1YVBI

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
RLLGAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords falcipain 2
total genus 22
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yvbI00
4N6TA 1LXEA 4N6LA 4N6UA 2KXGA 4ZM8A 1FUWA 3NX0A 4IT7A 5ELJA 5A0OB 1A90A 3QRDA 3PS8A 3K9MC 1STFI 2O9UX 3S67A 2CH9A 1DVDA 1GD4A 3PXMA 3PYJA 1N5PA 1PFPA 4EYCA 1ROAA 5EQLA 1DVCA 1FA3A 5LC7A 3MWZA 3KSED 3KFQC 3L0RA 1CYUA 1EQKA 1N5HA 1IV9A 2BO9B 1CYVA 1NB5I 1RN7A 1YVBI 1MNLA 1N9JA 1GD3A 1WNHA 3SVAA 5LC6A 1IV7A 1A67A 4LZIA 4N6MA 1M9GA 3IMAB 4N6NB 4N6V0 3GAXA 5ELUA 3UL6A 3UL5A 1G96A 2OCTA 1TIJA 3Q2PA 4CCVA 4TX4A 1KWIA 1R4CA 3LH4A 1NB3I 2W9QA 2W9PA 1CEWI 4N6OB 1MOLA
chains in the Genus database with same CATH superfamily
4N6TA 2CC3A 1ZGXA 1N9EA 3HZPA 3FG4A 3O8YA 3MSOA 1VQL3 9RNTA 1B2SA 1BNIA 3VGNA 5TGNA 3F7SA 4J5KA 4EYCA 1BGSA 4HM7B 3GZBA 2C10A 2IUKA 3NQZA 3CC73 1W2B2 4HM3B 4HYZA 3L0RA 4LSOA 4JRFA 3SXXA 3B8LA 4PEJA 4WFOA 5DREA 6RNTA 3DY5A 1GD3A 2WO0A 4WWUC 3WA2X 4XBTA 3H51A 5AIGA 4J9AA 3BIRA 5CXOA 1UUWB 1VQP3 2GEYA 2HMMB 3CPOA 1TRPA 1V74A 2OWPA 3KZTA 3S5CA 1PYLA 1UCJA 5FW5A 1OUNA 2Y74A 2WOHA 1RHLA 3UNLA 3GSPA 1VQN3 2YFJB 2E2VA 4AEQA 2AADA 1A90A 3D9RA 1ULJB 2XRXB 3M8CA 1UUGB 2AAEA 2JQ5A 4OK0A 2YX9A 3D4AA 1DVDA 2IY2A 3LTDA 4RNZA 5DRVA 3F8XA 4L8OA 2BIRA 1NO3A 3GZRA 1M904 2SARA 1JKGB 1YIJ3 2CX1A 2GU1A 3JUOA 4KFDA 2IUJA 4WP5A 1RGLA 1I0VA 1LRAA 3SOYA 3UB1A 1TJDA 3DGYA 1BNSA 3FLJA 4WHAA 2IYJA 2P05A 1FGOA 1QAFA 1YI23 3LH4A 1X1XA 3LZAA 4I4KA 1QALA 1NDOB 1OGXA 2D42A 1RN4A 3BNBA 3CCS3 5D83A 4H3UA 2GU3A 3BB9A 4IIAA 1EA2A 3ER7A 1FUWA 2WGQA 3NX0A 3SX1A 2J8XB 4FMCA 4HOHA 1IYYA 1MWTA 2P38A 2KF6A 3DMCA 1JBRA 2RFRA 4U13A 2CH9A 2SBLA 4BU4A 1YJ93 1ROAA 3JUMA 4JF8A 2XSOB 3KFQC 1RLSA 2HMNB 1GS3A 3LT9A 1CQSA 3A5EA 3F7XA 1IV7A 1JV2B 3SOAA 1RSNA 1IVUA 1VQ83 3OWSA 4X2HA 1FGRA 1YHQ3 1VQ53 4NREA 3G6E3 1BRKA 3NHXA 3X3ZA 5KP3A 3KN4A 1JZOA 1SQWA 2W56B 1KD14 1ULIB 2OQEA 1R4YA 5AYRB 1B2MA 1STFI 1Q7HA 5KP4A 1VQ93 4FR9A 5CF2A 3CCR3 5AIFA 1GOUA 2CKFB 3CCQ3 1KQS2 4AKYA 1CYUA 1VQQA 4HM5B 1MNLA 5IEOA 2OTL3 1A67A 4LZIA 1SPUA 3FF0A 3FH1A 3Q2PA 3WHOA 1JZDA 1O7NB 2BMOB 1RRLA 3T8NA 3FG3A 4GL6A 1K28A 2CW9A 2HMKB 2F5MA 2P09A 4KT3B 3B7CA 7GSPA 1LNHA 3HI7A 3J7Yd 2HMOB 3KKGA 2CWVA 2A15A 4MMXB 3GZXB 3DGNA 3EC9A 3N8BA 3LTAA 1DYUA 4HM6B 3LXUX 1FGTA 3MYTA 2UUGC 3LMLA 3DUKA 4BTXA 1RNTA 1BSEA 3K63A 5AIHA 3MWZA 1D6ZA 5LC7A 3G4S3 4HM0B 2OTJ3 1FA3A 1WTHA 1K41A 2L1SA 4I5QA 5RNTA 3DXOA 1JBSA 1GYBA 1KSIA 1SIHA 1T5YA 3CXC2 3WODG 3MG3A 3X42A 4R80A 2GBXB 2ML6A 1I0XA 3DGLA 1HZ1A 2F56A 1RCLA 1BIRA 2ZDJA 2HMLB 1B21A 1RTUA 2IA7A 2P0XA 4O3VA 2W9QA 1HYFA 2KF5A 2W9PA 1WMPA 1FUTA 2YFLB 3DH2A 4MMYB 3URPA 1RMSA 1BNRA 1UW1A 3KCHA 1RDSA 1LXEA 4N6LA 3Q90A 1MGRA 4FMDA 3CMA3 2BT3A 3K0ZA 2QEX3 1RGEA 4RNYA 4GSPA 4J5GA 4L8PA 3F40A 3RDEA 5BU4A 1LVNA 1IQ8A 1W6GA 5D81A 1VQ63 1BU4A 3PZWA 4EV5A 2MF7A 3V99A 3GZYB 1W2ZA 2W03A 4FCJA 5IG4A 2BO9B 1NB5I 2Q07A 1SARA 2YFIB 3SVAA 1UCKA 5ELUA 1OF5B 1SJWA 1MWUA 3G713 1TIJA 1QVG2 2BMRB 2XGLA 1KWIA 2RCDA 3FG1A 5EVHA 1C7HA 3HIGA 2R4IA 4NPBA 2CG0A 4XBXA 1BUJA 4RZMA 1Z1SA 2UGIA 3STDA 2LQVA 3CPW2 4R1KA 1CEWI 1PU4A 3EX9A 1JN5B 6GSPA 5IW9A 1EEJA 3VSYA 4FMAA 3I563 3QRDA 4J8TA 3EN8A 1M1K4 4HM4B 4HZ9B 3K5TA 1V58A 3DZLA 3EF8A 3N54B 3S67A 1NJI4 1W5ZA 2Z76A 2CFDA 1VQ43 3EB8A 1YNVX 1OCVA 2M7OA 3IPTA 3KSED 2KRTA 2K54A 1NWWA 4CPKA 4CDLA 5M1AA 4NHFA 4HM1B 5CK6A 1OHPA 4LGQA 4AKZA 2FGTA 5AI1A 3LTCA 3MG2A 3ECFA 3KE7A 4WYKB 1BRHA 4LMIA 3OV4A 1G0TA 3HIIA 1M9GA 1IK3A 5IG0A 2KXGA 1UGHI 3G0KA 5ELJA 2XF3A 1WMOA 1YJW3 3I0YA 2KF4A 1BRIA 1YJN3 1ROVA 4EBGA 3AGNA 3G8ZA 2Z77A 1QJGA 4FMBA 4GHOA 2O3OA 4HVNA 3CME3 1I3IA 2XFSA 5HGRA 3S28A 3FSDA 3V98A 1M1XB 3LTBA 1B27A 5FGOA 1VQO3 1VQK3 1X1YA 5GSPA 2FXTA 2CX0A 1E3RA 1STDA 5IF6A 2JDIH 4MJDA 1IDPA 2KAAA 2F98A 2RGQA 4G1MB 4BIRA 1T3BA 1RGHA 3NV0A 3OXAA 3RGAA 2W04A 3UJMA 2C11A 1KC84 3U97A 1GSPA 1FGMA 3PS8A 1LOWA 3JVCA 2Z6BA 3F14A 1GOVA 3WMDA 1B2XA 1AY7A 1TUHA 3PYJA 1B2ZA 1E3VA 1N5PA 1PFPA 3DM8A 3NXJA 1JB2A 4IPBA 3V92A 1I2FA 4EW5A 1AR0A 1W4NA 5AIIA 1ZS7A 3GWRA 3EE1A 3NBJA 4HJLB 5LC6A 1Q7Y4 2H0GA 4O8SA 4R9KA 3UL5A 2RBIA 1Q40B 3JUNA 2XFTA 2KCDA 1RRHA 4GB5A 4KVHA 1K8A4 5G1LA 2BHMA 1Q864 2C4BA 1W01A 8CHOA 1D6YA 2CG1A 5CLKA 4N6UA 4H61A 3T8UA 4HBRA 3MG1A 1W00A 3ALAA 3NV0B 1JRQA 1UUVB 1Y4KA 2H0IA 3K9MC 3PCRA 3A76A 3D3LA 3FKAA 4OVMA 3KSPA 3QK9A 5HOHA 1VQM3 3DGMA 1BUQA 4MEIA 1CH0A 8RNTA 1LOVA 1OH0A 1FYSA 1LQGC 1TU5A 1WNHA 2F4YA 4XDWA 1W02A 3Q1CA 1BNGA 2BMQB 1GMRA 1X1UA 3D5IA 4N6V0 3CC23 5IG3A 1G96A 5IG5A 1QVF2 3AMOB 1AQZA 2P0MA 3WOEB 1Q42A 2Z7AA 4XM4A 1YIT3 1X1WA 3CNMA 2HOHA 2CFGA 1JN5A 2V1LA 3JUQA 4R4KA 4RBNA 3LOYA 1LOYA 4BTYA 3GRDA 3BU4A 2CFLA 3S29A 1I70A 2OOVC 1DMQA 1UCLA 2W2CA 3D79A 3EJVA 2E2UA 4N3VA 4STDA 3ZG5A 4OUQA 2O9UX 1RGGA 1BRJA 1IT7A 3AHWA 1Q814 2OQEC 1UI8A 1O7WB 3EBYA 5EQLA 1DVCA 1J2BA 3B4PA 1N5HA 1CYVA 2UX0A 1EUIC 1RN7A 3K7CA 1ZO2A 1O7HB 2QGUA 3JUPA 4N6NB 2GBWB 3GAXA 5D82A 1L5GB 1N8R4 2XR8B 1TFOA 4QWTA 3CU3A 2QA43 1A2VA 2ML5A 1JB4A 5M18A 6STDA 1BSBA 1YGWA 2CFKA 2XH9A 2GSPA 3SEDA 1MWSA 1BSCA 1U5OA 1BNJA 3CNXA 1GY7A 1ISKA 1RGKA 1MOLA 1W7CA 1FZUA 1S723 4K1VA 3BNDA 4WYKA 1DE3A 4O02B 2W6JH 5KP1A 4ILFA 3T0UA 3HX8A 1IQXA 2INXA 5AEUB 1RGFA 1WQLB 3NM2A 3ZG0A 1RCKA 1RGCA 4LYLB 1GOYA 5G2GA 3MPHA 2MC8A 2XEPA 2R41A 4XB5A 1RGAA 3OWYA 2BU4A 2D1WA 3CCU3 2STDA 3X3YA 5I97A 3I553 5M19A 1BNEA 4RNTA 2E2TA 1LQMB 3F8HA 2Y73A 3H3HA 3OW22 1GY6A 1BOXA 3WOFB 4K1UA 3NBBA 5BIRA 1BRNL 2H0HA 1PY3A 4HKVB 1BAOA 3N9HA 4LEHA 1Q9EA 1A2PA 1BRGA 3WA3A 5AYSC 1K9M4 1T2IA 1MGWA 3NQYA 1D6UA 2LYXA 1BANA 1FGQA 1FW7A 4Q53A 1BSAA 1SIIA 1IQYA 2QIYA 1JBTA 3EQQB 3VF1A 3HOHA 2CIUA 3BLZA 1DETA 1B20A 2F5WA 4HM2B 4KFEA 3KIIA 4N6MA 3UL6A 3B4OA 3PCSA 3X41A 4EXRA 2W0QA 2F86B 3LYGA 5JBSA 3CCL3 1FUSA 1QAKA 3SYUA 1AV4A 3PGBA 3U1WA 3TDGA 1RJOA 4ZM8A 3BNCA 1TTOA 1EG9B 1G02A 4CJNA 5BXQA 3CD63 1C54A 1JKGA 3FCSB 3ROBA 4HZBB 2OOVA 1K734 3Q3FA 5JPUA 3PXMA 5STDA 1ASKA 1GMPA 5CF1A 4K61A 1JNQA 5IENA 3NBRA 1GY5A 4BL2A 1ZX2A 1RN1A 1BVIA 3CCV3 1US1A 2CFWA 1IVWA 1I2EA 1Q824 3IMAB 1AVKA 3BNEA 3EN1B 3OX9A 1OPYA 5EEOA 3CCM3 4O2HA 2RSXA 1UGIA 2BNGA 2WOFA 1GMQA 2I9WA 4K90B 1R4CA 2PZVA 3FGYA 1NB3I 1NNVA 1O7GB 1UCIA 3D5GA 3ZFZA 2CK3H 3G16A 4N6OB 1BSDA 1V57A 4R9LA 2ZA4A 1N8QA 4XBYA 4XDVA 1OGZA 3CC43 1B2UA 2W56A 1OACA 4HM8B 4DKIA 1JJ22 3S27A 1BNFA 2K0MA 4HAAA 3HK4A 4KZ1A 1WMNA 7RNTA 1GD4A 1YGEA 1UI7A 3EHCA 1RKYA 1VQ73 2CWUA 2F99A 2B1XB 2CWTA 2RNTA 2ZHXB 3F9SA 1JB5A 1I3FA 1IVXA 4ORLA 1EQKA 2HMJB 3RGRA 1IT8A 1E97A 1HKXA 3WR2A 1BRSA 2GXFA 4FCZA 4CCVA 2GEXA 3AMOA 7STDA 1RNBA 2PNCA 4TX4A 1Q40A 1AVLA 2K3DA 2IMJA 3DGOA 4BTWA 2FNQA 4BL3A 1OF5A 3X3XA 2ZL8A 5G1KA 2B24B 5BVBA 3NUVA 4KFFA 1O7PB 1IU7A 3EBTA 3FZWA 1LNIA 3SLUA 1EKMA 1B3SA 1LOXA 4IT7A 2L4VA 5A0OB 5AEWB 1UDII 1I2GA 1OHOA 3LT8A 5IEPA 1W6CA 1I8VA 3FF2A 1HU9A 1W6YA 2KF3A 2XSHB 3WDGB 1DMNA 3NM7A 1DMMA 1NU3A 1OHSA 2CHCA 1F8NA 3MKIA 4X2OA 3E99A 1IV9A 3MHEA 4FCMA 4MMZB 4EC6A 1O7MB 1TP6A 1YVBI 1N9JA 1A2KA 3X40A 3CCE3 3AGOA 3IJEB 5JPPA 2OCTA 4L7KA 1MWRA 3RNTA 1IVVA 4EV2A 2WGOA 1T2HA 1VZZA 3OWUA 5IERA 2XGNA 1S5AA 1TFKA 1U8CB 1QMAA 3AHSA 3CCJ3 1YVSA 1TRQA
chains in the Genus database with same CATH topology
4N6TA 2CC3A 1N9EA 3HZPA 3FG4A 3O8YA 3MSOA 1VQL3 3VGNA 5TGNA 3F7SA 4EYCA 1W2B2 4HM7B 3GZBA 2C10A 2IUKA 3NQZA 3CC73 4HM3B 4HYZA 3L0RA 4LSOA 4JRFA 3SXXA 3B8LA 4PEJA 4WFOA 5DREA 3DY5A 1GD3A 2WO0A 4WWUC 3WA2X 4XBTA 3H51A 5AIGA 4J9AA 5CXOA 1UUWB 1VQP3 2GEYA 2HMMB 3CPOA 1V74A 2OWPA 3KZTA 3S5CA 5FW5A 1OUNA 2Y74A 2WOHA 1VQN3 3UNLA 2YFJB 2E2VA 4AEQA 1A90A 3D9RA 1ULJB 2XRXB 3M8CA 2JQ5A 4OK0A 2YX9A 1DVDA 3LTDA 4RNZA 5DRVA 3F8XA 4L8OA 1NO3A 3GZRA 1M904 1YIJ3 1JKGB 2GU1A 3JUOA 4KFDA 2IUJA 4WP5A 3SOYA 3UB1A 4WHAA 3FLJA 2P05A 1FGOA 1QAFA 1YI23 3LH4A 3LZAA 4I4KA 1QALA 1NDOB 1OGXA 2D42A 3BNBA 3CCS3 5D83A 4H3UA 2GU3A 3BB9A 4IIAA 1EA2A 3ER7A 1FUWA 2WGQA 3NX0A 3SX1A 4FMCA 2P38A 3DMCA 2RFRA 4U13A 2CH9A 2SBLA 1YJ93 1ROAA 3JUMA 4JF8A 2XSOB 3KFQC 2HMNB 1GS3A 3LT9A 1CQSA 3F7XA 1IV7A 1JV2B 3SOAA 1IVUA 1VQ83 3OWSA 4X2HA 1FGRA 1YHQ3 1VQ53 4NREA 3G6E3 3X3ZA 3NHXA 5KP3A 3KN4A 1SQWA 2W56B 1KD14 1ULIB 2OQEA 5AYRB 1STFI 5KP4A 1VQ93 4FR9A 5CF2A 3CCR3 5AIFA 2CKFB 3CCQ3 1KQS2 4AKYA 1CYUA 4HM5B 1MNLA 5IEOA 2OTL3 1A67A 4LZIA 1SPUA 3FF0A 3FH1A 3Q2PA 1O7NB 2BMOB 1RRLA 3T8NA 3FG3A 4GL6A 1K28A 2CW9A 2HMKB 2P09A 3B7CA 1LNHA 3HI7A 3J7Yd 2HMOB 3KKGA 2CWVA 2A15A 4MMXB 3GZXB 3DGNA 3EC9A 3N8BA 3LTAA 1DYUA 4HM6B 3LXUX 1FGTA 3MYTA 3LMLA 3DUKA 4BTXA 3G4S3 3K63A 5AIHA 5LC7A 3MWZA 1D6ZA 2OTJ3 1FA3A 4HM0B 1WTHA 1K41A 3DXOA 1GYBA 1KSIA 1SIHA 1T5YA 3CXC2 3WODG 3MG3A 3X42A 4R80A 2GBXB 2ML6A 3DGLA 2ZDJA 2HMLB 2P0XA 2IA7A 4O3VA 2W9QA 2W9PA 1WMPA 2YFLB 4MMYB 1UW1A 1LXEA 4N6LA 3Q90A 3CMA3 4FMDA 2BT3A 3K0ZA 2QEX3 3CCJ3 4RNYA 4L8PA 3F40A 3RDEA 1LVNA 1IQ8A 1W6GA 5D81A 1VQ63 3PZWA 4EV5A 2MF7A 3V99A 3GZYB 1W2ZA 2W03A 4FCJA 5IG4A 2BO9B 1NB5I 2Q07A 2YFIB 3SVAA 5ELUA 1OF5B 1SJWA 3G713 1TIJA 1QVG2 2BMRB 2XGLA 1KWIA 2RCDA 3FG1A 5EVHA 1C7HA 3HIGA 2R4IA 2CG0A 4XBXA 4RZMA 1Z1SA 3STDA 3CPW2 2LQVA 4R1KA 1CEWI 1PU4A 3EX9A 1JN5B 5IW9A 3VSYA 4FMAA 3I563 3QRDA 4J8TA 3EN8A 1M1K4 4HM4B 4HZ9B 3K5TA 3DZLA 3EF8A 3N54B 3S67A 1NJI4 1W5ZA 2Z76A 2CFDA 1VQ43 3EB8A 2M7OA 1OCVA 3IPTA 3KSED 2KRTA 2K54A 1NWWA 4CDLA 4NHFA 4HM1B 5CK6A 1OHPA 4LGQA 4AKZA 2FGTA 5AI1A 3LTCA 3MG2A 3ECFA 3KE7A 4WYKB 4LMIA 3OV4A 3HIIA 1M9GA 1IK3A 5IG0A 2KXGA 3G0KA 5ELJA 2XF3A 1WMOA 1YJW3 3I0YA 1YJN3 1ROVA 4EBGA 3G8ZA 2Z77A 1QJGA 4FMBA 2O3OA 4HVNA 3CME3 2XFSA 5HGRA 3S28A 3FSDA 3V98A 1M1XB 3LTBA 5FGOA 1VQO3 1VQK3 2FXTA 1E3RA 1STDA 5IF6A 2JDIH 4MJDA 1IDPA 2F98A 2RGQA 4G1MB 3NV0A 3OXAA 3RGAA 2W04A 3UJMA 2C11A 1KC84 3U97A 1FGMA 3PS8A 3JVCA 2Z6BA 3F14A 3WMDA 1TUHA 3PYJA 1N5PA 1E3VA 1PFPA 3DM8A 3NXJA 4IPBA 1JB2A 3V92A 1AR0A 1W4NA 3GWRA 3EE1A 3NBJA 4HJLB 5LC6A 1Q7Y4 4O8SA 4R9KA 3UL5A 1Q40B 3JUNA 2XFTA 2KCDA 1RRHA 4GB5A 4KVHA 1K8A4 2BHMA 1Q864 1W01A 8CHOA 1D6YA 2CG1A 5CLKA 4N6UA 4H61A 3T8UA 4HBRA 3MG1A 1W00A 3ALAA 3NV0B 1JRQA 1UUVB 1Y4KA 4OVMA 3K9MC 3PCRA 3A76A 3D3LA 3FKAA 5AIIA 3KSPA 3QK9A 1VQM3 3DGMA 1BUQA 4MEIA 1OH0A 1TU5A 1WNHA 4XDWA 1W02A 3Q1CA 2BMQB 4N6V0 3CC23 5IG3A 1G96A 5IG5A 1QVF2 3AMOB 2P0MA 3WOEB 1Q42A 2Z7AA 4XM4A 1YIT3 3CNMA 4RBNA 2CFGA 1JN5A 2V1LA 3JUQA 4R4KA 3LOYA 4BTYA 3GRDA 2CFLA 3S29A 2OOVC 1DMQA 3EJVA 2W2CA 4STDA 2E2UA 4N3VA 4OUQA 2O9UX 1IT7A 1Q814 2OQEC 1UI8A 1O7WB 3EBYA 5EQLA 1DVCA 1J2BA 3B4PA 1N5HA 1CYVA 2UX0A 1RN7A 3K7CA 1ZO2A 1O7HB 2QGUA 3JUPA 4N6NB 2GBWB 3GAXA 5D82A 1L5GB 1N8R4 2XR8B 1TFOA 4QWTA 3CU3A 2QA43 1A2VA 2ML5A 1JB4A 6STDA 2CFKA 3SEDA 2XH9A 1U5OA 3CNXA 1GY7A 1ISKA 1MOLA 1W7CA 1S723 4K1VA 3BNDA 4WYKA 4O02B 2W6JH 5KP1A 3T0UA 3HX8A 1IQXA 2INXA 5AEUB 1WQLB 3NM2A 5G2GA 3MPHA 2MC8A 2XEPA 4XB5A 3OWYA 2D1WA 3CCU3 2STDA 3X3YA 5I97A 3I553 2E2TA 3F8HA 2Y73A 3H3HA 3OW22 1GY6A 3WOFB 4K1UA 3NBBA 4HKVB 3N9HA 4LEHA 3WA3A 5AYSC 1K9M4 3NQYA 1D6UA 2LYXA 1FGQA 4Q53A 1SIIA 1IQYA 2QIYA 3EQQB 3VF1A 2CIUA 3BLZA 4HM2B 4N6MA 3UL6A 4KFEA 3KIIA 3X41A 3B4OA 3PCSA 4EXRA 2W0QA 2F86B 3LYGA 5JBSA 3CCL3 1QAKA 1AV4A 3PGBA 3U1WA 3TDGA 1RJOA 4ZM8A 3BNCA 1EG9B 5BXQA 3CD63 1JKGA 3FCSB 3ROBA 4HZBB 2OOVA 1K734 5JPUA 3PXMA 5STDA 1ASKA 5CF1A 4K61A 1JNQA 5IENA 3NBRA 1GY5A 1ZX2A 3CCV3 1US1A 2CFWA 1IVWA 1Q824 3IMAB 1AVKA 3BNEA 3EN1B 3OX9A 1OPYA 5EEOA 3CCM3 4O2HA 2RSXA 2BNGA 2WOFA 2I9WA 4K90B 1R4CA 2PZVA 3FGYA 1NB3I 1O7GB 2CK3H 3G16A 4N6OB 4R9LA 1N8QA 4XBYA 4XDVA 1OGZA 3CC43 2W56A 1OACA 4HM8B 1JJ22 3S27A 2K0MA 3HK4A 4KZ1A 1WMNA 1GD4A 1YGEA 3EHCA 1UI7A 1RKYA 1VQ73 2CWUA 2F99A 2B1XB 2CWTA 3F9SA 1JB5A 1IVXA 4ORLA 1EQKA 2HMJB 3RGRA 1IT8A 1E97A 1HKXA 4CCVA 2GXFA 4FCZA 2GEXA 3AMOA 7STDA 2PNCA 4TX4A 1Q40A 1AVLA 2IMJA 3DGOA 4BTWA 1OF5A 3X3XA 2ZL8A 2B24B 5BVBA 3NUVA 4KFFA 1O7PB 1IU7A 3EBTA 3FZWA 3SLUA 1EKMA 1LOXA 4IT7A 2L4VA 5A0OB 5AEWB 3LT8A 1OHOA 5IEPA 1W6CA 3FF2A 1HU9A 1W6YA 3WDGB 2XSHB 1DMNA 3NM7A 1DMMA 1NU3A 1OHSA 2CHCA 1F8NA 3MKIA 4X2OA 3E99A 1IV9A 3MHEA 4FCMA 4MMZB 4EC6A 1O7MB 1TP6A 1YVBI 1N9JA 1A2KA 3X40A 3CCE3 3IJEB 5JPPA 2OCTA 4L7KA 1IVVA 4EV2A 2WGOA 5IERA 1VZZA 3OWUA 2XGNA 1S5AA 1TFKA 1U8CB 1QMAA 2FNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6T A;  1LXE A;  4N6L A;  4N6U A;  2KXG A;  4ZM8 A;  1FUW A;  3NX0 A;  4IT7 A;  5ELJ A;  5A0O B;  1A90 A;  3QRD A;  3PS8 A;  3K9M C;  1STF I;  2O9U X;  3S67 A;  2CH9 A;  1DVD A;  1GD4 A;  3PXM A;  3PYJ A;  1N5P A;  1PFP A;  4EYC A;  1ROA A;  5EQL A;  1DVC A;  1FA3 A;  5LC7 A;  3MWZ A;  3KSE D;  3KFQ C;  3L0R A;  1CYU A;  1EQK A;  1N5H A;  1IV9 A;  2BO9 B;  1CYV A;  1NB5 I;  1RN7 A;  1YVB I;  1MNL A;  1N9J A;  1GD3 A;  1WNH A;  3SVA A;  5LC6 A;  1IV7 A;  1A67 A;  4LZI A;  4N6M A;  1M9G A;  3IMA B;  4N6N B;  4N6V 0;  3GAX A;  5ELU A;  3UL6 A;  3UL5 A;  1G96 A;  2OCT A;  1TIJ A;  3Q2P A;  4CCV A;  4TX4 A;  1KWI A;  1R4C A;  3LH4 A;  1NB3 I;  2W9Q A;  2W9P A;  1CEW I;  4N6O B;  1MOL A; 
#chains in the Genus database with same CATH topology
 4N6T A;  2CC3 A;  1ZGX A;  1N9E A;  3HZP A;  3FG4 A;  3O8Y A;  3MSO A;  1VQL 3;  9RNT A;  1B2S A;  1BNI A;  3VGN A;  5TGN A;  3F7S A;  4J5K A;  4EYC A;  1BGS A;  4HM7 B;  3GZB A;  2C10 A;  2IUK A;  3NQZ A;  3CC7 3;  1W2B 2;  4HM3 B;  4HYZ A;  3L0R A;  4LSO A;  4JRF A;  3SXX A;  3B8L A;  4PEJ A;  4WFO A;  5DRE A;  6RNT A;  3DY5 A;  1GD3 A;  2WO0 A;  4WWU C;  3WA2 X;  4XBT A;  3H51 A;  5AIG A;  4J9A A;  3BIR A;  5CXO A;  1UUW B;  1VQP 3;  2GEY A;  2HMM B;  3CPO A;  1TRP A;  1V74 A;  2OWP A;  3KZT A;  3S5C A;  1PYL A;  1UCJ A;  5FW5 A;  1OUN A;  2Y74 A;  2WOH A;  1RHL A;  3UNL A;  3GSP A;  1VQN 3;  2YFJ B;  2E2V A;  4AEQ A;  2AAD A;  1A90 A;  3D9R A;  1ULJ B;  2XRX B;  3M8C A;  1UUG B;  2AAE A;  2JQ5 A;  4OK0 A;  2YX9 A;  3D4A A;  1DVD A;  2IY2 A;  3LTD A;  4RNZ A;  5DRV A;  3F8X A;  4L8O A;  2BIR A;  1NO3 A;  3GZR A;  1M90 4;  2SAR A;  1JKG B;  1YIJ 3;  2CX1 A;  2GU1 A;  3JUO A;  4KFD A;  2IUJ A;  4WP5 A;  1RGL A;  1I0V A;  1LRA A;  3SOY A;  3UB1 A;  1TJD A;  3DGY A;  1BNS A;  3FLJ A;  4WHA A;  2IYJ A;  2P05 A;  1FGO A;  1QAF A;  1YI2 3;  3LH4 A;  1X1X A;  3LZA A;  4I4K A;  1QAL A;  1NDO B;  1OGX A;  2D42 A;  1RN4 A;  3BNB A;  3CCS 3;  5D83 A;  4H3U A;  2GU3 A;  3BB9 A;  4IIA A;  1EA2 A;  3ER7 A;  1FUW A;  2WGQ A;  3NX0 A;  3SX1 A;  2J8X B;  4FMC A;  4HOH A;  1IYY A;  1MWT A;  2P38 A;  2KF6 A;  3DMC A;  1JBR A;  2RFR A;  4U13 A;  2CH9 A;  2SBL A;  4BU4 A;  1YJ9 3;  1ROA A;  3JUM A;  4JF8 A;  2XSO B;  3KFQ C;  1RLS A;  2HMN B;  1GS3 A;  3LT9 A;  1CQS A;  3A5E A;  3F7X A;  1IV7 A;  1JV2 B;  3SOA A;  1RSN A;  1IVU A;  1VQ8 3;  3OWS A;  4X2H A;  1FGR A;  1YHQ 3;  1VQ5 3;  4NRE A;  3G6E 3;  1BRK A;  3NHX A;  3X3Z A;  5KP3 A;  3KN4 A;  1JZO A;  1SQW A;  2W56 B;  1KD1 4;  1ULI B;  2OQE A;  1R4Y A;  5AYR B;  1B2M A;  1STF I;  1Q7H A;  5KP4 A;  1VQ9 3;  4FR9 A;  5CF2 A;  3CCR 3;  5AIF A;  1GOU A;  2CKF B;  3CCQ 3;  1KQS 2;  4AKY A;  1CYU A;  1VQQ A;  4HM5 B;  1MNL A;  5IEO A;  2OTL 3;  1A67 A;  4LZI A;  1SPU A;  3FF0 A;  3FH1 A;  3Q2P A;  3WHO A;  1JZD A;  1O7N B;  2BMO B;  1RRL A;  3T8N A;  3FG3 A;  4GL6 A;  1K28 A;  2CW9 A;  2HMK B;  2F5M A;  2P09 A;  4KT3 B;  3B7C A;  7GSP A;  1LNH A;  3HI7 A;  3J7Y d;  2HMO B;  3KKG A;  2CWV A;  2A15 A;  4MMX B;  3GZX B;  3DGN A;  3EC9 A;  3N8B A;  3LTA A;  1DYU A;  4HM6 B;  3LXU X;  1FGT A;  3MYT A;  2UUG C;  3LML A;  3DUK A;  4BTX A;  1RNT A;  1BSE A;  3K63 A;  5AIH A;  3MWZ A;  1D6Z A;  5LC7 A;  3G4S 3;  4HM0 B;  2OTJ 3;  1FA3 A;  1WTH A;  1K41 A;  2L1S A;  4I5Q A;  5RNT A;  3DXO A;  1JBS A;  1GYB A;  1KSI A;  1SIH A;  1T5Y A;  3CXC 2;  3WOD G;  3MG3 A;  3X42 A;  4R80 A;  2GBX B;  2ML6 A;  1I0X A;  3DGL A;  1HZ1 A;  2F56 A;  1RCL A;  1BIR A;  2ZDJ A;  2HML B;  1B21 A;  1RTU A;  2IA7 A;  2P0X A;  4O3V A;  2W9Q A;  1HYF A;  2KF5 A;  2W9P A;  1WMP A;  1FUT A;  2YFL B;  3DH2 A;  4MMY B;  3URP A;  1RMS A;  1BNR A;  1UW1 A;  3KCH A;  1RDS A;  1LXE A;  4N6L A;  3Q90 A;  1MGR A;  4FMD A;  3CMA 3;  2BT3 A;  3K0Z A;  2QEX 3;  1RGE A;  4RNY A;  4GSP A;  4J5G A;  4L8P A;  3F40 A;  3RDE A;  5BU4 A;  1LVN A;  1IQ8 A;  1W6G A;  5D81 A;  1VQ6 3;  1BU4 A;  3PZW A;  4EV5 A;  2MF7 A;  3V99 A;  3GZY B;  1W2Z A;  2W03 A;  4FCJ A;  5IG4 A;  2BO9 B;  1NB5 I;  2Q07 A;  1SAR A;  2YFI B;  3SVA A;  1UCK A;  5ELU A;  1OF5 B;  1SJW A;  1MWU A;  3G71 3;  1TIJ A;  1QVG 2;  2BMR B;  2XGL A;  1KWI A;  2RCD A;  3FG1 A;  5EVH A;  1C7H A;  3HIG A;  2R4I A;  4NPB A;  2CG0 A;  4XBX A;  1BUJ A;  4RZM A;  1Z1S A;  2UGI A;  3STD A;  2LQV A;  3CPW 2;  4R1K A;  1CEW I;  1PU4 A;  3EX9 A;  1JN5 B;  6GSP A;  5IW9 A;  1EEJ A;  3VSY A;  4FMA A;  3I56 3;  3QRD A;  4J8T A;  3EN8 A;  1M1K 4;  4HM4 B;  4HZ9 B;  3K5T A;  1V58 A;  3DZL A;  3EF8 A;  3N54 B;  3S67 A;  1NJI 4;  1W5Z A;  2Z76 A;  2CFD A;  1VQ4 3;  3EB8 A;  1YNV X;  1OCV A;  2M7O A;  3IPT A;  3KSE D;  2KRT A;  2K54 A;  1NWW A;  4CPK A;  4CDL A;  5M1A A;  4NHF A;  4HM1 B;  5CK6 A;  1OHP A;  4LGQ A;  4AKZ A;  2FGT A;  5AI1 A;  3LTC A;  3MG2 A;  3ECF A;  3KE7 A;  4WYK B;  1BRH A;  4LMI A;  3OV4 A;  1G0T A;  3HII A;  1M9G A;  1IK3 A;  5IG0 A;  2KXG A;  1UGH I;  3G0K A;  5ELJ A;  2XF3 A;  1WMO A;  1YJW 3;  3I0Y A;  2KF4 A;  1BRI A;  1YJN 3;  1ROV A;  4EBG A;  3AGN A;  3G8Z A;  2Z77 A;  1QJG A;  4FMB A;  4GHO A;  2O3O A;  4HVN A;  3CME 3;  1I3I A;  2XFS A;  5HGR A;  3S28 A;  3FSD A;  3V98 A;  1M1X B;  3LTB A;  1B27 A;  5FGO A;  1VQO 3;  1VQK 3;  1X1Y A;  5GSP A;  2FXT A;  2CX0 A;  1E3R A;  1STD A;  5IF6 A;  2JDI H;  4MJD A;  1IDP A;  2KAA A;  2F98 A;  2RGQ A;  4G1M B;  4BIR A;  1T3B A;  1RGH A;  3NV0 A;  3OXA A;  3RGA A;  2W04 A;  3UJM A;  2C11 A;  1KC8 4;  3U97 A;  1GSP A;  1FGM A;  3PS8 A;  1LOW A;  3JVC A;  2Z6B A;  3F14 A;  1GOV A;  3WMD A;  1B2X A;  1AY7 A;  1TUH A;  3PYJ A;  1B2Z A;  1E3V A;  1N5P A;  1PFP A;  3DM8 A;  3NXJ A;  1JB2 A;  4IPB A;  3V92 A;  1I2F A;  4EW5 A;  1AR0 A;  1W4N A;  5AII A;  1ZS7 A;  3GWR A;  3EE1 A;  3NBJ A;  4HJL B;  5LC6 A;  1Q7Y 4;  2H0G A;  4O8S A;  4R9K A;  3UL5 A;  2RBI A;  1Q40 B;  3JUN A;  2XFT A;  2KCD A;  1RRH A;  4GB5 A;  4KVH A;  1K8A 4;  5G1L A;  2BHM A;  1Q86 4;  2C4B A;  1W01 A;  8CHO A;  1D6Y A;  2CG1 A;  5CLK A;  4N6U A;  4H61 A;  3T8U A;  4HBR A;  3MG1 A;  1W00 A;  3ALA A;  3NV0 B;  1JRQ A;  1UUV B;  1Y4K A;  2H0I A;  3K9M C;  3PCR A;  3A76 A;  3D3L A;  3FKA A;  4OVM A;  3KSP A;  3QK9 A;  5HOH A;  1VQM 3;  3DGM A;  1BUQ A;  4MEI A;  1CH0 A;  8RNT A;  1LOV A;  1OH0 A;  1FYS A;  1LQG C;  1TU5 A;  1WNH A;  2F4Y A;  4XDW A;  1W02 A;  3Q1C A;  1BNG A;  2BMQ B;  1GMR A;  1X1U A;  3D5I A;  4N6V 0;  3CC2 3;  5IG3 A;  1G96 A;  5IG5 A;  1QVF 2;  3AMO B;  1AQZ A;  2P0M A;  3WOE B;  1Q42 A;  2Z7A A;  4XM4 A;  1YIT 3;  1X1W A;  3CNM A;  2HOH A;  2CFG A;  1JN5 A;  2V1L A;  3JUQ A;  4R4K A;  4RBN A;  3LOY A;  1LOY A;  4BTY A;  3GRD A;  3BU4 A;  2CFL A;  3S29 A;  1I70 A;  2OOV C;  1DMQ A;  1UCL A;  2W2C A;  3D79 A;  3EJV A;  2E2U A;  4N3V A;  4STD A;  3ZG5 A;  4OUQ A;  2O9U X;  1RGG A;  1BRJ A;  1IT7 A;  3AHW A;  1Q81 4;  2OQE C;  1UI8 A;  1O7W B;  3EBY A;  5EQL A;  1DVC A;  1J2B A;  3B4P A;  1N5H A;  1CYV A;  2UX0 A;  1EUI C;  1RN7 A;  3K7C A;  1ZO2 A;  1O7H B;  2QGU A;  3JUP A;  4N6N B;  2GBW B;  3GAX A;  5D82 A;  1L5G B;  1N8R 4;  2XR8 B;  1TFO A;  4QWT A;  3CU3 A;  2QA4 3;  1A2V A;  2ML5 A;  1JB4 A;  5M18 A;  6STD A;  1BSB A;  1YGW A;  2CFK A;  2XH9 A;  2GSP A;  3SED A;  1MWS A;  1BSC A;  1U5O A;  1BNJ A;  3CNX A;  1GY7 A;  1ISK A;  1RGK A;  1MOL A;  1W7C A;  1FZU A;  1S72 3;  4K1V A;  3BND A;  4WYK A;  1DE3 A;  4O02 B;  2W6J H;  5KP1 A;  4ILF A;  3T0U A;  3HX8 A;  1IQX A;  2INX A;  5AEU B;  1RGF A;  1WQL B;  3NM2 A;  3ZG0 A;  1RCK A;  1RGC A;  4LYL B;  1GOY A;  5G2G A;  3MPH A;  2MC8 A;  2XEP A;  2R41 A;  4XB5 A;  1RGA A;  3OWY A;  2BU4 A;  2D1W A;  3CCU 3;  2STD A;  3X3Y A;  5I97 A;  3I55 3;  5M19 A;  1BNE A;  4RNT A;  2E2T A;  1LQM B;  3F8H A;  2Y73 A;  3H3H A;  3OW2 2;  1GY6 A;  1BOX A;  3WOF B;  4K1U A;  3NBB A;  5BIR A;  1BRN L;  2H0H A;  1PY3 A;  4HKV B;  1BAO A;  3N9H A;  4LEH A;  1Q9E A;  1A2P A;  1BRG A;  3WA3 A;  5AYS C;  1K9M 4;  1T2I A;  1MGW A;  3NQY A;  1D6U A;  2LYX A;  1BAN A;  1FGQ A;  1FW7 A;  4Q53 A;  1BSA A;  1SII A;  1IQY A;  2QIY A;  1JBT A;  3EQQ B;  3VF1 A;  3HOH A;  2CIU A;  3BLZ A;  1DET A;  1B20 A;  2F5W A;  4HM2 B;  4KFE A;  3KII A;  4N6M A;  3UL6 A;  3B4O A;  3PCS A;  3X41 A;  4EXR A;  2W0Q A;  2F86 B;  3LYG A;  5JBS A;  3CCL 3;  1FUS A;  1QAK A;  3SYU A;  1AV4 A;  3PGB A;  3U1W A;  3TDG A;  1RJO A;  4ZM8 A;  3BNC A;  1TTO A;  1EG9 B;  1G02 A;  4CJN A;  5BXQ A;  3CD6 3;  1C54 A;  1JKG A;  3FCS B;  3ROB A;  4HZB B;  2OOV A;  1K73 4;  3Q3F A;  5JPU A;  3PXM A;  5STD A;  1ASK A;  1GMP A;  5CF1 A;  4K61 A;  1JNQ A;  5IEN A;  3NBR A;  1GY5 A;  4BL2 A;  1ZX2 A;  1RN1 A;  1BVI A;  3CCV 3;  1US1 A;  2CFW A;  1IVW A;  1I2E A;  1Q82 4;  3IMA B;  1AVK A;  3BNE A;  3EN1 B;  3OX9 A;  1OPY A;  5EEO A;  3CCM 3;  4O2H A;  2RSX A;  1UGI A;  2BNG A;  2WOF A;  1GMQ A;  2I9W A;  4K90 B;  1R4C A;  2PZV A;  3FGY A;  1NB3 I;  1NNV A;  1O7G B;  1UCI A;  3D5G A;  3ZFZ A;  2CK3 H;  3G16 A;  4N6O B;  1BSD A;  1V57 A;  4R9L A;  2ZA4 A;  1N8Q A;  4XBY A;  4XDV A;  1OGZ A;  3CC4 3;  1B2U A;  2W56 A;  1OAC A;  4HM8 B;  4DKI A;  1JJ2 2;  3S27 A;  1BNF A;  2K0M A;  4HAA A;  3HK4 A;  4KZ1 A;  1WMN A;  7RNT A;  1GD4 A;  1YGE A;  1UI7 A;  3EHC A;  1RKY A;  1VQ7 3;  2CWU A;  2F99 A;  2B1X B;  2CWT A;  2RNT A;  2ZHX B;  3F9S A;  1JB5 A;  1I3F A;  1IVX A;  4ORL A;  1EQK A;  2HMJ B;  3RGR A;  1IT8 A;  1E97 A;  1HKX A;  3WR2 A;  1BRS A;  2GXF A;  4FCZ A;  4CCV A;  2GEX A;  3AMO A;  7STD A;  1RNB A;  2PNC A;  4TX4 A;  1Q40 A;  1AVL A;  2K3D A;  2IMJ A;  3DGO A;  4BTW A;  2FNQ A;  4BL3 A;  1OF5 A;  3X3X A;  2ZL8 A;  5G1K A;  2B24 B;  5BVB A;  3NUV A;  4KFF A;  1O7P B;  1IU7 A;  3EBT A;  3FZW A;  1LNI A;  3SLU A;  1EKM A;  1B3S A;  1LOX A;  4IT7 A;  2L4V A;  5A0O B;  5AEW B;  1UDI I;  1I2G A;  1OHO A;  3LT8 A;  5IEP A;  1W6C A;  1I8V A;  3FF2 A;  1HU9 A;  1W6Y A;  2KF3 A;  2XSH B;  3WDG B;  1DMN A;  3NM7 A;  1DMM A;  1NU3 A;  1OHS A;  2CHC A;  1F8N A;  3MKI A;  4X2O A;  3E99 A;  1IV9 A;  3MHE A;  4FCM A;  4MMZ B;  4EC6 A;  1O7M B;  1TP6 A;  1YVB I;  1N9J A;  1A2K A;  3X40 A;  3CCE 3;  3AGO A;  3IJE B;  5JPP A;  2OCT A;  4L7K A;  1MWR A;  3RNT A;  1IVV A;  4EV2 A;  2WGO A;  1T2H A;  1VZZ A;  3OWU A;  5IER A;  2XGN A;  1S5A A;  1TFK A;  1U8C B;  1QMA A;  3AHS A;  3CCJ 3;  1YVS A;  1TRQ A; 
#chains in the Genus database with same CATH homology
 4N6T A;  2CC3 A;  1N9E A;  3HZP A;  3FG4 A;  3O8Y A;  3MSO A;  1VQL 3;  3VGN A;  5TGN A;  3F7S A;  4EYC A;  1W2B 2;  4HM7 B;  3GZB A;  2C10 A;  2IUK A;  3NQZ A;  3CC7 3;  4HM3 B;  4HYZ A;  3L0R A;  4LSO A;  4JRF A;  3SXX A;  3B8L A;  4PEJ A;  4WFO A;  5DRE A;  3DY5 A;  1GD3 A;  2WO0 A;  4WWU C;  3WA2 X;  4XBT A;  3H51 A;  5AIG A;  4J9A A;  5CXO A;  1UUW B;  1VQP 3;  2GEY A;  2HMM B;  3CPO A;  1V74 A;  2OWP A;  3KZT A;  3S5C A;  5FW5 A;  1OUN A;  2Y74 A;  2WOH A;  1VQN 3;  3UNL A;  2YFJ B;  2E2V A;  4AEQ A;  1A90 A;  3D9R A;  1ULJ B;  2XRX B;  3M8C A;  2JQ5 A;  4OK0 A;  2YX9 A;  1DVD A;  3LTD A;  4RNZ A;  5DRV A;  3F8X A;  4L8O A;  1NO3 A;  3GZR A;  1M90 4;  1YIJ 3;  1JKG B;  2GU1 A;  3JUO A;  4KFD A;  2IUJ A;  4WP5 A;  3SOY A;  3UB1 A;  4WHA A;  3FLJ A;  2P05 A;  1FGO A;  1QAF A;  1YI2 3;  3LH4 A;  3LZA A;  4I4K A;  1QAL A;  1NDO B;  1OGX A;  2D42 A;  3BNB A;  3CCS 3;  5D83 A;  4H3U A;  2GU3 A;  3BB9 A;  4IIA A;  1EA2 A;  3ER7 A;  1FUW A;  2WGQ A;  3NX0 A;  3SX1 A;  4FMC A;  2P38 A;  3DMC A;  2RFR A;  4U13 A;  2CH9 A;  2SBL A;  1YJ9 3;  1ROA A;  3JUM A;  4JF8 A;  2XSO B;  3KFQ C;  2HMN B;  1GS3 A;  3LT9 A;  1CQS A;  3F7X A;  1IV7 A;  1JV2 B;  3SOA A;  1IVU A;  1VQ8 3;  3OWS A;  4X2H A;  1FGR A;  1YHQ 3;  1VQ5 3;  4NRE A;  3G6E 3;  3X3Z A;  3NHX A;  5KP3 A;  3KN4 A;  1SQW A;  2W56 B;  1KD1 4;  1ULI B;  2OQE A;  5AYR B;  1STF I;  5KP4 A;  1VQ9 3;  4FR9 A;  5CF2 A;  3CCR 3;  5AIF A;  2CKF B;  3CCQ 3;  1KQS 2;  4AKY A;  1CYU A;  4HM5 B;  1MNL A;  5IEO A;  2OTL 3;  1A67 A;  4LZI A;  1SPU A;  3FF0 A;  3FH1 A;  3Q2P A;  1O7N B;  2BMO B;  1RRL A;  3T8N A;  3FG3 A;  4GL6 A;  1K28 A;  2CW9 A;  2HMK B;  2P09 A;  3B7C A;  1LNH A;  3HI7 A;  3J7Y d;  2HMO B;  3KKG A;  2CWV A;  2A15 A;  4MMX B;  3GZX B;  3DGN A;  3EC9 A;  3N8B A;  3LTA A;  1DYU A;  4HM6 B;  3LXU X;  1FGT A;  3MYT A;  3LML A;  3DUK A;  4BTX A;  3G4S 3;  3K63 A;  5AIH A;  5LC7 A;  3MWZ A;  1D6Z A;  2OTJ 3;  1FA3 A;  4HM0 B;  1WTH A;  1K41 A;  3DXO A;  1GYB A;  1KSI A;  1SIH A;  1T5Y A;  3CXC 2;  3WOD G;  3MG3 A;  3X42 A;  4R80 A;  2GBX B;  2ML6 A;  3DGL A;  2ZDJ A;  2HML B;  2P0X A;  2IA7 A;  4O3V A;  2W9Q A;  2W9P A;  1WMP A;  2YFL B;  4MMY B;  1UW1 A;  1LXE A;  4N6L A;  3Q90 A;  3CMA 3;  4FMD A;  2BT3 A;  3K0Z A;  2QEX 3;  3CCJ 3;  4RNY A;  4L8P A;  3F40 A;  3RDE A;  1LVN A;  1IQ8 A;  1W6G A;  5D81 A;  1VQ6 3;  3PZW A;  4EV5 A;  2MF7 A;  3V99 A;  3GZY B;  1W2Z A;  2W03 A;  4FCJ A;  5IG4 A;  2BO9 B;  1NB5 I;  2Q07 A;  2YFI B;  3SVA A;  5ELU A;  1OF5 B;  1SJW A;  3G71 3;  1TIJ A;  1QVG 2;  2BMR B;  2XGL A;  1KWI A;  2RCD A;  3FG1 A;  5EVH A;  1C7H A;  3HIG A;  2R4I A;  2CG0 A;  4XBX A;  4RZM A;  1Z1S A;  3STD A;  3CPW 2;  2LQV A;  4R1K A;  1CEW I;  1PU4 A;  3EX9 A;  1JN5 B;  5IW9 A;  3VSY A;  4FMA A;  3I56 3;  3QRD A;  4J8T A;  3EN8 A;  1M1K 4;  4HM4 B;  4HZ9 B;  3K5T A;  3DZL A;  3EF8 A;  3N54 B;  3S67 A;  1NJI 4;  1W5Z A;  2Z76 A;  2CFD A;  1VQ4 3;  3EB8 A;  2M7O A;  1OCV A;  3IPT A;  3KSE D;  2KRT A;  2K54 A;  1NWW A;  4CDL A;  4NHF A;  4HM1 B;  5CK6 A;  1OHP A;  4LGQ A;  4AKZ A;  2FGT A;  5AI1 A;  3LTC A;  3MG2 A;  3ECF A;  3KE7 A;  4WYK B;  4LMI A;  3OV4 A;  3HII A;  1M9G A;  1IK3 A;  5IG0 A;  2KXG A;  3G0K A;  5ELJ A;  2XF3 A;  1WMO A;  1YJW 3;  3I0Y A;  1YJN 3;  1ROV A;  4EBG A;  3G8Z A;  2Z77 A;  1QJG A;  4FMB A;  2O3O A;  4HVN A;  3CME 3;  2XFS A;  5HGR A;  3S28 A;  3FSD A;  3V98 A;  1M1X B;  3LTB A;  5FGO A;  1VQO 3;  1VQK 3;  2FXT A;  1E3R A;  1STD A;  5IF6 A;  2JDI H;  4MJD A;  1IDP A;  2F98 A;  2RGQ A;  4G1M B;  3NV0 A;  3OXA A;  3RGA A;  2W04 A;  3UJM A;  2C11 A;  1KC8 4;  3U97 A;  1FGM A;  3PS8 A;  3JVC A;  2Z6B A;  3F14 A;  3WMD A;  1TUH A;  3PYJ A;  1N5P A;  1E3V A;  1PFP A;  3DM8 A;  3NXJ A;  4IPB A;  1JB2 A;  3V92 A;  1AR0 A;  1W4N A;  3GWR A;  3EE1 A;  3NBJ A;  4HJL B;  5LC6 A;  1Q7Y 4;  4O8S A;  4R9K A;  3UL5 A;  1Q40 B;  3JUN A;  2XFT A;  2KCD A;  1RRH A;  4GB5 A;  4KVH A;  1K8A 4;  2BHM A;  1Q86 4;  1W01 A;  8CHO A;  1D6Y A;  2CG1 A;  5CLK A;  4N6U A;  4H61 A;  3T8U A;  4HBR A;  3MG1 A;  1W00 A;  3ALA A;  3NV0 B;  1JRQ A;  1UUV B;  1Y4K A;  4OVM A;  3K9M C;  3PCR A;  3A76 A;  3D3L A;  3FKA A;  5AII A;  3KSP A;  3QK9 A;  1VQM 3;  3DGM A;  1BUQ A;  4MEI A;  1OH0 A;  1TU5 A;  1WNH A;  4XDW A;  1W02 A;  3Q1C A;  2BMQ B;  4N6V 0;  3CC2 3;  5IG3 A;  1G96 A;  5IG5 A;  1QVF 2;  3AMO B;  2P0M A;  3WOE B;  1Q42 A;  2Z7A A;  4XM4 A;  1YIT 3;  3CNM A;  4RBN A;  2CFG A;  1JN5 A;  2V1L A;  3JUQ A;  4R4K A;  3LOY A;  4BTY A;  3GRD A;  2CFL A;  3S29 A;  2OOV C;  1DMQ A;  3EJV A;  2W2C A;  4STD A;  2E2U A;  4N3V A;  4OUQ A;  2O9U X;  1IT7 A;  1Q81 4;  2OQE C;  1UI8 A;  1O7W B;  3EBY A;  5EQL A;  1DVC A;  1J2B A;  3B4P A;  1N5H A;  1CYV A;  2UX0 A;  1RN7 A;  3K7C A;  1ZO2 A;  1O7H B;  2QGU A;  3JUP A;  4N6N B;  2GBW B;  3GAX A;  5D82 A;  1L5G B;  1N8R 4;  2XR8 B;  1TFO A;  4QWT A;  3CU3 A;  2QA4 3;  1A2V A;  2ML5 A;  1JB4 A;  6STD A;  2CFK A;  3SED A;  2XH9 A;  1U5O A;  3CNX A;  1GY7 A;  1ISK A;  1MOL A;  1W7C A;  1S72 3;  4K1V A;  3BND A;  4WYK A;  4O02 B;  2W6J H;  5KP1 A;  3T0U A;  3HX8 A;  1IQX A;  2INX A;  5AEU B;  1WQL B;  3NM2 A;  5G2G A;  3MPH A;  2MC8 A;  2XEP A;  4XB5 A;  3OWY A;  2D1W A;  3CCU 3;  2STD A;  3X3Y A;  5I97 A;  3I55 3;  2E2T A;  3F8H A;  2Y73 A;  3H3H A;  3OW2 2;  1GY6 A;  3WOF B;  4K1U A;  3NBB A;  4HKV B;  3N9H A;  4LEH A;  3WA3 A;  5AYS C;  1K9M 4;  3NQY A;  1D6U A;  2LYX A;  1FGQ A;  4Q53 A;  1SII A;  1IQY A;  2QIY A;  3EQQ B;  3VF1 A;  2CIU A;  3BLZ A;  4HM2 B;  4N6M A;  3UL6 A;  4KFE A;  3KII A;  3X41 A;  3B4O A;  3PCS A;  4EXR A;  2W0Q A;  2F86 B;  3LYG A;  5JBS A;  3CCL 3;  1QAK A;  1AV4 A;  3PGB A;  3U1W A;  3TDG A;  1RJO A;  4ZM8 A;  3BNC A;  1EG9 B;  5BXQ A;  3CD6 3;  1JKG A;  3FCS B;  3ROB A;  4HZB B;  2OOV A;  1K73 4;  5JPU A;  3PXM A;  5STD A;  1ASK A;  5CF1 A;  4K61 A;  1JNQ A;  5IEN A;  3NBR A;  1GY5 A;  1ZX2 A;  3CCV 3;  1US1 A;  2CFW A;  1IVW A;  1Q82 4;  3IMA B;  1AVK A;  3BNE A;  3EN1 B;  3OX9 A;  1OPY A;  5EEO A;  3CCM 3;  4O2H A;  2RSX A;  2BNG A;  2WOF A;  2I9W A;  4K90 B;  1R4C A;  2PZV A;  3FGY A;  1NB3 I;  1O7G B;  2CK3 H;  3G16 A;  4N6O B;  4R9L A;  1N8Q A;  4XBY A;  4XDV A;  1OGZ A;  3CC4 3;  2W56 A;  1OAC A;  4HM8 B;  1JJ2 2;  3S27 A;  2K0M A;  3HK4 A;  4KZ1 A;  1WMN A;  1GD4 A;  1YGE A;  3EHC A;  1UI7 A;  1RKY A;  1VQ7 3;  2CWU A;  2F99 A;  2B1X B;  2CWT A;  3F9S A;  1JB5 A;  1IVX A;  4ORL A;  1EQK A;  2HMJ B;  3RGR A;  1IT8 A;  1E97 A;  1HKX A;  4CCV A;  2GXF A;  4FCZ A;  2GEX A;  3AMO A;  7STD A;  2PNC A;  4TX4 A;  1Q40 A;  1AVL A;  2IMJ A;  3DGO A;  4BTW A;  1OF5 A;  3X3X A;  2ZL8 A;  2B24 B;  5BVB A;  3NUV A;  4KFF A;  1O7P B;  1IU7 A;  3EBT A;  3FZW A;  3SLU A;  1EKM A;  1LOX A;  4IT7 A;  2L4V A;  5A0O B;  5AEW B;  3LT8 A;  1OHO A;  5IEP A;  1W6C A;  3FF2 A;  1HU9 A;  1W6Y A;  3WDG B;  2XSH B;  1DMN A;  3NM7 A;  1DMM A;  1NU3 A;  1OHS A;  2CHC A;  1F8N A;  3MKI A;  4X2O A;  3E99 A;  1IV9 A;  3MHE A;  4FCM A;  4MMZ B;  4EC6 A;  1O7M B;  1TP6 A;  1YVB I;  1N9J A;  1A2K A;  3X40 A;  3CCE 3;  3IJE B;  5JPP A;  2OCT A;  4L7K A;  1IVV A;  4EV2 A;  2WGO A;  5IER A;  1VZZ A;  3OWU A;  2XGN A;  1S5A A;  1TFK A;  1U8C B;  1QMA A;  2FNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...