4;  3WA2 X;  3NBB A;  1DYU A;  1A2V A;  1UCK A;  2C11 A;  2KCD A;  4L7K A;  2KRT A;  3D9R A;  3IPT A;  5CK6 A;  5KP3 A;  3LOY A;  2OTL 3;  1ASK A;  4R9K A;  1HU9 A;  3EX9 A;  1OF5 B;  2D1W A;  5IG0 A;  5AYR B;  3RDE A;  1YJ9 3;  4FR9 A;  1BUJ A;  1IQ8 A;  1T2H A;  1VQ8 3;  1NO3 A;  1T3B A;  3AHS A;  3CC2 3;  1FW7 A;  1N8Q A;  3D4A A;  5I97 A;  3LYG A;  2CH9 A;  3CNX A;  4ZM8 A;  3F9S A;  4GB5 A;  1HZ1 A;  3EQQ B;  1YGW A;  3CU3 A;  3EHC A;  1GY6 A;  3LTD A;  2KAA A;  4KZ1 A;  2XH9 A;  2AAE A;  3LTB A;  3ZG5 A;  1VQ4 3;  4R1K A;  3RGR A;  3JVC A;  1U5O A;  2ZA4 A;  5IEN A;  3VGN A;  3NQZ A;  4J8T A;  4HM0 B;  1BAN A;  1QVG 2;  2CK3 H;  3URP A;  2L4V A;  1VQP 3;  3DMC A;  1BNJ A;  2GU3 A;  1BRI A;  2KF3 A;  3MPH A;  4MMX B;  2UUG C;  4KFE A;  1A2P A;  4HZB B;  1W5Z A;  3EF8 A;  1LVN A;  3CMA 3;  1WMP A;  5DRV A;  1OHO A;  5AEW B;  2Z76 A;  1IT8 A;  1OF5 A;  1O7M B;  2J8X B;  1Q86 4;  1I2F A;  3EN8 A;  1FZU A;  1IDP A;  1W4N A;  3D3L A;  1IVW A;  3LZA A;  4XBY A;  1I70 A;  1TRQ A;  2JQ5 A;  2W9P A;  1HKX A;  3ECF A;  3FGY A;  3FSD A;  4JRF A;  4AKZ A;  3DZL A;  4J5G A;  2Y73 A;  4WP5 A;  1NB3 I;  3JUQ A;  3LTA A;  3N54 B;  2XFT A; 
#chains in the Genus database with same CATH homology
 1ULJ B;  4N6N B;  2P09 A;  1GY7 A;  3KSP A;  2JDI H;  4O8S A;  4AKY A;  1QVF 2;  2YFL B;  1WMN A;  1DVD A;  3NM2 A;  4N3V A;  1OGZ A;  3NM7 A;  3UL5 A;  5BVB A;  1GYB A;  2Q07 A;  1OHP A;  2O9U X;  5D82 A;  2CFD A;  2XRX B;  1M1X B;  5KP1 A;  2QIY A;  1G96 A;  1EA2 A;  4STD A;  3X40 A;  1QJG A;  1US1 A;  4KVH A;  2MF7 A;  2STD A;  4EV5 A;  1OAC A;  3WDG B;  4AEQ A;  2XGL A;  4IPB A;  1N9E A;  2PZV A;  1FUW A;  3UJM A;  3CME 3;  1IQY A;  1YHQ 3;  2W56 B;  3FF0 A;  2PNC A;  1S5A A;  4LGQ A;  4HM7 B;  3I0Y A;  4KFF A;  2V1L A;  5IG4 A;  2XSH B;  3OXA A;  2W6J H;  1JB4 A;  4N6T A;  4HM6 B;  5CF2 A;  1NB5 I;  1TFO A;  1NDO B;  1W02 A;  4Q53 A;  4RBN A;  7STD A;  2IUK A;  3DGO A;  4QWT A;  1OH0 A;  4O02 B;  2QA4 3;  2A15 A;  3NBJ A;  4OUQ A;  2W2C A;  1YIT 3;  2K54 A;  2W03 A;  1FA3 A;  1AR0 A;  3CNM A;  1W6Y A;  1IVU A;  4RNZ A;  3PGB A;  3PZW A;  4EC6 A;  1JN5 B;  5EEO A;  1WNH A;  3CC4 3;  1O7N B;  5G2G A;  2Z77 A;  3K63 A;  3NHX A;  2W56 A;  2XEP A;  5LC6 A;  1M90 4;  1OHS A;  1OUN A;  2GBW B;  1ZO2 A;  1PU4 A;  1K28 A;  2B24 B;  3BNC A;  4MMY B;  5D83 A;  3CCU 3;  2MC8 A;  3GZB A;  4HZ9 B;  5STD A;  4HJL B;  3DGM A;  3NXJ A;  2YFJ B;  1YGE A;  3OWY A;  3FKA A;  2BHM A;  2GEY A;  2INX A;  1D6Z A;  5FGO A;  1RJO A;  1SII A;  2OWP A;  5AEU B;  1UUW B;  1BUQ A;  1SPU A;  3DM8 A;  1EQK A;  1YVB I;  2P0X A;  3WMD A;  4WYK B;  3NQY A;  1F8N A;  3FG3 A;  4X2O A;  3IMA B;  2BT3 A;  2R4I A;  1WTH A;  3K7C A;  1IK3 A;  1FGO A;  2C10 A;  2BMO B;  3MHE A;  1JN5 A;  1UI8 A;  3RDE A;  2P38 A;  3B4O A;  2BNG A;  3KN4 A;  4U13 A;  3OW2 2;  3FG1 A;  1JB5 A;  3TDG A;  1A67 A;  3FH1 A;  3OWU A;  1KD1 4;  1ZX2 A;  2WOF A;  2HMJ B;  2LYX A;  1MNL A;  1M1K 4;  3WOE B;  1C7H A;  2CKF B;  1TUH A;  3JUP A;  4HYZ A;  4JF8 A;  1OPY A;  4IIA A;  5IW9 A;  4HKV B;  3SOY A;  2XR8 B;  3BNE A;  5IEO A;  2HML B;  2ML5 A;  2OQE C;  3ALA A;  2CW9 A;  4WYK A;  2XSO B;  3SOA A;  3CD6 3;  1O7W B;  1OGX A;  3JUO A;  4FMC A;  3K0Z A;  5A0O B;  2O3O A;  3K5T A;  4EXR A;  2FXT A;  4FCZ A;  3DXO A;  5ELU A;  1JNQ A;  3ROB A;  3HIG A;  4K1U A;  2LQV A;  1AVK A;  3G4S 3;  1N8R 4;  4K61 A;  1QAF A;  3G6E 3;  2CFW A;  4EV2 A;  1TFK A;  1T5Y A;  5AIF A;  3NV0 B;  2RGQ A;  3EE1 A;  2B1X B;  4O2H A;  4EBG A;  1JKG B;  2ZDJ A;  1STD A;  3WA3 A;  1K9M 4;  1O7P B;  2BMR B;  3NUV A;  3CPW 2;  3U1W A;  1KSI A;  2FGT A;  1M9G A;  5EQL A;  3X3Y A;  3HK4 A;  4HM8 B;  4LSO A;  1Q81 4;  1IT7 A;  4BTW A;  1Y4K A;  4I4K A;  4WHA A;  3OWS A;  4R80 A;  1ROV A;  1YIJ 3;  3B4P A;  3JUM A;  4HVN A;  1JB2 A;  3LH4 A;  1NJI 4;  2IMJ A;  2GBX B;  2CFG A;  3X3Z A;  3G8Z A;  5CF1 A;  2XFS A;  2UX0 A;  1GD4 A;  3JUN A;  2CWT A;  3VF1 A;  1TIJ A;  3AMO B;  5FW5 A;  1Q7Y 4;  3A76 A;  2OTJ 3;  5JPP A;  3STD A;  1AV4 A;  1NU3 A;  3Q2P A;  3NV0 A;  5AIH A;  5HGR A;  1VQ9 3;  3K9M C;  1O7G B;  3CCL 3;  1STF I;  1UI7 A;  1VQ7 3;  3SVA A;  1KC8 4;  4HM1 B;  5DRE A;  3HX8 A;  3T8N A;  3EC9 A;  3CCE 3;  5JPU A;  3F8X A;  4R4K A;  1QAK A;  3T0U A;  4ORL A;  4BTX A;  1V74 A;  3MSO A;  1D6U A;  2CFL A;  2F98 A;  4EYC A;  1E97 A;  1PFP A;  3V98 A;  3BB9 A;  1RKY A;  1A2K A;  5CXO A;  3KII A;  3PCS A;  2QEX 3;  3PCR A;  2HMN B;  1OCV A;  2K0M A;  3U97 A;  1VQ5 3;  1Q42 A;  4MMZ B;  1FGT A;  2HMM B;  1L5G B;  2RFR A;  2RSX A;  2FNQ A;  3X3X A;  4TX4 A;  1K41 A;  2P05 A;  1RRL A;  3DGL A;  3LXU X;  4NRE A;  4MEI A;  5AI1 A;  2CWU A;  1MOL A;  4XM4 A;  1WQL B;  2KXG A;  2WOH A;  3EBT A;  1FGM A;  4RNY A;  2E2V A;  3J7Y d;  3H3H A;  4GL6 A;  3MG2 A;  8CHO A;  4O3V A;  3LML A;  4OVM A;  2CC3 A;  5LC7 A;  3S27 A;  1JRQ A;  2GEX A;  4L8P A;  2IUJ A;  3DY5 A;  5KP4 A;  2E2T A;  1VZZ A;  1QAL A;  1QMA A;  3DUK A;  3WOD G;  1K73 4;  2OOV A;  1N9J A;  1DVC A;  3L0R A;  2XF3 A;  1FGR A;  1AVL A;  1KWI A;  1RRH A;  1Z1S A;  4HM3 B;  3KZT A;  3EB8 A;  2M7O A;  1YJW 3;  4HM5 B;  2BO9 B;  2OQE A;  3E99 A;  4LMI A;  3S67 A;  1W01 A;  4CCV A;  2QGU A;  3GAX A;  1VQL 3;  3MG3 A;  2Z7A A;  3N9H A;  1N5H A;  4FCJ A;  3SED A;  3T8U A;  3CCQ 3;  1W00 A;  1W6C A;  2OOV C;  5EVH A;  4OK0 A;  3CPO A;  3GZR A;  1K8A 4;  3PS8 A;  1VQ6 3;  1W6G A;  3BND A;  3X42 A;  3ER7 A;  1D6Y A;  3GRD A;  4N6V 0;  4BTY A;  5BXQ A;  5IER A;  1DMQ A;  2GXF A;  5CLK A;  3Q1C A;  1LOX A;  6STD A;  2CHC A;  1Q40 B;  5AII A;  2HMO B;  5AYS C;  4LEH A;  3F7X A;  1UUV B;  2HMK B;  3FG4 A;  5IG3 A;  3EN1 B;  1LNH A;  3KSE D;  3X41 A;  5D81 A;  1IU7 A;  5JBS A;  3SX1 A;  1EG9 B;  1IQX A;  2F99 A;  2WO0 A;  1EKM A;  3CCS 3;  3V99 A;  4XBT A;  3CCR 3;  3G16 A;  3NBR A;  1JJ2 2;  5ELJ A;  3MWZ A;  2F86 B;  4PEJ A;  3KE7 A;  3FZW A;  3HII A;  4N6U A;  1O7H B;  3CCV 3;  3I56 3;  1CYU A;  2CG0 A;  2SBL A;  3FCS B;  1W2B 2;  4FMA A;  3CCJ 3;  1NWW A;  4CDL A;  3F8H A;  1Q40 A;  1R4C A;  1E3V A;  3DGN A;  4G1M B;  1SQW A;  2W9Q A;  1IVX A;  3FLJ A;  4R9L A;  4RZM A;  4HM2 B;  3F14 A;  1JV2 B;  2RCD A;  3B7C A;  4K90 B;  4LZI A;  4NHF A;  4H61 A;  1IV7 A;  1W2Z A;  3Q90 A;  3F40 A;  4FCM A;  4XBX A;  2IA7 A;  3I55 3;  4HBR A;  4WWU C;  3S5C A;  3CCM 3;  3WOF B;  1SIH A;  1U8C B;  1YJN 3;  2GU1 A;  1GY5 A;  1LXE A;  3G71 3;  1JKG A;  5TGN A;  3BLZ A;  3GWR A;  3QK9 A;  3LT9 A;  3EBY A;  1GS3 A;  3S28 A;  4X2H A;  2E2U A;  1N5P A;  3MKI A;  2I9W A;  1DMM A;  3GZY B;  1CYV A;  1WMO A;  3S29 A;  4N6L A;  4N6M A;  2CIU A;  4XB5 A;  3UL6 A;  3IJE B;  3OV4 A;  1VQM 3;  5IEP A;  3QRD A;  2WGO A;  1IV9 A;  3SXX A;  2W04 A;  4XDV A;  2P0M A;  5IF6 A;  2Y74 A;  1W7C A;  4KFD A;  1ISK A;  2D42 A;  2CWV A;  3F7S A;  3SLU A;  3O8Y A;  4MJD A;  1KQS 2;  1RN7 A;  3AMO A;  2YX9 A;  3G0K A;  1TU5 A;  3KFQ C;  3RGA A;  4H3U A;  4FMB A;  1VQK 3;  4N6O B;  3H51 A;  1UW1 A;  4J9A A;  3UB1 A;  3KKG A;  3M8C A;  3BNB A;  3PYJ A;  3EJV A;  2CFK A;  1VQN 3;  2CG1 A;  2XGN A;  2W0Q A;  3GZX B;  1VQO 3;  1IVV A;  3PXM A;  3CC7 3;  1FGQ A;  3FF2 A;  3HZP A;  3HI7 A;  3LT8 A;  3OX9 A;  3MG1 A;  1GD3 A;  1SJW A;  3UNL A;  1A90 A;  1J2B A;  4HM4 B;  4FMD A;  3VSY A;  4L8O A;  1ROA A;  2BMQ B;  2Z6B A;  3LTC A;  3V92 A;  1S72 3;  2OCT A;  3B8L A;  2WGQ A;  1TP6 A;  3NX0 A;  5AIG A;  2YFI B;  1E3R A;  2ML6 A;  4WFO A;  4IT7 A;  4XDW A;  3CXC 2;  3N8B A;  2ZL8 A;  1DMN A;  5IG5 A;  1ULI B;  1CQS A;  4K1V A;  1YI2 3;  3MYT A;  1CEW I;  1Q82 4;  3WA2 X;  3NBB A;  1DYU A;  1A2V A;  2C11 A;  2KCD A;  4L7K A;  2KRT A;  3D9R A;  3IPT A;  5CK6 A;  5KP3 A;  3LOY A;  2OTL 3;  1ASK A;  4R9K A;  1HU9 A;  3EX9 A;  1OF5 B;  2D1W A;  5IG0 A;  5AYR B;  1YJ9 3;  4FR9 A;  1IQ8 A;  1VQ8 3;  1NO3 A;  3CC2 3;  1N8Q A;  5I97 A;  3LYG A;  2CH9 A;  3CNX A;  4ZM8 A;  3F9S A;  4GB5 A;  3EQQ B;  3CU3 A;  3EHC A;  1GY6 A;  3LTD A;  4KZ1 A;  2XH9 A;  3LTB A;  1VQ4 3;  4R1K A;  3RGR A;  3JVC A;  1U5O A;  5IEN A;  3VGN A;  3NQZ A;  4J8T A;  4HM0 B;  1QVG 2;  2CK3 H;  1VQP 3;  2L4V A;  3DMC A;  2GU3 A;  3MPH A;  4MMX B;  4KFE A;  4HZB B;  1W5Z A;  3EF8 A;  1LVN A;  3CMA 3;  1WMP A;  5DRV A;  1OHO A;  5AEW B;  2Z76 A;  1IT8 A;  1OF5 A;  1O7M B;  1Q86 4;  3EN8 A;  1IDP A;  1W4N A;  3D3L A;  1IVW A;  3LZA A;  4XBY A;  2JQ5 A;  2W9P A;  1HKX A;  3ECF A;  3FGY A;  3FSD A;  4JRF A;  4AKZ A;  3DZL A;  2Y73 A;  4WP5 A;  1NB3 I;  3JUQ A;  3LTA A;  3N54 B;  2XFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...