1YVBI

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
RLLGAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords falcipain 2
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yvbI00
1MOLA 1M9GA 1A67A 4CCVA 4TX4A 1GD4A 3PXMA 1WNHA 1ROAA 1KWIA 3S67A 3IMAB 4IT7A 3QRDA 3GAXA 4LZIA 4N6UA 1YVBI 3PYJA 5A0OB 4ZM8A 5ELJA 1TIJA 3Q2PA 5ELUA 1DVCA 1NB5I 3PS8A 1N9JA 2BO9B 1STFI 2KXGA 2CH9A 1CEWI 1EQKA 4N6V0 1PFPA 3UL5A 3KFQC 1CYUA 3L0RA 3LH4A 4N6OB 1LXEA 3UL6A 2OCTA 3KSED 3NX0A 1DVDA 3MWZA 1IV9A 2W9QA 4N6MA 1N5PA 3SVAA 1MNLA 1CYVA 5EQLA 1FA3A 1G96A 1FUWA 1A90A 3K9MC 1NB3I 1R4CA 5LC7A 2O9UX 4N6LA 2W9PA 1N5HA 1GD3A 1IV7A 4EYCA 5LC6A 1RN7A 4N6TA 4N6NB
chains in the Genus database with same CATH superfamily
1ZS7A 3FG4A 3OWSA 5KP3A 4MMXB 1VQ53 4HAAA 3H51A 4PEJA 1IU7A 4HM6B 4TX4A 1QALA 2KCDA 1RCKA 1MWTA 4MJDA 1Y4KA 3LT8A 1OH0A 3UJMA 3LTCA 2W56A 2P0MA 4X2OA 1JZOA 2K3DA 1I3FA 1SQWA 3EN1B 2GU1A 5AEUB 1RLSA 5D83A 2UGIA 1D6UA 3JUOA 1ROAA 5HOHA 1KWIA 1GOYA 2R41A 1LRAA 1X1UA 3S67A 1TFKA 3OXAA 4IT7A 5KP1A 1Q7HA 3PZWA 4LZIA 1STDA 3VGNA 4AEQA 2C4BA 2WOHA 5M19A 4BIRA 1AR0A 1JN5A 3A5EA 5DRVA 2KAAA 1E3RA 3ZG5A 3WR2A 1BSEA 1WMNA 2SBLA 5IERA 1BANA 1NNVA 2GXFA 4WP5A 2F99A 3ECFA 3JUQA 3PS8A 3I553 4XBTA 1BOXA 2BO9B 1STFI 1GY6A 3NQZA 2GU3A 2AADA 1ASKA 1DMQA 1HKXA 1SPUA 2W04A 2XF3A 1FUTA 3AGNA 3NBJA 4O3VA 4EV5A 5IG4A 3O8YA 5AIIA 3BB9A 1B3SA 3EBYA 3NV0B 3N9HA 1AVKA 2FNQA 3N54B 3LXUX 4WWUC 1I2GA 2WO0A 1VQP3 1R4YA 1I0XA 3KFQC 3KN4A 2XGNA 3EX9A 2V1LA 1BGSA 1QAFA 3JUPA 1VQ93 3NUVA 3LH4A 4ILFA 3DGYA 2PZVA 3PCRA 2B1XB 4N6OB 2SARA 1DYUA 6RNTA 2IMJA 1RMSA 3AHWA 3UL6A 4KFFA 3G4S3 3ALAA 3MYTA 1UW1A 2CWTA 1F8NA 1JKGA 2XR8B 4GB5A 2F5MA 3MKIA 2J8XB 3BLZA 2R4IA 3B8LA 1VQO3 2AAEA 2UX0A 1YIT3 2CWUA 2HMOB 3I0YA 1OF5A 1WMPA 2BHMA 3UNLA 2GEYA 2K0MA 3F14A 4MEIA 1DVDA 2CFDA 3SOAA 1W02A 3WA2X 1J2BA 3DGNA 3LMLA 1EUIC 1O7GB 1CQSA 1UUGB 1BNIA 4WYKA 5M18A 1EEJA 2P09A 3FLJA 1LQGC 2W03A 2D1WA 2OQEC 3MG2A 1UCLA 1Q7Y4 4HOHA 1IYYA 4LSOA 1ULJB 2YFLB 1K734 1RTUA 2E2TA 3K63A 3LZAA 4BTYA 3ER7A 1RRHA 2IUKA 1NB3I 4FMCA 2RFRA 3D3LA 1JJ22 2KF6A 2A15A 4BU4A 2BNGA 2W9PA 3EB8A 3A76A 1TRPA 5RNTA 3URPA 3CC43 1IV7A 4XDWA 1RHLA 3GZYB 4J5GA 3DGMA 3JVCA 1W6GA 3NM7A 3G16A 4HM7B 1RNTA 1K41A 3Q1CA 3Q3FA 4R80A 2O3OA 4K1UA 2RGQA 5GSPA 1EA2A 3ZG0A 4NHFA 3CD63 4O8SA 1Q864 3OV4A 1A67A 3X40A 1WQLB 4N3VA 1FUSA 4RNTA 1FGRA 1A2PA 1YGWA 1BNRA 3CCU3 2Y73A 2XSHB 4HM5B 3V98A 4L7KA 2P38A 3PXMA 1B2SA 4I5QA 5CLKA 3RDEA 1BRGA 1T3BA 2F86B 5CF2A 3T0UA 2CK3H 1SIIA 2CFWA 2ML5A 5G2GA 1GMPA 7RNTA 3GAXA 1B2MA 1FGMA 4KVHA 1IQYA 1IT7A 3U1WA 1BSCA 5FGOA 1UUVB 1B2ZA 2H0HA 2INXA 4HM8B 1IQ8A 4BL2A 1OACA 3D9RA 2HMKB 3V92A 1NU3A 2PNCA 4FCJA 4HYZA 2LYXA 3MG3A 3Q2PA 1DE3A 3EBTA 2MF7A 1VQL3 2CFLA 4GSPA 6STDA 4HKVB 1GOUA 4HM1B 1W2B2 1MWSA 2YFIB 1UGIA 2CH9A 2ZA4A 1S723 8CHOA 3WHOA 2F5WA 3SEDA 1EQKA 2CKFB 2BMOB 3HIIA 3IJEB 3CCR3 1G0TA 1VQM3 1JB5A 3FSDA 3HK4A 4FR9A 1BU4A 4O02B 1VQ83 1PFPA 1TUHA 2CW9A 3NQYA 5JBSA 4QWTA 3M8CA 1OGZA 1GY5A 1IDPA 1QJGA 3L0RA 3S29A 4R1KA 3DUKA 2KF3A 2OTJ3 3J7Yd 3WA3A 1NWWA 1AY7A 1FGOA 1MGRA 1GYBA 1W6CA 3CCM3 3KCHA 1LNIA 2MC8A 1LXEA 3CCJ3 3CNXA 3BNDA 3PCSA 1X1WA 2OCTA 4LMIA 1MWUA 1GS3A 4RNYA 1D6YA 2CFGA 1O7WB 4JF8A 1MWRA 1RGEA 3CPOA 4NREA 2Y74A 4U13A 1BRSA 5D82A 1HYFA 2GEXA 4CPKA 3CCV3 3X41A 1BUQA 3DH2A 1B2UA 4H61A 4AKZA 1BNSA 2XEPA 5AYSC 1N8QA 3WOEB 1U5OA 2L1SA 5BXQA 1D6ZA 3MWZA 5AIHA 4CDLA 1B21A 3CNMA 1QAKA 1T5YA 5TGNA 1VQQA 3SLUA 4HM0B 4XM4A 5CXOA 3SX1A 1JV2B 3WDGB 5EEOA 5CF1A 1LOVA 1LVNA 2RCDA 3WODG 1FYSA 4FMAA 2YX9A 3V99A 1YI23 1BSBA 3JUMA 2ML6A 3PGBA 1BRKA 3RGRA 1K28A 1U8CB 2ZL8A 3GZXB 3DGOA 2FXTA 5LC7A 2CG1A 2OOVA 2O9UX 1OGXA 3S5CA 2RBIA 1BVIA 1Q40B 3S27A 5IEPA 1W00A 1W6YA 3EE1A 4HVNA 1K8A4 3AMOB 3MSOA 3G713 1E3VA 1DMMA 1OHOA 1ZGXA 1QVG2 4RBNA 4N6TA 3MPHA 1JZDA 3AGOA 1RGGA 1X1XA 1GSPA 1FW7A 4XBYA 1MOLA 1RGLA 4J9AA 4R9LA 1OHSA 1M9GA 4CCVA 2LQVA 1IK3A 4I4KA 5FW5A 1YVSA 4X2HA 5IW9A 2D42A 1FGTA 1T2IA 3NV0A 1JBTA 3VSYA 4J8TA 1C7HA 2I9WA 3MG1A 4L8PA 4EBGA 1GD4A 3D5GA 4LGQA 4HM4B 1I2FA 2OTL3 2H0IA 2JDIH 1ROVA 5AEWB 1VQK3 1O7PB 2M7OA 5AIGA 3GSPA 3OWUA 4XB5A 5BU4A 1ISKA 1DETA 5BIRA 4JRFA 1OUNA 3EHCA 1JRQA 1HZ1A 1NO3A 2QIYA 3PYJA 1W5ZA 4L8OA 3KSPA 5A0OB 3B4OA 5CK6A 3D4AA 1US1A 3K5TA 4ZM8A 4HZ9B 2W6JH 1TIJA 1PY3A 1RJOA 1RGKA 1EKMA 1BSDA 2RSXA 3HOHA 4KFDA 3HZPA 5EVHA 2ZDJA 3D79A 5M1AA 6GSPA 3LTBA 1LNHA 3CCE3 1ZO2A 1CEWI 1M1XB 1YNVX 3T8NA 1YJ93 3E99A 1BNJA 1FZUA 1W7CA 4HM2B 1RSNA 3BNBA 4N6V0 3OX9A 3CCS3 2CFKA 2W56B 1O7HB 3KIIA 1RN4A 2KF5A 1CYUA 2B24B 3NM2A 3KKGA 2C10A 3Q90A 3CC73 1SIHA 4R4KA 1NJI4 1IVUA 1LOWA 1LOYA 1TP6A 1V74A 1UGHI 4OVMA 4MMZB 3F7SA 5STDA 1K9M4 1AV4A 2Z77A 1M904 1RGHA 4EW5A 4FMDA 2GSPA 3D5IA 5IG3A 4FCZA 4AKYA 1Q42A 2CC3A 3EC9A 4Q53A 5AI1A 4RNZA 1V58A 1BNEA 4K1VA 2P0XA 9RNTA 1JN5B 1ULIB 1W2ZA 1RGAA 3NBBA 7GSPA 5I97A 3KSED 1KD14 3FF2A 1BRHA 3CXC2 3DM8A 4KFEA 7STDA 1O7MB 1FGQA 2FGTA 1Q824 1UCKA 1UI8A 4GHOA 3U97A 5JPUA 4O2HA 1Q814 1I8VA 1WTHA 1IV9A 3QK9A 3F8HA 5G1KA 2W9QA 1VQ63 2Z7AA 2XFSA 2CX0A 3X42A 2UUGC 5JPPA 3SVAA 1LOXA 1TFOA 4LYLB 1MNLA 3B4PA 4H3UA 2WOFA 1B20A 3BU4A 1OPYA 5EQLA 3DZLA 1GMRA 4G1MB 8RNTA 1FUWA 3NXJA 1GMQA 5D81A 4K90B 5AYRB 1AQZA 1C54A 2K54A 5KP4A 1YGEA 1R4CA 2HMLB 1EG9B 2XH9A 1JBSA 1UI7A 1A2KA 1AVLA 2HMJB 1RNBA 3LOYA 3DMCA 1QVF2 1O7NB 2W2CA 4NPBA 5G1LA 4BL3A 2F56A 2WGOA 2WGQA 1GD3A 5HGRA 4EYCA 3CU3A 3SOYA 1IQXA 1JKGB 1N9EA 2CWVA 1BRJA 2IYJA 1RN7A 3BIRA 4ORLA 1GOVA 2HMNB 2OWPA 1KC84 1IT8A 4FCMA 1TU5A 1YJW3 2JQ5A 3FH1A 3LYGA 2IUJA 2P05A 3HX8A 1OF5B 4XBXA 4HZBB 2H0GA 5BVBA 3OWYA 3WMDA 1YJN3 5IF6A 2F4YA 2BMRB 1YIJ3 1OHPA 1YHQ3 2HOHA 4WYKB 1M1K4 1E97A 4MMYB 1X1YA 1I70A 1WNHA 3BNEA 4KT3B 1BSAA 3FF0A 1BRIA 1A2VA 4EV2A 1VQ43 4HBRA 3GZRA 2Z76A 1TJDA 3K0ZA 3EF8A 3EQQB 3CCL3 3IMAB 3S28A 2YFJB 3F9SA 3QRDA 1PU4A 4OUQA 3X3XA 4N6UA 1UCJA 1YVBI 1BIRA 1MGWA 4BTXA 3NBRA 5AIFA 3X3YA 3GRDA 1OCVA 3TDGA 3CME3 3GZBA 1KSIA 1PYLA 1BNGA 1VZZA 2BT3A 3NHXA 5DREA 2OQEA 3DXOA 3ROBA 1RKYA 1JNQA 4K61A 5ELJA 3STDA 1UCIA 2QEX3 2GBWB 2XFTA 1G02A 2E2UA 1DVCA 2HMMB 5ELUA 1ZX2A 1NB5I 1I0VA 1N9JA 1Z1SA 3ZFZA 2KXGA 2L4VA 2W0QA 2XGLA 3H3HA 3K7CA 1DMNA 2OOVC 1B27A 4FMBA 1RRLA 1BUJA 1IVXA 3UB1A 1VQN3 1TRQA 2E2VA 1B2XA 2CG0A 1SJWA 3HI7A 1BAOA 1RN1A 3BNCA 3JUNA 2CHCA 3MHEA 2KF4A 3LTDA 3WOFB 2IA7A 3F8XA 1I2EA 4STDA 5IG5A 1NDOB 3UL5A 4IIAA 3FKAA 5IG0A 2F98A 2STDA 1L5GB 1UDII 1VQ73 3IPTA 3FG1A 1KQS2 2GBXB 2CIUA 3SXXA 4KZ1A 2C11A 4BTWA 3FGYA 1HU9A 1TTOA 1N8R4 1Q40A 3FG3A 4DKIA 3SYUA 2BU4A 3AMOA 3CCQ3 4HM3B 5IEOA 1W01A 4XDVA 3B7CA 1IVWA 1CH0A 1V57A 3KE7A 4EC6A 2QGUA 4HJLB 3I563 3F40A 3F7XA 1SARA 3NX0A 1GY7A 3T8UA 2Z6BA 5IENA 1WMOA 3G6E3 3RNTA 1UUWB 4OK0A 3N8BA 2BMQB 4LEHA 3CPW2 3CC23 3FCSB 4N6MA 3DY5A 3KZTA 4EXRA 3CMA3 1N5PA 3LT9A 3DGLA 4CJNA 1RCLA 4WFOA 1W4NA 3EJVA 1CYVA 4WHAA 2XRXB 3GWRA 1FA3A 1JB4A 1G96A 2ZHXB 2BIRA 2QA43 3FZWA 1A90A 3RGAA 3K9MC 2RNTA 2CX1A 4IPBA 1JBRA 3G0KA 1IVVA 1S5AA 2Q07A 1RDSA 3AHSA 3X3ZA 3OW22 1JB2A 2KRTA 4N6LA 4J5KA 1N5HA 2XSOB 1BRNL 3EN8A 3LTAA 3VF1A 1BNFA 4GL6A 3G8ZA 4RZMA 1I3IA 5LC6A 1QMAA 1LQMB 2IY2A 4N6NB 1T2HA 1RGCA 3HIGA 1Q9EA 1RGFA 4R9KA
chains in the Genus database with same CATH topology
3FG4A 3OWSA 5KP3A 4MMXB 1VQ53 3H51A 4PEJA 1IU7A 4HM6B 4TX4A 1QALA 2KCDA 4MJDA 1Y4KA 3LT8A 1OH0A 3UJMA 3LTCA 2W56A 2P0MA 4X2OA 1SQWA 3EN1B 2GU1A 5AEUB 5D83A 1D6UA 3JUOA 1ROAA 1KWIA 3S67A 1TFKA 3OXAA 4IT7A 5KP1A 3PZWA 4LZIA 1STDA 3VGNA 4AEQA 2WOHA 1AR0A 1JN5A 5DRVA 1E3RA 1WMNA 2SBLA 5IERA 2GXFA 4WP5A 2F99A 3ECFA 3JUQA 3PS8A 3I553 4XBTA 2BO9B 1STFI 1GY6A 3NQZA 2GU3A 1ASKA 1DMQA 1HKXA 1SPUA 2XF3A 2W04A 4O3VA 4EV5A 3NBJA 5IG4A 3O8YA 5AIIA 3BB9A 3EBYA 3NV0B 3N9HA 1AVKA 2FNQA 3N54B 3LXUX 4WWUC 1VQP3 2WO0A 3KFQC 3KN4A 2XGNA 3EX9A 2V1LA 1QAFA 3JUPA 1VQ93 3NUVA 3LH4A 2PZVA 3PCRA 2B1XB 4N6OB 1DYUA 2IMJA 3UL6A 4KFFA 3G4S3 3ALAA 3MYTA 1UW1A 2CWTA 1F8NA 1JKGA 2XR8B 4GB5A 3MKIA 3BLZA 2R4IA 3B8LA 1VQO3 2UX0A 1YIT3 2CWUA 2HMOB 3I0YA 1OF5A 1WMPA 2BHMA 3UNLA 2GEYA 2K0MA 3F14A 4MEIA 1DVDA 2CFDA 3SOAA 1W02A 3WA2X 1J2BA 3DGNA 3LMLA 1O7GB 1CQSA 4WYKA 2P09A 3FLJA 2W03A 2D1WA 2OQEC 3MG2A 1Q7Y4 4LSOA 1ULJB 2YFLB 1K734 2E2TA 3K63A 3LZAA 4BTYA 3ER7A 1RRHA 2IUKA 1NB3I 4FMCA 2RFRA 3D3LA 1JJ22 2A15A 2BNGA 2W9PA 3EB8A 3A76A 3CC43 1IV7A 4XDWA 3GZYB 3DGMA 3JVCA 1W6GA 3NM7A 3G16A 4HM7B 1K41A 3Q1CA 4R80A 2O3OA 4K1UA 2RGQA 1EA2A 4NHFA 3CD63 4O8SA 1Q864 3OV4A 1A67A 3X40A 1WQLB 4N3VA 1FGRA 3CCU3 2Y73A 2XSHB 4HM5B 3V98A 4L7KA 2P38A 3PXMA 5CLKA 3RDEA 5CF2A 2F86B 3T0UA 2CK3H 1SIIA 2CFWA 2ML5A 5G2GA 3GAXA 1FGMA 4KVHA 1IQYA 1IT7A 3U1WA 5FGOA 1UUVB 2INXA 4HM8B 1IQ8A 1OACA 3D9RA 2HMKB 3V92A 1NU3A 2PNCA 4FCJA 4HYZA 2LYXA 3MG3A 3Q2PA 3EBTA 2MF7A 1VQL3 2CFLA 6STDA 1W2B2 4HKVB 4HM1B 2YFIB 2CH9A 1S723 8CHOA 3SEDA 1EQKA 2CKFB 2BMOB 3HIIA 3IJEB 3CCR3 1VQM3 1JB5A 3FSDA 3HK4A 4FR9A 4O02B 1VQ83 1PFPA 1TUHA 2CW9A 3NQYA 5JBSA 4QWTA 3M8CA 1OGZA 1IDPA 1GY5A 1QJGA 3L0RA 3S29A 4R1KA 3DUKA 2OTJ3 3J7Yd 3WA3A 1NWWA 1FGOA 1W6CA 1GYBA 3CCM3 2MC8A 1LXEA 3CCJ3 3CNXA 3BNDA 3PCSA 4LMIA 2OCTA 4RNYA 1GS3A 1D6YA 2CFGA 1O7WB 4JF8A 4NREA 4U13A 3CPOA 5D82A 2Y74A 3STDA 5IG3A 2GEXA 3CCV3 3X41A 1BUQA 4H61A 4AKZA 2XEPA 5AYSC 1N8QA 3WOEB 1U5OA 5BXQA 1D6ZA 3MWZA 5AIHA 4CDLA 3CNMA 1QAKA 1T5YA 5TGNA 3SLUA 4HM0B 4XM4A 5CXOA 3SX1A 1JV2B 3WDGB 5EEOA 5CF1A 1LVNA 2RCDA 3WODG 4FMAA 2YX9A 3V99A 1YI23 3JUMA 2ML6A 3PGBA 3RGRA 1K28A 2ZL8A 1U8CB 3GZXB 3DGOA 2FXTA 5LC7A 2CG1A 2OOVA 2O9UX 1OGXA 3S5CA 1Q40B 3S27A 5IEPA 1W00A 1W6YA 3EE1A 4HVNA 1K8A4 3AMOB 3MSOA 3G713 1E3VA 1DMMA 1OHOA 1QVG2 4RBNA 4N6TA 3MPHA 4XBYA 1MOLA 4J9AA 4R9LA 1OHSA 1M9GA 4CCVA 2LQVA 1IK3A 4I4KA 5FW5A 4X2HA 5IW9A 2D42A 1FGTA 3NV0A 3VSYA 4J8TA 1C7HA 2I9WA 3MG1A 4L8PA 4EBGA 1GD4A 4LGQA 4HM4B 2OTL3 2JDIH 1ROVA 5AEWB 1VQK3 1O7PB 2M7OA 5AIGA 3OWUA 4XB5A 1ISKA 4JRFA 1OUNA 3EHCA 1JRQA 2QIYA 1NO3A 3PYJA 1W5ZA 4L8OA 3KSPA 5A0OB 3B4OA 5CK6A 1US1A 3K5TA 4ZM8A 4HZ9B 2W6JH 1TIJA 1RJOA 1EKMA 4KFDA 2RSXA 3HZPA 5EVHA 2ZDJA 3LTBA 1LNHA 3CCE3 1ZO2A 1CEWI 1M1XB 3T8NA 1YJ93 3E99A 1W7CA 4HM2B 3BNBA 4N6V0 3OX9A 3CCS3 2CFKA 2W56B 1O7HB 3KIIA 1CYUA 2B24B 3NM2A 3KKGA 2C10A 3Q90A 3CC73 1SIHA 4R4KA 1NJI4 1IVUA 1TP6A 1V74A 4OVMA 4MMZB 3F7SA 5STDA 1K9M4 1AV4A 2Z77A 1M904 4FMDA 4FCZA 4AKYA 1Q42A 2CC3A 3EC9A 4Q53A 5AI1A 4RNZA 4K1VA 2P0XA 1JN5B 1ULIB 1W2ZA 3NBBA 5I97A 3KSED 1KD14 3FF2A 3CXC2 3DM8A 4KFEA 7STDA 1O7MB 1FGQA 2FGTA 1Q824 1UI8A 3U97A 5JPUA 4O2HA 1Q814 1WTHA 1IV9A 3QK9A 3F8HA 2W9QA 1VQ63 2Z7AA 2XFSA 3X42A 5JPPA 3SVAA 1LOXA 1TFOA 1MNLA 3B4PA 4H3UA 2WOFA 1OPYA 5EQLA 3DZLA 4G1MB 1FUWA 3NXJA 5D81A 4K90B 5AYRB 2K54A 5KP4A 1YGEA 1R4CA 2HMLB 1EG9B 2XH9A 1UI7A 1A2KA 1AVLA 2HMJB 3LOYA 3DMCA 1QVF2 1O7NB 2W2CA 2WGOA 2WGQA 1GD3A 5HGRA 4EYCA 3CU3A 3SOYA 1IQXA 1JKGB 1N9EA 2CWVA 1RN7A 1KC84 4ORLA 2HMNB 2OWPA 1IT8A 4FCMA 1TU5A 1YJW3 2JQ5A 3FH1A 3LYGA 2IUJA 2P05A 3HX8A 1OF5B 4XBXA 4HZBB 5BVBA 3OWYA 3WMDA 1YJN3 5IF6A 2BMRB 1YIJ3 1OHPA 1YHQ3 4WYKB 1M1K4 1E97A 4MMYB 1WNHA 3BNEA 3FF0A 1A2VA 4EV2A 1VQ43 4HBRA 3GZRA 2Z76A 3K0ZA 3EF8A 3EQQB 3CCL3 3IMAB 3S28A 2YFJB 3F9SA 3QRDA 1PU4A 4OUQA 3X3XA 4N6UA 1YVBI 4BTXA 3NBRA 5AIFA 3X3YA 3GRDA 1OCVA 3TDGA 3CME3 3GZBA 1KSIA 1VZZA 2BT3A 3NHXA 2OQEA 5DREA 3DXOA 3ROBA 1RKYA 1JNQA 4K61A 5ELJA 2QEX3 2GBWB 2XFTA 2E2UA 1DVCA 2HMMB 5ELUA 1ZX2A 1NB5I 1N9JA 1Z1SA 2KXGA 2L4VA 2W0QA 2XGLA 3H3HA 3K7CA 1DMNA 2OOVC 4FMBA 1RRLA 1IVXA 3UB1A 1VQN3 2E2VA 3HI7A 2CG0A 1SJWA 3MHEA 3JUNA 3WOFB 3BNCA 2CHCA 3LTDA 2IA7A 3F8XA 4STDA 5IG5A 1NDOB 3UL5A 4IIAA 3FKAA 5IG0A 2F98A 2STDA 1L5GB 1VQ73 3IPTA 3FG1A 1KQS2 2GBXB 2CIUA 3SXXA 4KZ1A 2C11A 4BTWA 3FGYA 1HU9A 1Q40A 3FG3A 3AMOA 3CCQ3 4HM3B 5IEOA 1W01A 4XDVA 3B7CA 1IVWA 3KE7A 4EC6A 2QGUA 4HJLB 3I563 3F40A 3F7XA 3NX0A 1GY7A 3T8UA 2Z6BA 5IENA 1WMOA 3G6E3 1UUWB 4OK0A 3N8BA 2BMQB 4LEHA 3CPW2 3CC23 3FCSB 4N6MA 3DY5A 3KZTA 4EXRA 3CMA3 1N5PA 3LT9A 3DGLA 4WFOA 1W4NA 3EJVA 1CYVA 4WHAA 2XRXB 3GWRA 1FA3A 1JB4A 1G96A 2QA43 3FZWA 1A90A 3RGAA 3K9MC 4IPBA 3G0KA 1IVVA 1S5AA 2Q07A 3X3ZA 3OW22 1JB2A 2KRTA 4N6LA 1N5HA 2XSOB 3EN8A 3LTAA 3VF1A 4RZMA 4GL6A 3G8ZA 5LC6A 1QMAA 4N6NB 1N8R4 3HIGA 4R9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOL A;  1M9G A;  1A67 A;  4CCV A;  4TX4 A;  1GD4 A;  3PXM A;  1WNH A;  1ROA A;  1KWI A;  3S67 A;  3IMA B;  4IT7 A;  3QRD A;  3GAX A;  4LZI A;  4N6U A;  1YVB I;  3PYJ A;  5A0O B;  4ZM8 A;  5ELJ A;  1TIJ A;  3Q2P A;  5ELU A;  1DVC A;  1NB5 I;  3PS8 A;  1N9J A;  2BO9 B;  1STF I;  2KXG A;  2CH9 A;  1CEW I;  1EQK A;  4N6V 0;  1PFP A;  3UL5 A;  3KFQ C;  1CYU A;  3L0R A;  3LH4 A;  4N6O B;  1LXE A;  3UL6 A;  2OCT A;  3KSE D;  3NX0 A;  1DVD A;  3MWZ A;  1IV9 A;  2W9Q A;  4N6M A;  1N5P A;  3SVA A;  1MNL A;  1CYV A;  5EQL A;  1FA3 A;  1G96 A;  1FUW A;  1A90 A;  3K9M C;  1NB3 I;  1R4C A;  5LC7 A;  2O9U X;  4N6L A;  2W9P A;  1N5H A;  1GD3 A;  1IV7 A;  4EYC A;  5LC6 A;  1RN7 A;  4N6T A;  4N6N B; 
#chains in the Genus database with same CATH topology
 1ZS7 A;  3FG4 A;  3OWS A;  5KP3 A;  4MMX B;  1VQ5 3;  4HAA A;  3H51 A;  4PEJ A;  1IU7 A;  4HM6 B;  4TX4 A;  1QAL A;  2KCD A;  1RCK A;  1MWT A;  4MJD A;  1Y4K A;  3LT8 A;  1OH0 A;  3UJM A;  3LTC A;  2W56 A;  2P0M A;  4X2O A;  1JZO A;  2K3D A;  1I3F A;  1SQW A;  3EN1 B;  2GU1 A;  5AEU B;  1RLS A;  5D83 A;  2UGI A;  1D6U A;  3JUO A;  1ROA A;  5HOH A;  1KWI A;  1GOY A;  2R41 A;  1LRA A;  1X1U A;  3S67 A;  1TFK A;  3OXA A;  4IT7 A;  5KP1 A;  1Q7H A;  3PZW A;  4LZI A;  1STD A;  3VGN A;  4AEQ A;  2C4B A;  2WOH A;  5M19 A;  4BIR A;  1AR0 A;  1JN5 A;  3A5E A;  5DRV A;  2KAA A;  1E3R A;  3ZG5 A;  3WR2 A;  1BSE A;  1WMN A;  2SBL A;  5IER A;  1BAN A;  1NNV A;  2GXF A;  4WP5 A;  2F99 A;  3ECF A;  3JUQ A;  3PS8 A;  3I55 3;  4XBT A;  1BOX A;  2BO9 B;  1STF I;  1GY6 A;  3NQZ A;  2GU3 A;  2AAD A;  1ASK A;  1DMQ A;  1HKX A;  1SPU A;  2W04 A;  2XF3 A;  1FUT A;  3AGN A;  3NBJ A;  4O3V A;  4EV5 A;  5IG4 A;  3O8Y A;  5AII A;  3BB9 A;  1B3S A;  3EBY A;  3NV0 B;  3N9H A;  1AVK A;  2FNQ A;  3N54 B;  3LXU X;  4WWU C;  1I2G A;  2WO0 A;  1VQP 3;  1R4Y A;  1I0X A;  3KFQ C;  3KN4 A;  2XGN A;  3EX9 A;  2V1L A;  1BGS A;  1QAF A;  3JUP A;  1VQ9 3;  3NUV A;  3LH4 A;  4ILF A;  3DGY A;  2PZV A;  3PCR A;  2B1X B;  4N6O B;  2SAR A;  1DYU A;  6RNT A;  2IMJ A;  1RMS A;  3AHW A;  3UL6 A;  4KFF A;  3G4S 3;  3ALA A;  3MYT A;  1UW1 A;  2CWT A;  1F8N A;  1JKG A;  2XR8 B;  4GB5 A;  2F5M A;  3MKI A;  2J8X B;  3BLZ A;  2R4I A;  3B8L A;  1VQO 3;  2AAE A;  2UX0 A;  1YIT 3;  2CWU A;  2HMO B;  3I0Y A;  1OF5 A;  1WMP A;  2BHM A;  3UNL A;  2GEY A;  2K0M A;  3F14 A;  4MEI A;  1DVD A;  2CFD A;  3SOA A;  1W02 A;  3WA2 X;  1J2B A;  3DGN A;  3LML A;  1EUI C;  1O7G B;  1CQS A;  1UUG B;  1BNI A;  4WYK A;  5M18 A;  1EEJ A;  2P09 A;  3FLJ A;  1LQG C;  2W03 A;  2D1W A;  2OQE C;  3MG2 A;  1UCL A;  1Q7Y 4;  4HOH A;  1IYY A;  4LSO A;  1ULJ B;  2YFL B;  1K73 4;  1RTU A;  2E2T A;  3K63 A;  3LZA A;  4BTY A;  3ER7 A;  1RRH A;  2IUK A;  1NB3 I;  4FMC A;  2RFR A;  3D3L A;  1JJ2 2;  2KF6 A;  2A15 A;  4BU4 A;  2BNG A;  2W9P A;  3EB8 A;  3A76 A;  1TRP A;  5RNT A;  3URP A;  3CC4 3;  1IV7 A;  4XDW A;  1RHL A;  3GZY B;  4J5G A;  3DGM A;  3JVC A;  1W6G A;  3NM7 A;  3G16 A;  4HM7 B;  1RNT A;  1K41 A;  3Q1C A;  3Q3F A;  4R80 A;  2O3O A;  4K1U A;  2RGQ A;  5GSP A;  1EA2 A;  3ZG0 A;  4NHF A;  3CD6 3;  4O8S A;  1Q86 4;  3OV4 A;  1A67 A;  3X40 A;  1WQL B;  4N3V A;  1FUS A;  4RNT A;  1FGR A;  1A2P A;  1YGW A;  1BNR A;  3CCU 3;  2Y73 A;  2XSH B;  4HM5 B;  3V98 A;  4L7K A;  2P38 A;  3PXM A;  1B2S A;  4I5Q A;  5CLK A;  3RDE A;  1BRG A;  1T3B A;  2F86 B;  5CF2 A;  3T0U A;  2CK3 H;  1SII A;  2CFW A;  2ML5 A;  5G2G A;  1GMP A;  7RNT A;  3GAX A;  1B2M A;  1FGM A;  4KVH A;  1IQY A;  1IT7 A;  3U1W A;  1BSC A;  5FGO A;  1UUV B;  1B2Z A;  2H0H A;  2INX A;  4HM8 B;  1IQ8 A;  4BL2 A;  1OAC A;  3D9R A;  2HMK B;  3V92 A;  1NU3 A;  2PNC A;  4FCJ A;  4HYZ A;  2LYX A;  3MG3 A;  3Q2P A;  1DE3 A;  3EBT A;  2MF7 A;  1VQL 3;  2CFL A;  4GSP A;  6STD A;  4HKV B;  1GOU A;  4HM1 B;  1W2B 2;  1MWS A;  2YFI B;  1UGI A;  2CH9 A;  2ZA4 A;  1S72 3;  8CHO A;  3WHO A;  2F5W A;  3SED A;  1EQK A;  2CKF B;  2BMO B;  3HII A;  3IJE B;  3CCR 3;  1G0T A;  1VQM 3;  1JB5 A;  3FSD A;  3HK4 A;  4FR9 A;  1BU4 A;  4O02 B;  1VQ8 3;  1PFP A;  1TUH A;  2CW9 A;  3NQY A;  5JBS A;  4QWT A;  3M8C A;  1OGZ A;  1GY5 A;  1IDP A;  1QJG A;  3L0R A;  3S29 A;  4R1K A;  3DUK A;  2KF3 A;  2OTJ 3;  3J7Y d;  3WA3 A;  1NWW A;  1AY7 A;  1FGO A;  1MGR A;  1GYB A;  1W6C A;  3CCM 3;  3KCH A;  1LNI A;  2MC8 A;  1LXE A;  3CCJ 3;  3CNX A;  3BND A;  3PCS A;  1X1W A;  2OCT A;  4LMI A;  1MWU A;  1GS3 A;  4RNY A;  1D6Y A;  2CFG A;  1O7W B;  4JF8 A;  1MWR A;  1RGE A;  3CPO A;  4NRE A;  2Y74 A;  4U13 A;  1BRS A;  5D82 A;  1HYF A;  2GEX A;  4CPK A;  3CCV 3;  3X41 A;  1BUQ A;  3DH2 A;  1B2U A;  4H61 A;  4AKZ A;  1BNS A;  2XEP A;  5AYS C;  1N8Q A;  3WOE B;  1U5O A;  2L1S A;  5BXQ A;  1D6Z A;  3MWZ A;  5AIH A;  4CDL A;  1B21 A;  3CNM A;  1QAK A;  1T5Y A;  5TGN A;  1VQQ A;  3SLU A;  4HM0 B;  4XM4 A;  5CXO A;  3SX1 A;  1JV2 B;  3WDG B;  5EEO A;  5CF1 A;  1LOV A;  1LVN A;  2RCD A;  3WOD G;  1FYS A;  4FMA A;  2YX9 A;  3V99 A;  1YI2 3;  1BSB A;  3JUM A;  2ML6 A;  3PGB A;  1BRK A;  3RGR A;  1K28 A;  1U8C B;  2ZL8 A;  3GZX B;  3DGO A;  2FXT A;  5LC7 A;  2CG1 A;  2OOV A;  2O9U X;  1OGX A;  3S5C A;  2RBI A;  1BVI A;  1Q40 B;  3S27 A;  5IEP A;  1W00 A;  1W6Y A;  3EE1 A;  4HVN A;  1K8A 4;  3AMO B;  3MSO A;  3G71 3;  1E3V A;  1DMM A;  1OHO A;  1ZGX A;  1QVG 2;  4RBN A;  4N6T A;  3MPH A;  1JZD A;  3AGO A;  1RGG A;  1X1X A;  1GSP A;  1FW7 A;  4XBY A;  1MOL A;  1RGL A;  4J9A A;  4R9L A;  1OHS A;  1M9G A;  4CCV A;  2LQV A;  1IK3 A;  4I4K A;  5FW5 A;  1YVS A;  4X2H A;  5IW9 A;  2D42 A;  1FGT A;  1T2I A;  3NV0 A;  1JBT A;  3VSY A;  4J8T A;  1C7H A;  2I9W A;  3MG1 A;  4L8P A;  4EBG A;  1GD4 A;  3D5G A;  4LGQ A;  4HM4 B;  1I2F A;  2OTL 3;  2H0I A;  2JDI H;  1ROV A;  5AEW B;  1VQK 3;  1O7P B;  2M7O A;  5AIG A;  3GSP A;  3OWU A;  4XB5 A;  5BU4 A;  1ISK A;  1DET A;  5BIR A;  4JRF A;  1OUN A;  3EHC A;  1JRQ A;  1HZ1 A;  1NO3 A;  2QIY A;  3PYJ A;  1W5Z A;  4L8O A;  3KSP A;  5A0O B;  3B4O A;  5CK6 A;  3D4A A;  1US1 A;  3K5T A;  4ZM8 A;  4HZ9 B;  2W6J H;  1TIJ A;  1PY3 A;  1RJO A;  1RGK A;  1EKM A;  1BSD A;  2RSX A;  3HOH A;  4KFD A;  3HZP A;  5EVH A;  2ZDJ A;  3D79 A;  5M1A A;  6GSP A;  3LTB A;  1LNH A;  3CCE 3;  1ZO2 A;  1CEW I;  1M1X B;  1YNV X;  3T8N A;  1YJ9 3;  3E99 A;  1BNJ A;  1FZU A;  1W7C A;  4HM2 B;  1RSN A;  3BNB A;  4N6V 0;  3OX9 A;  3CCS 3;  2CFK A;  2W56 B;  1O7H B;  3KII A;  1RN4 A;  2KF5 A;  1CYU A;  2B24 B;  3NM2 A;  3KKG A;  2C10 A;  3Q90 A;  3CC7 3;  1SIH A;  4R4K A;  1NJI 4;  1IVU A;  1LOW A;  1LOY A;  1TP6 A;  1V74 A;  1UGH I;  4OVM A;  4MMZ B;  3F7S A;  5STD A;  1K9M 4;  1AV4 A;  2Z77 A;  1M90 4;  1RGH A;  4EW5 A;  4FMD A;  2GSP A;  3D5I A;  5IG3 A;  4FCZ A;  4AKY A;  1Q42 A;  2CC3 A;  3EC9 A;  4Q53 A;  5AI1 A;  4RNZ A;  1V58 A;  1BNE A;  4K1V A;  2P0X A;  9RNT A;  1JN5 B;  1ULI B;  1W2Z A;  1RGA A;  3NBB A;  7GSP A;  5I97 A;  3KSE D;  1KD1 4;  3FF2 A;  1BRH A;  3CXC 2;  3DM8 A;  4KFE A;  7STD A;  1O7M B;  1FGQ A;  2FGT A;  1Q82 4;  1UCK A;  1UI8 A;  4GHO A;  3U97 A;  5JPU A;  4O2H A;  1Q81 4;  1I8V A;  1WTH A;  1IV9 A;  3QK9 A;  3F8H A;  5G1K A;  2W9Q A;  1VQ6 3;  2Z7A A;  2XFS A;  2CX0 A;  3X42 A;  2UUG C;  5JPP A;  3SVA A;  1LOX A;  1TFO A;  4LYL B;  1MNL A;  3B4P A;  4H3U A;  2WOF A;  1B20 A;  3BU4 A;  1OPY A;  5EQL A;  3DZL A;  1GMR A;  4G1M B;  8RNT A;  1FUW A;  3NXJ A;  1GMQ A;  5D81 A;  4K90 B;  5AYR B;  1AQZ A;  1C54 A;  2K54 A;  5KP4 A;  1YGE A;  1R4C A;  2HML B;  1EG9 B;  2XH9 A;  1JBS A;  1UI7 A;  1A2K A;  1AVL A;  2HMJ B;  1RNB A;  3LOY A;  3DMC A;  1QVF 2;  1O7N B;  2W2C A;  4NPB A;  5G1L A;  4BL3 A;  2F56 A;  2WGO A;  2WGQ A;  1GD3 A;  5HGR A;  4EYC A;  3CU3 A;  3SOY A;  1IQX A;  1JKG B;  1N9E A;  2CWV A;  1BRJ A;  2IYJ A;  1RN7 A;  3BIR A;  4ORL A;  1GOV A;  2HMN B;  2OWP A;  1KC8 4;  1IT8 A;  4FCM A;  1TU5 A;  1YJW 3;  2JQ5 A;  3FH1 A;  3LYG A;  2IUJ A;  2P05 A;  3HX8 A;  1OF5 B;  4XBX A;  4HZB B;  2H0G A;  5BVB A;  3OWY A;  3WMD A;  1YJN 3;  5IF6 A;  2F4Y A;  2BMR B;  1YIJ 3;  1OHP A;  1YHQ 3;  2HOH A;  4WYK B;  1M1K 4;  1E97 A;  4MMY B;  1X1Y A;  1I70 A;  1WNH A;  3BNE A;  4KT3 B;  1BSA A;  3FF0 A;  1BRI A;  1A2V A;  4EV2 A;  1VQ4 3;  4HBR A;  3GZR A;  2Z76 A;  1TJD A;  3K0Z A;  3EF8 A;  3EQQ B;  3CCL 3;  3IMA B;  3S28 A;  2YFJ B;  3F9S A;  3QRD A;  1PU4 A;  4OUQ A;  3X3X A;  4N6U A;  1UCJ A;  1YVB I;  1BIR A;  1MGW A;  4BTX A;  3NBR A;  5AIF A;  3X3Y A;  3GRD A;  1OCV A;  3TDG A;  3CME 3;  3GZB A;  1KSI A;  1PYL A;  1BNG A;  1VZZ A;  2BT3 A;  3NHX A;  5DRE A;  2OQE A;  3DXO A;  3ROB A;  1RKY A;  1JNQ A;  4K61 A;  5ELJ A;  3STD A;  1UCI A;  2QEX 3;  2GBW B;  2XFT A;  1G02 A;  2E2U A;  1DVC A;  2HMM B;  5ELU A;  1ZX2 A;  1NB5 I;  1I0V A;  1N9J A;  1Z1S A;  3ZFZ A;  2KXG A;  2L4V A;  2W0Q A;  2XGL A;  3H3H A;  3K7C A;  1DMN A;  2OOV C;  1B27 A;  4FMB A;  1RRL A;  1BUJ A;  1IVX A;  3UB1 A;  1VQN 3;  1TRQ A;  2E2V A;  1B2X A;  2CG0 A;  1SJW A;  3HI7 A;  1BAO A;  1RN1 A;  3BNC A;  3JUN A;  2CHC A;  3MHE A;  2KF4 A;  3LTD A;  3WOF B;  2IA7 A;  3F8X A;  1I2E A;  4STD A;  5IG5 A;  1NDO B;  3UL5 A;  4IIA A;  3FKA A;  5IG0 A;  2F98 A;  2STD A;  1L5G B;  1UDI I;  1VQ7 3;  3IPT A;  3FG1 A;  1KQS 2;  2GBX B;  2CIU A;  3SXX A;  4KZ1 A;  2C11 A;  4BTW A;  3FGY A;  1HU9 A;  1TTO A;  1N8R 4;  1Q40 A;  3FG3 A;  4DKI A;  3SYU A;  2BU4 A;  3AMO A;  3CCQ 3;  4HM3 B;  5IEO A;  1W01 A;  4XDV A;  3B7C A;  1IVW A;  1CH0 A;  1V57 A;  3KE7 A;  4EC6 A;  2QGU A;  4HJL B;  3I56 3;  3F40 A;  3F7X A;  1SAR A;  3NX0 A;  1GY7 A;  3T8U A;  2Z6B A;  5IEN A;  1WMO A;  3G6E 3;  3RNT A;  1UUW B;  4OK0 A;  3N8B A;  2BMQ B;  4LEH A;  3CPW 2;  3CC2 3;  3FCS B;  4N6M A;  3DY5 A;  3KZT A;  4EXR A;  3CMA 3;  1N5P A;  3LT9 A;  3DGL A;  4CJN A;  1RCL A;  4WFO A;  1W4N A;  3EJV A;  1CYV A;  4WHA A;  2XRX B;  3GWR A;  1FA3 A;  1JB4 A;  1G96 A;  2ZHX B;  2BIR A;  2QA4 3;  3FZW A;  1A90 A;  3RGA A;  3K9M C;  2RNT A;  2CX1 A;  4IPB A;  1JBR A;  3G0K A;  1IVV A;  1S5A A;  2Q07 A;  1RDS A;  3AHS A;  3X3Z A;  3OW2 2;  1JB2 A;  2KRT A;  4N6L A;  4J5K A;  1N5H A;  2XSO B;  1BRN L;  3EN8 A;  3LTA A;  3VF1 A;  1BNF A;  4GL6 A;  3G8Z A;  4RZM A;  1I3I A;  5LC6 A;  1QMA A;  1LQM B;  2IY2 A;  4N6N B;  1T2H A;  1RGC A;  3HIG A;  1Q9E A;  1RGF A;  4R9K A; 
#chains in the Genus database with same CATH homology
 3FG4 A;  3OWS A;  5KP3 A;  4MMX B;  1VQ5 3;  3H51 A;  4PEJ A;  1IU7 A;  4HM6 B;  4TX4 A;  1QAL A;  2KCD A;  4MJD A;  1Y4K A;  3LT8 A;  1OH0 A;  3UJM A;  3LTC A;  2W56 A;  2P0M A;  4X2O A;  1SQW A;  3EN1 B;  2GU1 A;  5AEU B;  5D83 A;  1D6U A;  3JUO A;  1ROA A;  1KWI A;  3S67 A;  1TFK A;  3OXA A;  4IT7 A;  5KP1 A;  3PZW A;  4LZI A;  1STD A;  3VGN A;  4AEQ A;  2WOH A;  1AR0 A;  1JN5 A;  5DRV A;  1E3R A;  1WMN A;  2SBL A;  5IER A;  2GXF A;  4WP5 A;  2F99 A;  3ECF A;  3JUQ A;  3PS8 A;  3I55 3;  4XBT A;  2BO9 B;  1STF I;  1GY6 A;  3NQZ A;  2GU3 A;  1ASK A;  1DMQ A;  1HKX A;  1SPU A;  2XF3 A;  2W04 A;  4O3V A;  4EV5 A;  3NBJ A;  5IG4 A;  3O8Y A;  5AII A;  3BB9 A;  3EBY A;  3NV0 B;  3N9H A;  1AVK A;  2FNQ A;  3N54 B;  3LXU X;  4WWU C;  1VQP 3;  2WO0 A;  3KFQ C;  3KN4 A;  2XGN A;  3EX9 A;  2V1L A;  1QAF A;  3JUP A;  1VQ9 3;  3NUV A;  3LH4 A;  2PZV A;  3PCR A;  2B1X B;  4N6O B;  1DYU A;  2IMJ A;  3UL6 A;  4KFF A;  3G4S 3;  3ALA A;  3MYT A;  1UW1 A;  2CWT A;  1F8N A;  1JKG A;  2XR8 B;  4GB5 A;  3MKI A;  3BLZ A;  2R4I A;  3B8L A;  1VQO 3;  2UX0 A;  1YIT 3;  2CWU A;  2HMO B;  3I0Y A;  1OF5 A;  1WMP A;  2BHM A;  3UNL A;  2GEY A;  2K0M A;  3F14 A;  4MEI A;  1DVD A;  2CFD A;  3SOA A;  1W02 A;  3WA2 X;  1J2B A;  3DGN A;  3LML A;  1O7G B;  1CQS A;  4WYK A;  2P09 A;  3FLJ A;  2W03 A;  2D1W A;  2OQE C;  3MG2 A;  1Q7Y 4;  4LSO A;  1ULJ B;  2YFL B;  1K73 4;  2E2T A;  3K63 A;  3LZA A;  4BTY A;  3ER7 A;  1RRH A;  2IUK A;  1NB3 I;  4FMC A;  2RFR A;  3D3L A;  1JJ2 2;  2A15 A;  2BNG A;  2W9P A;  3EB8 A;  3A76 A;  3CC4 3;  1IV7 A;  4XDW A;  3GZY B;  3DGM A;  3JVC A;  1W6G A;  3NM7 A;  3G16 A;  4HM7 B;  1K41 A;  3Q1C A;  4R80 A;  2O3O A;  4K1U A;  2RGQ A;  1EA2 A;  4NHF A;  3CD6 3;  4O8S A;  1Q86 4;  3OV4 A;  1A67 A;  3X40 A;  1WQL B;  4N3V A;  1FGR A;  3CCU 3;  2Y73 A;  2XSH B;  4HM5 B;  3V98 A;  4L7K A;  2P38 A;  3PXM A;  5CLK A;  3RDE A;  5CF2 A;  2F86 B;  3T0U A;  2CK3 H;  1SII A;  2CFW A;  2ML5 A;  5G2G A;  3GAX A;  1FGM A;  4KVH A;  1IQY A;  1IT7 A;  3U1W A;  5FGO A;  1UUV B;  2INX A;  4HM8 B;  1IQ8 A;  1OAC A;  3D9R A;  2HMK B;  3V92 A;  1NU3 A;  2PNC A;  4FCJ A;  4HYZ A;  2LYX A;  3MG3 A;  3Q2P A;  3EBT A;  2MF7 A;  1VQL 3;  2CFL A;  6STD A;  1W2B 2;  4HKV B;  4HM1 B;  2YFI B;  2CH9 A;  1S72 3;  8CHO A;  3SED A;  1EQK A;  2CKF B;  2BMO B;  3HII A;  3IJE B;  3CCR 3;  1VQM 3;  1JB5 A;  3FSD A;  3HK4 A;  4FR9 A;  4O02 B;  1VQ8 3;  1PFP A;  1TUH A;  2CW9 A;  3NQY A;  5JBS A;  4QWT A;  3M8C A;  1OGZ A;  1IDP A;  1GY5 A;  1QJG A;  3L0R A;  3S29 A;  4R1K A;  3DUK A;  2OTJ 3;  3J7Y d;  3WA3 A;  1NWW A;  1FGO A;  1W6C A;  1GYB A;  3CCM 3;  2MC8 A;  1LXE A;  3CCJ 3;  3CNX A;  3BND A;  3PCS A;  4LMI A;  2OCT A;  4RNY A;  1GS3 A;  1D6Y A;  2CFG A;  1O7W B;  4JF8 A;  4NRE A;  4U13 A;  3CPO A;  5D82 A;  2Y74 A;  3STD A;  5IG3 A;  2GEX A;  3CCV 3;  3X41 A;  1BUQ A;  4H61 A;  4AKZ A;  2XEP A;  5AYS C;  1N8Q A;  3WOE B;  1U5O A;  5BXQ A;  1D6Z A;  3MWZ A;  5AIH A;  4CDL A;  3CNM A;  1QAK A;  1T5Y A;  5TGN A;  3SLU A;  4HM0 B;  4XM4 A;  5CXO A;  3SX1 A;  1JV2 B;  3WDG B;  5EEO A;  5CF1 A;  1LVN A;  2RCD A;  3WOD G;  4FMA A;  2YX9 A;  3V99 A;  1YI2 3;  3JUM A;  2ML6 A;  3PGB A;  3RGR A;  1K28 A;  2ZL8 A;  1U8C B;  3GZX B;  3DGO A;  2FXT A;  5LC7 A;  2CG1 A;  2OOV A;  2O9U X;  1OGX A;  3S5C A;  1Q40 B;  3S27 A;  5IEP A;  1W00 A;  1W6Y A;  3EE1 A;  4HVN A;  1K8A 4;  3AMO B;  3MSO A;  3G71 3;  1E3V A;  1DMM A;  1OHO A;  1QVG 2;  4RBN A;  4N6T A;  3MPH A;  4XBY A;  1MOL A;  4J9A A;  4R9L A;  1OHS A;  1M9G A;  4CCV A;  2LQV A;  1IK3 A;  4I4K A;  5FW5 A;  4X2H A;  5IW9 A;  2D42 A;  1FGT A;  3NV0 A;  3VSY A;  4J8T A;  1C7H A;  2I9W A;  3MG1 A;  4L8P A;  4EBG A;  1GD4 A;  4LGQ A;  4HM4 B;  2OTL 3;  2JDI H;  1ROV A;  5AEW B;  1VQK 3;  1O7P B;  2M7O A;  5AIG A;  3OWU A;  4XB5 A;  1ISK A;  4JRF A;  1OUN A;  3EHC A;  1JRQ A;  2QIY A;  1NO3 A;  3PYJ A;  1W5Z A;  4L8O A;  3KSP A;  5A0O B;  3B4O A;  5CK6 A;  1US1 A;  3K5T A;  4ZM8 A;  4HZ9 B;  2W6J H;  1TIJ A;  1RJO A;  1EKM A;  4KFD A;  2RSX A;  3HZP A;  5EVH A;  2ZDJ A;  3LTB A;  1LNH A;  3CCE 3;  1ZO2 A;  1CEW I;  1M1X B;  3T8N A;  1YJ9 3;  3E99 A;  1W7C A;  4HM2 B;  3BNB A;  4N6V 0;  3OX9 A;  3CCS 3;  2CFK A;  2W56 B;  1O7H B;  3KII A;  1CYU A;  2B24 B;  3NM2 A;  3KKG A;  2C10 A;  3Q90 A;  3CC7 3;  1SIH A;  4R4K A;  1NJI 4;  1IVU A;  1TP6 A;  1V74 A;  4OVM A;  4MMZ B;  3F7S A;  5STD A;  1K9M 4;  1AV4 A;  2Z77 A;  1M90 4;  4FMD A;  4FCZ A;  4AKY A;  1Q42 A;  2CC3 A;  3EC9 A;  4Q53 A;  5AI1 A;  4RNZ A;  4K1V A;  2P0X A;  1JN5 B;  1ULI B;  1W2Z A;  3NBB A;  5I97 A;  3KSE D;  1KD1 4;  3FF2 A;  3CXC 2;  3DM8 A;  4KFE A;  7STD A;  1O7M B;  1FGQ A;  2FGT A;  1Q82 4;  1UI8 A;  3U97 A;  5JPU A;  4O2H A;  1Q81 4;  1WTH A;  1IV9 A;  3QK9 A;  3F8H A;  2W9Q A;  1VQ6 3;  2Z7A A;  2XFS A;  3X42 A;  5JPP A;  3SVA A;  1LOX A;  1TFO A;  1MNL A;  3B4P A;  4H3U A;  2WOF A;  1OPY A;  5EQL A;  3DZL A;  4G1M B;  1FUW A;  3NXJ A;  5D81 A;  4K90 B;  5AYR B;  2K54 A;  5KP4 A;  1YGE A;  1R4C A;  2HML B;  1EG9 B;  2XH9 A;  1UI7 A;  1A2K A;  1AVL A;  2HMJ B;  3LOY A;  3DMC A;  1QVF 2;  1O7N B;  2W2C A;  2WGO A;  2WGQ A;  1GD3 A;  5HGR A;  4EYC A;  3CU3 A;  3SOY A;  1IQX A;  1JKG B;  1N9E A;  2CWV A;  1RN7 A;  1KC8 4;  4ORL A;  2HMN B;  2OWP A;  1IT8 A;  4FCM A;  1TU5 A;  1YJW 3;  2JQ5 A;  3FH1 A;  3LYG A;  2IUJ A;  2P05 A;  3HX8 A;  1OF5 B;  4XBX A;  4HZB B;  5BVB A;  3OWY A;  3WMD A;  1YJN 3;  5IF6 A;  2BMR B;  1YIJ 3;  1OHP A;  1YHQ 3;  4WYK B;  1M1K 4;  1E97 A;  4MMY B;  1WNH A;  3BNE A;  3FF0 A;  1A2V A;  4EV2 A;  1VQ4 3;  4HBR A;  3GZR A;  2Z76 A;  3K0Z A;  3EF8 A;  3EQQ B;  3CCL 3;  3IMA B;  3S28 A;  2YFJ B;  3F9S A;  3QRD A;  1PU4 A;  4OUQ A;  3X3X A;  4N6U A;  1YVB I;  4BTX A;  3NBR A;  5AIF A;  3X3Y A;  3GRD A;  1OCV A;  3TDG A;  3CME 3;  3GZB A;  1KSI A;  1VZZ A;  2BT3 A;  3NHX A;  2OQE A;  5DRE A;  3DXO A;  3ROB A;  1RKY A;  1JNQ A;  4K61 A;  5ELJ A;  2QEX 3;  2GBW B;  2XFT A;  2E2U A;  1DVC A;  2HMM B;  5ELU A;  1ZX2 A;  1NB5 I;  1N9J A;  1Z1S A;  2KXG A;  2L4V A;  2W0Q A;  2XGL A;  3H3H A;  3K7C A;  1DMN A;  2OOV C;  4FMB A;  1RRL A;  1IVX A;  3UB1 A;  1VQN 3;  2E2V A;  3HI7 A;  2CG0 A;  1SJW A;  3MHE A;  3JUN A;  3WOF B;  3BNC A;  2CHC A;  3LTD A;  2IA7 A;  3F8X A;  4STD A;  5IG5 A;  1NDO B;  3UL5 A;  4IIA A;  3FKA A;  5IG0 A;  2F98 A;  2STD A;  1L5G B;  1VQ7 3;  3IPT A;  3FG1 A;  1KQS 2;  2GBX B;  2CIU A;  3SXX A;  4KZ1 A;  2C11 A;  4BTW A;  3FGY A;  1HU9 A;  1Q40 A;  3FG3 A;  3AMO A;  3CCQ 3;  4HM3 B;  5IEO A;  1W01 A;  4XDV A;  3B7C A;  1IVW A;  3KE7 A;  4EC6 A;  2QGU A;  4HJL B;  3I56 3;  3F40 A;  3F7X A;  3NX0 A;  1GY7 A;  3T8U A;  2Z6B A;  5IEN A;  1WMO A;  3G6E 3;  1UUW B;  4OK0 A;  3N8B A;  2BMQ B;  4LEH A;  3CPW 2;  3CC2 3;  3FCS B;  4N6M A;  3DY5 A;  3KZT A;  4EXR A;  3CMA 3;  1N5P A;  3LT9 A;  3DGL A;  4WFO A;  1W4N A;  3EJV A;  1CYV A;  4WHA A;  2XRX B;  3GWR A;  1FA3 A;  1JB4 A;  1G96 A;  2QA4 3;  3FZW A;  1A90 A;  3RGA A;  3K9M C;  4IPB A;  3G0K A;  1IVV A;  1S5A A;  2Q07 A;  3X3Z A;  3OW2 2;  1JB2 A;  2KRT A;  4N6L A;  1N5H A;  2XSO B;  3EN8 A;  3LTA A;  3VF1 A;  4RZM A;  4GL6 A;  3G8Z A;  5LC6 A;  1QMA A;  4N6N B;  1N8R 4;  3HIG A;  4R9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...