1YVBI

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
RLLGAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords falcipain 2
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 22
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yvbI00
3SVAA 1STFI 4N6LA 1ROAA 1EQKA 3PYJA 5EQLA 4N6V0 5ELJA 3UL5A 4LZIA 4EYCA 1N5HA 4N6NB 1GD3A 3L0RA 1TIJA 4N6MA 5LC7A 1M9GA 3UL6A 3S67A 4N6OB 1N9JA 4N6TA 1IV7A 4CCVA 1CYUA 2O9UX 1LXEA 1CEWI 1KWIA 3QRDA 1G96A 2W9PA 3IMAB 1RN7A 1YVBI 2BO9B 1R4CA 1NB5I 1FUWA 2W9QA 3K9MC 3KSED 1MOLA 1IV9A 5A0OB 3KFQC 3Q2PA 1MNLA 4N6UA 4ZM8A 1A90A 5LC6A 1WNHA 1CYVA 2CH9A 4IT7A 2OCTA 1GD4A 3NX0A 1FA3A 3GAXA 1PFPA 1DVDA 3PXMA 3PS8A 3MWZA 5ELUA 1A67A 2KXGA 1N5PA 1NB3I 4TX4A 1DVCA 3LH4A
chains in the Genus database with same CATH superfamily
3SVAA 3NQZA 1BAOA 3CCU3 4AKZA 4HM7B 3H3HA 1B2ZA 1RLSA 1UUGB 3CCE3 1IQXA 1RDSA 4CDLA 1I2GA 4J5KA 1Q864 3MSOA 1DMQA 3NV0A 3ZFZA 2Z6BA 3PYJA 1BRIA 1BSEA 2KF6A 3X3XA 5IEOA 1OPYA 1FZUA 1SARA 3IPTA 2XSHB 4R9LA 4WYKA 3FKAA 4L8OA 4HZ9B 2CW9A 2UUGC 1JBTA 4AKYA 3DH2A 1QALA 5M1AA 2BMQB 3BLZA 5AEWB 4K90B 3EC9A 3PGBA 3WOEB 2YX9A 1M1K4 4MMXB 5D82A 5IENA 1GYBA 1WMPA 4O3VA 2FXTA 5G1KA 4MMZB 1JKGB 3DXOA 1W02A 3X42A 2RCDA 1O7PB 3F7XA 1BVIA 2CX1A 3SEDA 1BIRA 1OACA 5DRVA 1B3SA 2GBWB 1JB5A 1TIJA 4LEHA 1YJN3 1ROVA 1FW7A 1TRPA 3S67A 3CCJ3 3AMOA 1NWWA 1BUQA 1CYUA 2O9UX 1BNRA 5AIFA 2QEX3 1KWIA 3G0KA 3CCS3 5JBSA 2RNTA 4EBGA 1J2BA 3K0ZA 2MC8A 1VQ73 1W6GA 5BU4A 3E99A 1BNJA 1FGQA 2BT3A 3BB9A 3IJEB 1IVUA 1FGRA 1K28A 3TDGA 1A2VA 1BUJA 1UGHI 5D83A 1G02A 2PZVA 5TGNA 3RGRA 1UUVB 1VQ93 4O8SA 1VQ43 3JUQA 3KSED 4I5QA 5EEOA 1PY3A 1BRGA 2P38A 5A0OB 1GY7A 3KFQC 3Q2PA 2KCDA 2Q07A 3CC23 3AGOA 3WOFB 3BNDA 2F4YA 3SOAA 4FMAA 1EQKA 1O7GB 1IVVA 1BRHA 1Q42A 4X2HA 3URPA 1W5ZA 3EE1A 3FLJA 4RNZA 1UCJA 2KAAA 1JKGA 2BMRB 3KCHA 2XEPA 3CPOA 1QVG2 1GS3A 2UX0A 4HM4B 3EF8A 4FCZA 3PZWA 2WO0A 1DE3A 1I8VA 3BNEA 2OOVA 1RGLA 1ZO2A 4STDA 1GD4A 4HAAA 4HJLB 1I0XA 3S29A 1Q7Y4 3CD63 4I4KA 4RNTA 1I2FA 1YIJ3 1VZZA 4FCJA 1I0VA 1EA2A 3GAXA 4FCMA 2BHMA 3FF2A 3D9RA 3PXMA 3GWRA 3OV4A 1UI7A 2C10A 3OXAA 1OHOA 2F5WA 3X40A 5BXQA 3V99A 1RNTA 2MF7A 2RFRA 3I553 2SBLA 5RNTA 1SIHA 3RGAA 3DGLA 2M7OA 1N5PA 1LRAA 3KIIA 5KP4A 1RKYA 1IT7A 4JRFA 4KFDA 4NHFA 1VQ83 2IUKA 1VQP3 1OF5B 2CFLA 1N8QA 1AY7A 1B2XA 3LH4A 2YFJB 5IG5A 3DGMA 1TRQA 2YFIB 1HKXA 1WMOA 3OWSA 2OWPA 2W2CA 3FG1A 1YJW3 4BTWA 3FG4A 3DGOA 1IVWA 3KN4A 2B24B 3CC73 1K41A 2C11A 3VSYA 3B4PA 3F9SA 1BRJA 3RDEA 1U5OA 2F5MA 1E97A 3DZLA 3K5TA 5ELJA 3EB8A 1JV2B 4J9AA 3UL5A 5JPUA 1VQQA 4HM1B 2ML5A 2H0HA 3K63A 1JZOA 2CFGA 1HZ1A 2RBIA 3CMA3 4WWUC 4LSOA 1WQLB 3CCR3 4N6NB 1EKMA 1K734 1O7HB 3MG1A 1BSDA 3G16A 4KZ1A 1RGGA 2WGOA 1TJDA 2XFTA 2KF5A 4HM8B 1YGEA 4BU4A 3OWYA 2P0XA 3MKIA 4XB5A 3CXC2 1OHPA 1US1A 3CPW2 2FGTA 2P09A 1JNQA 1L5GB 5CXOA 5IG4A 4H61A 2R41A 2RGQA 3CCL3 1BNSA 1IYYA 3UL6A 1UI8A 4J5GA 3B7CA 4WP5A 3NUVA 1MWUA 3O8YA 1VQ53 1ULJB 1PYLA 1UDII 4N6TA 1OF5A 4EW5A 2XGLA 5CLKA 1UGIA 3N54B 1BNEA 3NM2A 3QRDA 4JF8A 5IG0A 3HK4A 1T2IA 2W9PA 2YFLB 2WOHA 3SLUA 3IMAB 1BANA 1RN7A 1V74A 4IIAA 1IDPA 2LQVA 3DUKA 2AADA 1ULIB 5AIHA 3ALAA 4IPBA 1NB5I 3EBYA 4HM6B 1AR0A 3AGNA 3F14A 1N8R4 2AAEA 2IUJA 2BIRA 1BRSA 2K54A 5AI1A 1JJ22 1M904 2HMLB 4R4KA 1IV9A 1T5YA 1RSNA 5CF1A 1W00A 1DYUA 3H51A 3KKGA 5D81A 3T8NA 3WDGB 4KVHA 3CNXA 3LTCA 3DGNA 4ZM8A 1X1XA 4EV2A 5AYSC 1U8CB 4HM0B 2W0QA 4DKIA 1Q9EA 4XBYA 2CG1A 1YHQ3 4U13A 5DREA 3EQQB 1WNHA 1LVNA 4H3UA 3LTBA 4XDVA 5KP1A 3EX9A 3BU4A 1KQS2 5KP3A 1NO3A 1CYVA 7RNTA 1C7HA 1V58A 1FUTA 2Z77A 1HU9A 1TFKA 3QK9A 1IK3A 4IT7A 2HMJB 3SX1A 2W03A 4J8TA 1T2HA 2OCTA 2HMMB 4KT3B 3CME3 2F86B 3PCSA 1K9M4 2GSPA 1QAKA 3D5IA 5M18A 1ISKA 2LYXA 1GY5A 5JPPA 1T3BA 2Z76A 3UNLA 1BGSA 3MG2A 1MWRA 4MMYB 4GHOA 1OGZA 1I70A 1ASKA 1B2UA 3BNCA 1UCIA 2V1LA 3PS8A 3MG3A 4XBTA 4KFEA 3SYUA 3I0YA 5ELUA 4CPKA 5I97A 1X1YA 2RSXA 2W56B 3S27A 4BL2A 1AVKA 3I563 7GSPA 1W01A 1MGWA 1OH0A 3MPHA 4G1MB 4TX4A 2XF3A 3CC43 4EXRA 1TP6A 3SXXA 3U97A 1RHLA 2HMOB 2R4IA 2CWTA 4K1VA 2B1XB 1ZS7A 4MJDA 3G8ZA 1BRKA 1O7MB 3AHSA 1LOWA 1OCVA 3FGYA 4HBRA 1W6YA 1QMAA 2A15A 3MYTA 2JDIH 1W4NA 3JUOA 4N6V0 2H0GA 1JZDA 2D1WA 3DMCA 4LMIA 3NBRA 3EBTA 4LZIA 1B20A 1BSAA 4L8PA 4BTYA 1IQ8A 1B2MA 4EYCA 1RJOA 3LT9A 1N5HA 2L1SA 4FMBA 1RRHA 4BIRA 2GXFA 1X1WA 4LYLB 3UJMA 4R9KA 2OTJ3 1QJGA 3UB1A 3V92A 3NBBA 2E2TA 4FMCA 2CG0A 4GSPA 1VQM3 1F8NA 3L0RA 5EVHA 1BU4A 2W56A 4N6MA 3D4AA 5LC7A 1M9GA 4EV5A 5GSPA 3G6E3 4HKVB 1BRNL 4N6OB 1N9JA 1CQSA 1FGOA 2CHCA 2QIYA 6GSPA 3BNBA 1JB4A 1R4YA 2E2UA 2GU1A 1G96A 1MWSA 3GZXB 1TTOA 3VF1A 1W7CA 3ECFA 3JUMA 3NQYA 3NV0B 3VGNA 2ML6A 1JBSA 1YVBI 1R4CA 2INXA 1HYFA 1YI23 3OW22 2IY2A 5IERA 5BIRA 1S5AA 4O2HA 3JUNA 3LMLA 3A5EA 4FMDA 1MGRA 4HM2B 1E3RA 5BVBA 2OTL3 1FGTA 4QWTA 4GL6A 1MNLA 4N6UA 4HM5B 1M1XB 2XR8B 3ZG5A 2CWVA 1D6YA 1RGEA 3D3LA 3Q90A 4PEJA 5M19A 3AHWA 5LC6A 1UCKA 4BL3A 6STDA 1RRLA 3FG3A 4RBNA 6RNTA 2CKFB 2JQ5A 3F8HA 3HIIA 1NJI4 3EHCA 1FYSA 2CWUA 1SPUA 4OUQA 1B2SA 3FSDA 4XDWA 4LGQA 1VQN3 1C54A 1KC84 2XRXB 1RCLA 3S28A 1KD14 4NPBA 3D79A 3F7SA 4X2OA 2IA7A 4OK0A 3WHOA 3BIRA 3F40A 3NHXA 4HYZA 3X41A 3G713 3HIGA 1LQGC 1D6ZA 2BNGA 3NX0A 3KZTA 4ILFA 4WHAA 1W2B2 1WTHA 1BSBA 3FCSB 5IF6A 1ZX2A 3LYGA 1DVDA 2ZL8A 1EEJA 1RMSA 3MWZA 2HOHA 1UW1A 4HVNA 1YNVX 3T0UA 1UUWB 2O3OA 1Q40B 1NNVA 2W6JH 1GOVA 1A67A 5CK6A 1PU4A 3M8CA 2GU3A 2CFKA 1O7NB 3OX9A 2CX0A 3PCRA 1X1UA 4RZMA 1TUHA 2KF3A 3WA2X 1BOXA 1NB3I 5IEPA 1GY6A 2UGIA 1G0TA 2ZA4A 1B27A 4OVMA 4MEIA 3RNTA 3FH1A 1IT8A 3B4OA 1AVLA 1STFI 1LNIA 4N6LA 2K0MA 1QAFA 1ROAA 1Q7HA 2ZHXB 1AV4A 3HX8A 3NBJA 5G2GA 1O7WB 8RNTA 3DM8A 2F56A 3EN8A 4GB5A 1RCKA 1OGXA 1DMNA 1RTUA 1SIIA 2D42A 2GEXA 3EN1B 1CH0A 1LOVA 2IMJA 3NM7A 1GMRA 1JRQA 1ZGXA 1EUIC 2Z7AA 3KSPA 5EQLA 1SJWA 3X3YA 1RGFA 2FNQA 1Q814 5FGOA 3WODG 2CC3A 4WFOA 1E3VA 3EJVA 3GSPA 4K1UA 1S723 3JUPA 3SOYA 2CK3H 2XGNA 3GZBA 3LT8A 2CIUA 1BNIA 4N3VA 1AQZA 4ORLA 1GD3A 1W2ZA 2CFDA 1RGHA 2BMOB 1VQ63 2QA43 2HMKB 3WR2A 2OOVC 1IVXA 1Y4KA 1LOYA 3HI7A 2P05A 3V98A 2SARA 2C4BA 2Y73A 1VQL3 1Q40A 3OWUA 1LQMB 1BNFA 2H0IA 3X3ZA 4K61A 4RNYA 1STDA 1IV7A 1GOYA 1YGWA 4CCVA 3J7Yd 3MHEA 1LXEA 1GMPA 1TU5A 1LNHA 2Y74A 3DGYA 3LOYA 1CEWI 1JN5B 2F98A 3B8LA 2BU4A 4R80A 2W04A 3GZYB 2F99A 3CNMA 4NREA 2KRTA 3G4S3 3CCV3 3F8XA 3HOHA 2XSOB 2KF4A 3CU3A 5CF2A 2BO9B 1N9EA 1WMNA 3T8UA 3LZAA 3JVCA 3ROBA 2GEYA 1VQK3 2QGUA 2L4VA 2XFSA 1LOXA 1FUWA 3FZWA 4KFFA 4R1KA 3ZG0A 5HOHA 2PNCA 2W9QA 3CCQ3 4HOHA 5AYRB 3K7CA 1BSCA 1DETA 3K9MC 3KE7A 1MOLA 2XH9A 3NXJA 1GSPA 5FW5A 8CHOA 3GZRA 1JB2A 1MWTA 3LTAA 3WMDA 5AIIA 4FR9A 5AIGA 1RNBA 3LXUX 5STDA 1I3IA 1SQWA 3HZPA 4CJNA 3WA3A 3A76A 1A90A 1D6UA 1W6CA 5IG3A 1DMMA 2CFWA 1Q824 1BNGA 1A2KA 2I9WA 3FF0A 3Q1CA 3N8BA 7STDA 1JBRA 5IW9A 5G1LA 1NU3A 1RGKA 3N9HA 1QVF2 1RGCA 4Q53A 1RN4A 1RGAA 1UCLA 2CH9A 3D5GA 4WYKB 2K3DA 4EC6A 4O02B 2HMNB 1B21A 4XBXA 2OQEC 1IQYA 1YIT3 1JN5A 3LTDA 1IU7A 1Z1SA 3Q3FA 1YVSA 1EG9B 3DY5A 3CCM3 1FA3A 1VQO3 3GRDA 1PFPA 1I2EA 1I3FA 1NDOB 2J8XB 4XM4A 9RNTA 2ZDJA 1TFOA 3S5CA 1KSIA 1OHSA 1FUSA 1FGMA 4HM3B 5AEUB 2WOFA 4L7KA 4AEQA 1OUNA 3U1WA 5HGRA 2KXGA 1A2PA 2E2VA 1GOUA 3AMOB 1YJ93 1V57A 2STDA 1GMQA 1RN1A 2WGQA 2IYJA 1K8A4 4HZBB 3STDA 4BTXA 1DVCA 3ER7A 2GBXB 2P0MA 2OQEA
chains in the Genus database with same CATH topology
3SVAA 3NQZA 3CCU3 4AKZA 4HM7B 3H3HA 3CCE3 1IQXA 4CDLA 1Q864 3MSOA 1DMQA 3NV0A 2Z6BA 3X3XA 5IEOA 1OPYA 4R9LA 3IPTA 2XSHB 4WYKA 3FKAA 4L8OA 4HZ9B 2CW9A 4AKYA 1QALA 2BMQB 3BLZA 5AEWB 4K90B 3EC9A 3PGBA 3WOEB 2YX9A 1M1K4 4MMXB 5D82A 5IENA 1GYBA 1WMPA 4O3VA 2FXTA 4MMZB 1JKGB 3DXOA 1W02A 3X42A 2RCDA 1O7PB 3F7XA 3SEDA 1OACA 5DRVA 2GBWB 4LEHA 1JB5A 1TIJA 1YJN3 1ROVA 3S67A 3CCJ3 3AMOA 1NWWA 1BUQA 1CYUA 2O9UX 5AIFA 2QEX3 1KWIA 3G0KA 3CCS3 5JBSA 4EBGA 1J2BA 3K0ZA 2MC8A 1VQ73 1W6GA 3E99A 1FGQA 2BT3A 3BB9A 3IJEB 1IVUA 1FGRA 1K28A 3TDGA 1A2VA 5D83A 2PZVA 5TGNA 3RGRA 1UUVB 1VQ93 4O8SA 1VQ43 3JUQA 3KSED 5EEOA 2P38A 5A0OB 1GY7A 3KFQC 3Q2PA 2KCDA 2Q07A 3CC23 3WOFB 3BNDA 3SOAA 4FMAA 1EQKA 1O7GB 1IVVA 1Q42A 4X2HA 1W5ZA 3EE1A 3FLJA 4RNZA 1JKGA 2BMRB 2XEPA 3CPOA 1QVG2 1GS3A 2UX0A 4HM4B 3EF8A 4FCZA 3PZWA 2WO0A 3BNEA 2OOVA 1ZO2A 4STDA 1GD4A 4HJLB 3S29A 1Q7Y4 3CD63 4I4KA 1YIJ3 1VZZA 4FCJA 3GAXA 1EA2A 4FCMA 2BHMA 3FF2A 3D9RA 3PXMA 3GWRA 1UI7A 2C10A 3OXAA 1OHOA 3X40A 5BXQA 3V99A 2RFRA 2MF7A 3I553 2SBLA 1SIHA 3RGAA 3DGLA 2M7OA 1N5PA 3KIIA 5KP4A 1RKYA 1IT7A 4JRFA 4KFDA 4NHFA 1VQ83 2IUKA 1VQP3 1OF5B 2CFLA 1N8QA 3LH4A 2YFJB 5IG5A 3DGMA 2YFIB 1HKXA 1WMOA 3OWSA 2OWPA 2W2CA 3FG1A 1YJW3 4BTWA 3FG4A 3DGOA 1IVWA 3KN4A 2B24B 3CC73 1K41A 2C11A 3VSYA 3B4PA 3F9SA 3RDEA 1U5OA 1E97A 3DZLA 3K5TA 5ELJA 3EB8A 1JV2B 4J9AA 3UL5A 5JPUA 4HM1B 2ML5A 3K63A 2CFGA 3CMA3 4WWUC 4LSOA 1WQLB 3CCR3 4N6NB 1EKMA 1K734 1O7HB 3MG1A 3G16A 4KZ1A 2WGOA 2XFTA 4HM8B 3CXC2 1YGEA 3CPW2 3OWYA 2P0XA 3MKIA 4XB5A 1OHPA 1US1A 2FGTA 2P09A 1JNQA 1L5GB 5CXOA 5IG4A 4H61A 3CCL3 2RGQA 3UL6A 1UI8A 3B7CA 4WP5A 3NUVA 3O8YA 1VQ53 1ULJB 4N6TA 1OF5A 2XGLA 5CLKA 3N54B 3NM2A 3QRDA 4JF8A 5IG0A 3HK4A 2W9PA 2YFLB 2WOHA 3SLUA 3IMAB 1RN7A 1V74A 4IIAA 1IDPA 2LQVA 3DUKA 1ULIB 5AIHA 3ALAA 4IPBA 1NB5I 3EBYA 4HM6B 1AR0A 3F14A 1N8R4 2IUJA 5AI1A 2K54A 1JJ22 1M904 2HMLB 4R4KA 1IV9A 1T5YA 5CF1A 1W00A 1DYUA 3H51A 3KKGA 5D81A 3T8NA 3WDGB 4KVHA 3CNXA 3LTCA 3DGNA 4ZM8A 4EV2A 5AYSC 1U8CB 4HM0B 2W0QA 1YHQ3 4XBYA 2CG1A 4U13A 5DREA 3EQQB 1WNHA 1LVNA 4H3UA 3LTBA 4XDVA 5KP1A 3EX9A 1KQS2 5KP3A 1NO3A 1CYVA 1C7HA 2Z77A 1HU9A 1TFKA 3QK9A 1IK3A 4IT7A 2HMJB 3SX1A 2W03A 4J8TA 2OCTA 2HMMB 3CME3 2F86B 3PCSA 1K9M4 1QAKA 1ISKA 2LYXA 1GY5A 5JPPA 2Z76A 3UNLA 3MG2A 4MMYB 1OGZA 1ASKA 3BNCA 3PS8A 2V1LA 3MG3A 4XBTA 4KFEA 5I97A 3I0YA 5ELUA 2RSXA 2W56B 3S27A 1AVKA 3I563 1W01A 1OH0A 3MPHA 4G1MB 4TX4A 2XF3A 3CC43 4EXRA 1TP6A 3SXXA 3U97A 2R4IA 2HMOB 2CWTA 4K1VA 2B1XB 4MJDA 3G8ZA 1O7MB 1OCVA 3FGYA 4HBRA 1W6YA 1QMAA 2A15A 3MYTA 2JDIH 1W4NA 3JUOA 4N6V0 2D1WA 3DMCA 4LMIA 3NBRA 3EBTA 4LZIA 4L8PA 4BTYA 1IQ8A 4EYCA 1RJOA 3LT9A 1N5HA 4FMBA 1RRHA 2GXFA 3UJMA 4R9KA 2OTJ3 1QJGA 3UB1A 3V92A 3NBBA 2E2TA 4FMCA 2CG0A 1VQM3 1F8NA 3L0RA 5EVHA 2W56A 4N6MA 5LC7A 1M9GA 4EV5A 3G6E3 4HKVB 4N6OB 1N9JA 1CQSA 1FGOA 2CHCA 2QIYA 3BNBA 1JB4A 2E2UA 2GU1A 1G96A 3GZXB 3VF1A 1W7CA 3ECFA 3JUMA 3NQYA 3NV0B 3VGNA 2ML6A 1YVBI 1R4CA 2INXA 1YI23 3OW22 5IERA 1S5AA 4O2HA 3JUNA 3LMLA 4FMDA 4HM2B 1E3RA 5BVBA 2OTL3 1FGTA 4QWTA 4GL6A 1MNLA 4N6UA 4HM5B 1M1XB 2XR8B 2CWVA 1D6YA 3D3LA 3Q90A 4PEJA 5LC6A 6STDA 1RRLA 3FG3A 4RBNA 2CKFB 2JQ5A 3F8HA 3HIIA 1NJI4 3EHCA 2CWUA 4OUQA 1SPUA 4XDWA 3FSDA 1VQN3 4LGQA 1KC84 2XRXB 3S28A 1KD14 3F7SA 4X2OA 2IA7A 4OK0A 3NHXA 3F40A 4HYZA 3X41A 3G713 3HIGA 2BNGA 1D6ZA 4WHAA 3NX0A 3KZTA 1W2B2 1WTHA 3FCSB 5IF6A 1ZX2A 3LYGA 1DVDA 2ZL8A 3MWZA 1UW1A 3T0UA 1UUWB 2O3OA 1Q40B 2W6JH 1A67A 5CK6A 1PU4A 3M8CA 2GU3A 2CFKA 1O7NB 3OX9A 3PCRA 4RZMA 1TUHA 3WA2X 1NB3I 5IEPA 1GY6A 4OVMA 4MEIA 3FH1A 1IT8A 3B4OA 1AVLA 1STFI 4N6LA 2K0MA 1QAFA 1ROAA 3HX8A 3NBJA 1AV4A 5G2GA 1O7WB 3DM8A 3EN8A 4GB5A 1OGXA 1DMNA 1SIIA 2D42A 2GEXA 3EN1B 3NM7A 3OV4A 3PYJA 2IMJA 4HVNA 1JRQA 3WODG 2Z7AA 3KSPA 5EQLA 1SJWA 3X3YA 2FNQA 1Q814 5FGOA 2CC3A 4WFOA 1E3VA 3EJVA 1S723 4K1UA 3JUPA 3SOYA 2CK3H 2XGNA 3GZBA 3LT8A 2CIUA 4N3VA 4ORLA 1GD3A 1W2ZA 2CFDA 2BMOB 1VQ63 2QA43 2HMKB 2OOVC 1IVXA 1Y4KA 3HI7A 3V98A 2P05A 2Y73A 1VQL3 1Q40A 3OWUA 3X3ZA 4K61A 4RNYA 1STDA 1IV7A 4CCVA 3J7Yd 3MHEA 1LXEA 1TU5A 1LNHA 2Y74A 3LOYA 1CEWI 1JN5B 2F98A 3B8LA 4R80A 2W04A 3GZYB 2F99A 3CNMA 4NREA 2KRTA 3G4S3 3CCV3 3F8XA 2XSOB 5CF2A 3CU3A 2BO9B 1N9EA 1WMNA 3T8UA 3LZAA 3JVCA 3ROBA 2GEYA 1VQK3 2QGUA 2L4VA 2XFSA 1LOXA 1FUWA 3FZWA 4KFFA 4R1KA 2PNCA 2W9QA 3CCQ3 5AYRB 3K7CA 3KE7A 3K9MC 1MOLA 2XH9A 3NXJA 5FW5A 8CHOA 3GZRA 1JB2A 3LTAA 3WMDA 5AIIA 4FR9A 5AIGA 3LXUX 5STDA 1SQWA 3HZPA 3WA3A 3A76A 1A90A 1D6UA 1W6CA 5IG3A 1DMMA 2CFWA 1Q824 1A2KA 2I9WA 3FF0A 3Q1CA 3N8BA 7STDA 5IW9A 1NU3A 3N9HA 1QVF2 4Q53A 2CH9A 4WYKB 4EC6A 4O02B 2HMNB 4XBXA 2OQEC 1IQYA 1YIT3 1JN5A 3LTDA 1IU7A 1Z1SA 1EG9B 3DY5A 3CCM3 1FA3A 1VQO3 3GRDA 1PFPA 1NDOB 4XM4A 2ZDJA 1TFOA 3S5CA 1KSIA 1OHSA 1FGMA 4HM3B 5AEUB 2WOFA 4L7KA 4AEQA 1OUNA 3U1WA 5HGRA 2KXGA 2E2VA 3AMOB 1YJ93 2STDA 2WGQA 1K8A4 4HZBB 3STDA 4BTXA 1DVCA 3ER7A 2GBXB 2P0MA 2OQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVA A;  1STF I;  4N6L A;  1ROA A;  1EQK A;  3PYJ A;  5EQL A;  4N6V 0;  5ELJ A;  3UL5 A;  4LZI A;  4EYC A;  1N5H A;  4N6N B;  1GD3 A;  3L0R A;  1TIJ A;  4N6M A;  5LC7 A;  1M9G A;  3UL6 A;  3S67 A;  4N6O B;  1N9J A;  4N6T A;  1IV7 A;  4CCV A;  1CYU A;  2O9U X;  1LXE A;  1CEW I;  1KWI A;  3QRD A;  1G96 A;  2W9P A;  3IMA B;  1RN7 A;  1YVB I;  2BO9 B;  1R4C A;  1NB5 I;  1FUW A;  2W9Q A;  3K9M C;  3KSE D;  1MOL A;  1IV9 A;  5A0O B;  3KFQ C;  3Q2P A;  1MNL A;  4N6U A;  4ZM8 A;  1A90 A;  5LC6 A;  1WNH A;  1CYV A;  2CH9 A;  4IT7 A;  2OCT A;  1GD4 A;  3NX0 A;  1FA3 A;  3GAX A;  1PFP A;  1DVD A;  3PXM A;  3PS8 A;  3MWZ A;  5ELU A;  1A67 A;  2KXG A;  1N5P A;  1NB3 I;  4TX4 A;  1DVC A;  3LH4 A; 
#chains in the Genus database with same CATH topology
 3SVA A;  3NQZ A;  1BAO A;  3CCU 3;  4AKZ A;  4HM7 B;  3H3H A;  1B2Z A;  1RLS A;  1UUG B;  3CCE 3;  1IQX A;  1RDS A;  4CDL A;  1I2G A;  4J5K A;  1Q86 4;  3MSO A;  1DMQ A;  3NV0 A;  3ZFZ A;  2Z6B A;  3PYJ A;  1BRI A;  1BSE A;  2KF6 A;  3X3X A;  5IEO A;  1OPY A;  1FZU A;  1SAR A;  3IPT A;  2XSH B;  4R9L A;  4WYK A;  3FKA A;  4L8O A;  4HZ9 B;  2CW9 A;  2UUG C;  1JBT A;  4AKY A;  3DH2 A;  1QAL A;  5M1A A;  2BMQ B;  3BLZ A;  5AEW B;  4K90 B;  3EC9 A;  3PGB A;  3WOE B;  2YX9 A;  1M1K 4;  4MMX B;  5D82 A;  5IEN A;  1GYB A;  1WMP A;  4O3V A;  2FXT A;  5G1K A;  4MMZ B;  1JKG B;  3DXO A;  1W02 A;  3X42 A;  2RCD A;  1O7P B;  3F7X A;  1BVI A;  2CX1 A;  3SED A;  1BIR A;  1OAC A;  5DRV A;  1B3S A;  2GBW B;  1JB5 A;  1TIJ A;  4LEH A;  1YJN 3;  1ROV A;  1FW7 A;  1TRP A;  3S67 A;  3CCJ 3;  3AMO A;  1NWW A;  1BUQ A;  1CYU A;  2O9U X;  1BNR A;  5AIF A;  2QEX 3;  1KWI A;  3G0K A;  3CCS 3;  5JBS A;  2RNT A;  4EBG A;  1J2B A;  3K0Z A;  2MC8 A;  1VQ7 3;  1W6G A;  5BU4 A;  3E99 A;  1BNJ A;  1FGQ A;  2BT3 A;  3BB9 A;  3IJE B;  1IVU A;  1FGR A;  1K28 A;  3TDG A;  1A2V A;  1BUJ A;  1UGH I;  5D83 A;  1G02 A;  2PZV A;  5TGN A;  3RGR A;  1UUV B;  1VQ9 3;  4O8S A;  1VQ4 3;  3JUQ A;  3KSE D;  4I5Q A;  5EEO A;  1PY3 A;  1BRG A;  2P38 A;  5A0O B;  1GY7 A;  3KFQ C;  3Q2P A;  2KCD A;  2Q07 A;  3CC2 3;  3AGO A;  3WOF B;  3BND A;  2F4Y A;  3SOA A;  4FMA A;  1EQK A;  1O7G B;  1IVV A;  1BRH A;  1Q42 A;  4X2H A;  3URP A;  1W5Z A;  3EE1 A;  3FLJ A;  4RNZ A;  1UCJ A;  2KAA A;  1JKG A;  2BMR B;  3KCH A;  2XEP A;  3CPO A;  1QVG 2;  1GS3 A;  2UX0 A;  4HM4 B;  3EF8 A;  4FCZ A;  3PZW A;  2WO0 A;  1DE3 A;  1I8V A;  3BNE A;  2OOV A;  1RGL A;  1ZO2 A;  4STD A;  1GD4 A;  4HAA A;  4HJL B;  1I0X A;  3S29 A;  1Q7Y 4;  3CD6 3;  4I4K A;  4RNT A;  1I2F A;  1YIJ 3;  1VZZ A;  4FCJ A;  1I0V A;  1EA2 A;  3GAX A;  4FCM A;  2BHM A;  3FF2 A;  3D9R A;  3PXM A;  3GWR A;  3OV4 A;  1UI7 A;  2C10 A;  3OXA A;  1OHO A;  2F5W A;  3X40 A;  5BXQ A;  3V99 A;  1RNT A;  2MF7 A;  2RFR A;  3I55 3;  2SBL A;  5RNT A;  1SIH A;  3RGA A;  3DGL A;  2M7O A;  1N5P A;  1LRA A;  3KII A;  5KP4 A;  1RKY A;  1IT7 A;  4JRF A;  4KFD A;  4NHF A;  1VQ8 3;  2IUK A;  1VQP 3;  1OF5 B;  2CFL A;  1N8Q A;  1AY7 A;  1B2X A;  3LH4 A;  2YFJ B;  5IG5 A;  3DGM A;  1TRQ A;  2YFI B;  1HKX A;  1WMO A;  3OWS A;  2OWP A;  2W2C A;  3FG1 A;  1YJW 3;  4BTW A;  3FG4 A;  3DGO A;  1IVW A;  3KN4 A;  2B24 B;  3CC7 3;  1K41 A;  2C11 A;  3VSY A;  3B4P A;  3F9S A;  1BRJ A;  3RDE A;  1U5O A;  2F5M A;  1E97 A;  3DZL A;  3K5T A;  5ELJ A;  3EB8 A;  1JV2 B;  4J9A A;  3UL5 A;  5JPU A;  1VQQ A;  4HM1 B;  2ML5 A;  2H0H A;  3K63 A;  1JZO A;  2CFG A;  1HZ1 A;  2RBI A;  3CMA 3;  4WWU C;  4LSO A;  1WQL B;  3CCR 3;  4N6N B;  1EKM A;  1K73 4;  1O7H B;  3MG1 A;  1BSD A;  3G16 A;  4KZ1 A;  1RGG A;  2WGO A;  1TJD A;  2XFT A;  2KF5 A;  4HM8 B;  1YGE A;  4BU4 A;  3OWY A;  2P0X A;  3MKI A;  4XB5 A;  3CXC 2;  1OHP A;  1US1 A;  3CPW 2;  2FGT A;  2P09 A;  1JNQ A;  1L5G B;  5CXO A;  5IG4 A;  4H61 A;  2R41 A;  2RGQ A;  3CCL 3;  1BNS A;  1IYY A;  3UL6 A;  1UI8 A;  4J5G A;  3B7C A;  4WP5 A;  3NUV A;  1MWU A;  3O8Y A;  1VQ5 3;  1ULJ B;  1PYL A;  1UDI I;  4N6T A;  1OF5 A;  4EW5 A;  2XGL A;  5CLK A;  1UGI A;  3N54 B;  1BNE A;  3NM2 A;  3QRD A;  4JF8 A;  5IG0 A;  3HK4 A;  1T2I A;  2W9P A;  2YFL B;  2WOH A;  3SLU A;  3IMA B;  1BAN A;  1RN7 A;  1V74 A;  4IIA A;  1IDP A;  2LQV A;  3DUK A;  2AAD A;  1ULI B;  5AIH A;  3ALA A;  4IPB A;  1NB5 I;  3EBY A;  4HM6 B;  1AR0 A;  3AGN A;  3F14 A;  1N8R 4;  2AAE A;  2IUJ A;  2BIR A;  1BRS A;  2K54 A;  5AI1 A;  1JJ2 2;  1M90 4;  2HML B;  4R4K A;  1IV9 A;  1T5Y A;  1RSN A;  5CF1 A;  1W00 A;  1DYU A;  3H51 A;  3KKG A;  5D81 A;  3T8N A;  3WDG B;  4KVH A;  3CNX A;  3LTC A;  3DGN A;  4ZM8 A;  1X1X A;  4EV2 A;  5AYS C;  1U8C B;  4HM0 B;  2W0Q A;  4DKI A;  1Q9E A;  4XBY A;  2CG1 A;  1YHQ 3;  4U13 A;  5DRE A;  3EQQ B;  1WNH A;  1LVN A;  4H3U A;  3LTB A;  4XDV A;  5KP1 A;  3EX9 A;  3BU4 A;  1KQS 2;  5KP3 A;  1NO3 A;  1CYV A;  7RNT A;  1C7H A;  1V58 A;  1FUT A;  2Z77 A;  1HU9 A;  1TFK A;  3QK9 A;  1IK3 A;  4IT7 A;  2HMJ B;  3SX1 A;  2W03 A;  4J8T A;  1T2H A;  2OCT A;  2HMM B;  4KT3 B;  3CME 3;  2F86 B;  3PCS A;  1K9M 4;  2GSP A;  1QAK A;  3D5I A;  5M18 A;  1ISK A;  2LYX A;  1GY5 A;  5JPP A;  1T3B A;  2Z76 A;  3UNL A;  1BGS A;  3MG2 A;  1MWR A;  4MMY B;  4GHO A;  1OGZ A;  1I70 A;  1ASK A;  1B2U A;  3BNC A;  1UCI A;  2V1L A;  3PS8 A;  3MG3 A;  4XBT A;  4KFE A;  3SYU A;  3I0Y A;  5ELU A;  4CPK A;  5I97 A;  1X1Y A;  2RSX A;  2W56 B;  3S27 A;  4BL2 A;  1AVK A;  3I56 3;  7GSP A;  1W01 A;  1MGW A;  1OH0 A;  3MPH A;  4G1M B;  4TX4 A;  2XF3 A;  3CC4 3;  4EXR A;  1TP6 A;  3SXX A;  3U97 A;  1RHL A;  2HMO B;  2R4I A;  2CWT A;  4K1V A;  2B1X B;  1ZS7 A;  4MJD A;  3G8Z A;  1BRK A;  1O7M B;  3AHS A;  1LOW A;  1OCV A;  3FGY A;  4HBR A;  1W6Y A;  1QMA A;  2A15 A;  3MYT A;  2JDI H;  1W4N A;  3JUO A;  4N6V 0;  2H0G A;  1JZD A;  2D1W A;  3DMC A;  4LMI A;  3NBR A;  3EBT A;  4LZI A;  1B20 A;  1BSA A;  4L8P A;  4BTY A;  1IQ8 A;  1B2M A;  4EYC A;  1RJO A;  3LT9 A;  1N5H A;  2L1S A;  4FMB A;  1RRH A;  4BIR A;  2GXF A;  1X1W A;  4LYL B;  3UJM A;  4R9K A;  2OTJ 3;  1QJG A;  3UB1 A;  3V92 A;  3NBB A;  2E2T A;  4FMC A;  2CG0 A;  4GSP A;  1VQM 3;  1F8N A;  3L0R A;  5EVH A;  1BU4 A;  2W56 A;  4N6M A;  3D4A A;  5LC7 A;  1M9G A;  4EV5 A;  5GSP A;  3G6E 3;  4HKV B;  1BRN L;  4N6O B;  1N9J A;  1CQS A;  1FGO A;  2CHC A;  2QIY A;  6GSP A;  3BNB A;  1JB4 A;  1R4Y A;  2E2U A;  2GU1 A;  1G96 A;  1MWS A;  3GZX B;  1TTO A;  3VF1 A;  1W7C A;  3ECF A;  3JUM A;  3NQY A;  3NV0 B;  3VGN A;  2ML6 A;  1JBS A;  1YVB I;  1R4C A;  2INX A;  1HYF A;  1YI2 3;  3OW2 2;  2IY2 A;  5IER A;  5BIR A;  1S5A A;  4O2H A;  3JUN A;  3LML A;  3A5E A;  4FMD A;  1MGR A;  4HM2 B;  1E3R A;  5BVB A;  2OTL 3;  1FGT A;  4QWT A;  4GL6 A;  1MNL A;  4N6U A;  4HM5 B;  1M1X B;  2XR8 B;  3ZG5 A;  2CWV A;  1D6Y A;  1RGE A;  3D3L A;  3Q90 A;  4PEJ A;  5M19 A;  3AHW A;  5LC6 A;  1UCK A;  4BL3 A;  6STD A;  1RRL A;  3FG3 A;  4RBN A;  6RNT A;  2CKF B;  2JQ5 A;  3F8H A;  3HII A;  1NJI 4;  3EHC A;  1FYS A;  2CWU A;  1SPU A;  4OUQ A;  1B2S A;  3FSD A;  4XDW A;  4LGQ A;  1VQN 3;  1C54 A;  1KC8 4;  2XRX B;  1RCL A;  3S28 A;  1KD1 4;  4NPB A;  3D79 A;  3F7S A;  4X2O A;  2IA7 A;  4OK0 A;  3WHO A;  3BIR A;  3F40 A;  3NHX A;  4HYZ A;  3X41 A;  3G71 3;  3HIG A;  1LQG C;  1D6Z A;  2BNG A;  3NX0 A;  3KZT A;  4ILF A;  4WHA A;  1W2B 2;  1WTH A;  1BSB A;  3FCS B;  5IF6 A;  1ZX2 A;  3LYG A;  1DVD A;  2ZL8 A;  1EEJ A;  1RMS A;  3MWZ A;  2HOH A;  1UW1 A;  4HVN A;  1YNV X;  3T0U A;  1UUW B;  2O3O A;  1Q40 B;  1NNV A;  2W6J H;  1GOV A;  1A67 A;  5CK6 A;  1PU4 A;  3M8C A;  2GU3 A;  2CFK A;  1O7N B;  3OX9 A;  2CX0 A;  3PCR A;  1X1U A;  4RZM A;  1TUH A;  2KF3 A;  3WA2 X;  1BOX A;  1NB3 I;  5IEP A;  1GY6 A;  2UGI A;  1G0T A;  2ZA4 A;  1B27 A;  4OVM A;  4MEI A;  3RNT A;  3FH1 A;  1IT8 A;  3B4O A;  1AVL A;  1STF I;  1LNI A;  4N6L A;  2K0M A;  1QAF A;  1ROA A;  1Q7H A;  2ZHX B;  1AV4 A;  3HX8 A;  3NBJ A;  5G2G A;  1O7W B;  8RNT A;  3DM8 A;  2F56 A;  3EN8 A;  4GB5 A;  1RCK A;  1OGX A;  1DMN A;  1RTU A;  1SII A;  2D42 A;  2GEX A;  3EN1 B;  1CH0 A;  1LOV A;  2IMJ A;  3NM7 A;  1GMR A;  1JRQ A;  1ZGX A;  1EUI C;  2Z7A A;  3KSP A;  5EQL A;  1SJW A;  3X3Y A;  1RGF A;  2FNQ A;  1Q81 4;  5FGO A;  3WOD G;  2CC3 A;  4WFO A;  1E3V A;  3EJV A;  3GSP A;  4K1U A;  1S72 3;  3JUP A;  3SOY A;  2CK3 H;  2XGN A;  3GZB A;  3LT8 A;  2CIU A;  1BNI A;  4N3V A;  1AQZ A;  4ORL A;  1GD3 A;  1W2Z A;  2CFD A;  1RGH A;  2BMO B;  1VQ6 3;  2QA4 3;  2HMK B;  3WR2 A;  2OOV C;  1IVX A;  1Y4K A;  1LOY A;  3HI7 A;  2P05 A;  3V98 A;  2SAR A;  2C4B A;  2Y73 A;  1VQL 3;  1Q40 A;  3OWU A;  1LQM B;  1BNF A;  2H0I A;  3X3Z A;  4K61 A;  4RNY A;  1STD A;  1IV7 A;  1GOY A;  1YGW A;  4CCV A;  3J7Y d;  3MHE A;  1LXE A;  1GMP A;  1TU5 A;  1LNH A;  2Y74 A;  3DGY A;  3LOY A;  1CEW I;  1JN5 B;  2F98 A;  3B8L A;  2BU4 A;  4R80 A;  2W04 A;  3GZY B;  2F99 A;  3CNM A;  4NRE A;  2KRT A;  3G4S 3;  3CCV 3;  3F8X A;  3HOH A;  2XSO B;  2KF4 A;  3CU3 A;  5CF2 A;  2BO9 B;  1N9E A;  1WMN A;  3T8U A;  3LZA A;  3JVC A;  3ROB A;  2GEY A;  1VQK 3;  2QGU A;  2L4V A;  2XFS A;  1LOX A;  1FUW A;  3FZW A;  4KFF A;  4R1K A;  3ZG0 A;  5HOH A;  2PNC A;  2W9Q A;  3CCQ 3;  4HOH A;  5AYR B;  3K7C A;  1BSC A;  1DET A;  3K9M C;  3KE7 A;  1MOL A;  2XH9 A;  3NXJ A;  1GSP A;  5FW5 A;  8CHO A;  3GZR A;  1JB2 A;  1MWT A;  3LTA A;  3WMD A;  5AII A;  4FR9 A;  5AIG A;  1RNB A;  3LXU X;  5STD A;  1I3I A;  1SQW A;  3HZP A;  4CJN A;  3WA3 A;  3A76 A;  1A90 A;  1D6U A;  1W6C A;  5IG3 A;  1DMM A;  2CFW A;  1Q82 4;  1BNG A;  1A2K A;  2I9W A;  3FF0 A;  3Q1C A;  3N8B A;  7STD A;  1JBR A;  5IW9 A;  5G1L A;  1NU3 A;  1RGK A;  3N9H A;  1QVF 2;  1RGC A;  4Q53 A;  1RN4 A;  1RGA A;  1UCL A;  2CH9 A;  3D5G A;  4WYK B;  2K3D A;  4EC6 A;  4O02 B;  2HMN B;  1B21 A;  4XBX A;  2OQE C;  1IQY A;  1YIT 3;  1JN5 A;  3LTD A;  1IU7 A;  1Z1S A;  3Q3F A;  1YVS A;  1EG9 B;  3DY5 A;  3CCM 3;  1FA3 A;  1VQO 3;  3GRD A;  1PFP A;  1I2E A;  1I3F A;  1NDO B;  2J8X B;  4XM4 A;  9RNT A;  2ZDJ A;  1TFO A;  3S5C A;  1KSI A;  1OHS A;  1FUS A;  1FGM A;  4HM3 B;  5AEU B;  2WOF A;  4L7K A;  4AEQ A;  1OUN A;  3U1W A;  5HGR A;  2KXG A;  1A2P A;  2E2V A;  1GOU A;  3AMO B;  1YJ9 3;  1V57 A;  2STD A;  1GMQ A;  1RN1 A;  2WGQ A;  2IYJ A;  1K8A 4;  4HZB B;  3STD A;  4BTX A;  1DVC A;  3ER7 A;  2GBX B;  2P0M A;  2OQE A; 
#chains in the Genus database with same CATH homology
 3SVA A;  3NQZ A;  3CCU 3;  4AKZ A;  4HM7 B;  3H3H A;  3CCE 3;  1IQX A;  4CDL A;  1Q86 4;  3MSO A;  1DMQ A;  3NV0 A;  2Z6B A;  3X3X A;  5IEO A;  1OPY A;  4R9L A;  3IPT A;  2XSH B;  4WYK A;  3FKA A;  4L8O A;  4HZ9 B;  2CW9 A;  4AKY A;  1QAL A;  2BMQ B;  3BLZ A;  5AEW B;  4K90 B;  3EC9 A;  3PGB A;  3WOE B;  2YX9 A;  1M1K 4;  4MMX B;  5D82 A;  5IEN A;  1GYB A;  1WMP A;  4O3V A;  2FXT A;  4MMZ B;  1JKG B;  3DXO A;  1W02 A;  3X42 A;  2RCD A;  1O7P B;  3F7X A;  3SED A;  1OAC A;  5DRV A;  2GBW B;  4LEH A;  1JB5 A;  1TIJ A;  1YJN 3;  1ROV A;  3S67 A;  3CCJ 3;  3AMO A;  1NWW A;  1BUQ A;  1CYU A;  2O9U X;  5AIF A;  2QEX 3;  1KWI A;  3G0K A;  3CCS 3;  5JBS A;  4EBG A;  1J2B A;  3K0Z A;  2MC8 A;  1VQ7 3;  1W6G A;  3E99 A;  1FGQ A;  2BT3 A;  3BB9 A;  3IJE B;  1IVU A;  1FGR A;  1K28 A;  3TDG A;  1A2V A;  5D83 A;  2PZV A;  5TGN A;  3RGR A;  1UUV B;  1VQ9 3;  4O8S A;  1VQ4 3;  3JUQ A;  3KSE D;  5EEO A;  2P38 A;  5A0O B;  1GY7 A;  3KFQ C;  3Q2P A;  2KCD A;  2Q07 A;  3CC2 3;  3WOF B;  3BND A;  3SOA A;  4FMA A;  1EQK A;  1O7G B;  1IVV A;  1Q42 A;  4X2H A;  1W5Z A;  3EE1 A;  3FLJ A;  4RNZ A;  1JKG A;  2BMR B;  2XEP A;  3CPO A;  1QVG 2;  1GS3 A;  2UX0 A;  4HM4 B;  3EF8 A;  4FCZ A;  3PZW A;  2WO0 A;  3BNE A;  2OOV A;  1ZO2 A;  4STD A;  1GD4 A;  4HJL B;  3S29 A;  1Q7Y 4;  3CD6 3;  4I4K A;  1YIJ 3;  1VZZ A;  4FCJ A;  3GAX A;  1EA2 A;  4FCM A;  2BHM A;  3FF2 A;  3D9R A;  3PXM A;  3GWR A;  1UI7 A;  2C10 A;  3OXA A;  1OHO A;  3X40 A;  5BXQ A;  3V99 A;  2RFR A;  2MF7 A;  3I55 3;  2SBL A;  1SIH A;  3RGA A;  3DGL A;  2M7O A;  1N5P A;  3KII A;  5KP4 A;  1RKY A;  1IT7 A;  4JRF A;  4KFD A;  4NHF A;  1VQ8 3;  2IUK A;  1VQP 3;  1OF5 B;  2CFL A;  1N8Q A;  3LH4 A;  2YFJ B;  5IG5 A;  3DGM A;  2YFI B;  1HKX A;  1WMO A;  3OWS A;  2OWP A;  2W2C A;  3FG1 A;  1YJW 3;  4BTW A;  3FG4 A;  3DGO A;  1IVW A;  3KN4 A;  2B24 B;  3CC7 3;  1K41 A;  2C11 A;  3VSY A;  3B4P A;  3F9S A;  3RDE A;  1U5O A;  1E97 A;  3DZL A;  3K5T A;  5ELJ A;  3EB8 A;  1JV2 B;  4J9A A;  3UL5 A;  5JPU A;  4HM1 B;  2ML5 A;  3K63 A;  2CFG A;  3CMA 3;  4WWU C;  4LSO A;  1WQL B;  3CCR 3;  4N6N B;  1EKM A;  1K73 4;  1O7H B;  3MG1 A;  3G16 A;  4KZ1 A;  2WGO A;  2XFT A;  4HM8 B;  3CXC 2;  1YGE A;  3CPW 2;  3OWY A;  2P0X A;  3MKI A;  4XB5 A;  1OHP A;  1US1 A;  2FGT A;  2P09 A;  1JNQ A;  1L5G B;  5CXO A;  5IG4 A;  4H61 A;  3CCL 3;  2RGQ A;  3UL6 A;  1UI8 A;  3B7C A;  4WP5 A;  3NUV A;  3O8Y A;  1VQ5 3;  1ULJ B;  4N6T A;  1OF5 A;  2XGL A;  5CLK A;  3N54 B;  3NM2 A;  3QRD A;  4JF8 A;  5IG0 A;  3HK4 A;  2W9P A;  2YFL B;  2WOH A;  3SLU A;  3IMA B;  1RN7 A;  1V74 A;  4IIA A;  1IDP A;  2LQV A;  3DUK A;  1ULI B;  5AIH A;  3ALA A;  4IPB A;  1NB5 I;  3EBY A;  4HM6 B;  1AR0 A;  3F14 A;  1N8R 4;  2IUJ A;  5AI1 A;  2K54 A;  1JJ2 2;  1M90 4;  2HML B;  4R4K A;  1IV9 A;  1T5Y A;  5CF1 A;  1W00 A;  1DYU A;  3H51 A;  3KKG A;  5D81 A;  3T8N A;  3WDG B;  4KVH A;  3CNX A;  3LTC A;  3DGN A;  4ZM8 A;  4EV2 A;  5AYS C;  1U8C B;  4HM0 B;  2W0Q A;  1YHQ 3;  4XBY A;  2CG1 A;  4U13 A;  5DRE A;  3EQQ B;  1WNH A;  1LVN A;  4H3U A;  3LTB A;  4XDV A;  5KP1 A;  3EX9 A;  1KQS 2;  5KP3 A;  1NO3 A;  1CYV A;  1C7H A;  2Z77 A;  1HU9 A;  1TFK A;  3QK9 A;  1IK3 A;  4IT7 A;  2HMJ B;  3SX1 A;  2W03 A;  4J8T A;  2OCT A;  2HMM B;  3CME 3;  2F86 B;  3PCS A;  1K9M 4;  1QAK A;  1ISK A;  2LYX A;  1GY5 A;  5JPP A;  2Z76 A;  3UNL A;  3MG2 A;  4MMY B;  1OGZ A;  1ASK A;  3BNC A;  3PS8 A;  2V1L A;  3MG3 A;  4XBT A;  4KFE A;  5I97 A;  3I0Y A;  5ELU A;  2RSX A;  2W56 B;  3S27 A;  1AVK A;  3I56 3;  1W01 A;  1OH0 A;  3MPH A;  4G1M B;  4TX4 A;  2XF3 A;  3CC4 3;  4EXR A;  1TP6 A;  3SXX A;  3U97 A;  2R4I A;  2HMO B;  2CWT A;  4K1V A;  2B1X B;  4MJD A;  3G8Z A;  1O7M B;  1OCV A;  3FGY A;  4HBR A;  1W6Y A;  1QMA A;  2A15 A;  3MYT A;  2JDI H;  1W4N A;  3JUO A;  4N6V 0;  2D1W A;  3DMC A;  4LMI A;  3NBR A;  3EBT A;  4LZI A;  4L8P A;  4BTY A;  1IQ8 A;  4EYC A;  1RJO A;  3LT9 A;  1N5H A;  4FMB A;  1RRH A;  2GXF A;  3UJM A;  4R9K A;  2OTJ 3;  1QJG A;  3UB1 A;  3V92 A;  3NBB A;  2E2T A;  4FMC A;  2CG0 A;  1VQM 3;  1F8N A;  3L0R A;  5EVH A;  2W56 A;  4N6M A;  5LC7 A;  1M9G A;  4EV5 A;  3G6E 3;  4HKV B;  4N6O B;  1N9J A;  1CQS A;  1FGO A;  2CHC A;  2QIY A;  3BNB A;  1JB4 A;  2E2U A;  2GU1 A;  1G96 A;  3GZX B;  3VF1 A;  1W7C A;  3ECF A;  3JUM A;  3NQY A;  3NV0 B;  3VGN A;  2ML6 A;  1YVB I;  1R4C A;  2INX A;  1YI2 3;  3OW2 2;  5IER A;  1S5A A;  4O2H A;  3JUN A;  3LML A;  4FMD A;  4HM2 B;  1E3R A;  5BVB A;  2OTL 3;  1FGT A;  4QWT A;  4GL6 A;  1MNL A;  4N6U A;  4HM5 B;  1M1X B;  2XR8 B;  2CWV A;  1D6Y A;  3D3L A;  3Q90 A;  4PEJ A;  5LC6 A;  6STD A;  1RRL A;  3FG3 A;  4RBN A;  2CKF B;  2JQ5 A;  3F8H A;  3HII A;  1NJI 4;  3EHC A;  2CWU A;  4OUQ A;  1SPU A;  4XDW A;  3FSD A;  1VQN 3;  4LGQ A;  1KC8 4;  2XRX B;  3S28 A;  1KD1 4;  3F7S A;  4X2O A;  2IA7 A;  4OK0 A;  3NHX A;  3F40 A;  4HYZ A;  3X41 A;  3G71 3;  3HIG A;  2BNG A;  1D6Z A;  4WHA A;  3NX0 A;  3KZT A;  1W2B 2;  1WTH A;  3FCS B;  5IF6 A;  1ZX2 A;  3LYG A;  1DVD A;  2ZL8 A;  3MWZ A;  1UW1 A;  3T0U A;  1UUW B;  2O3O A;  1Q40 B;  2W6J H;  1A67 A;  5CK6 A;  1PU4 A;  3M8C A;  2GU3 A;  2CFK A;  1O7N B;  3OX9 A;  3PCR A;  4RZM A;  1TUH A;  3WA2 X;  1NB3 I;  5IEP A;  1GY6 A;  4OVM A;  4MEI A;  3FH1 A;  1IT8 A;  3B4O A;  1AVL A;  1STF I;  4N6L A;  2K0M A;  1QAF A;  1ROA A;  3HX8 A;  3NBJ A;  1AV4 A;  5G2G A;  1O7W B;  3DM8 A;  3EN8 A;  4GB5 A;  1OGX A;  1DMN A;  1SII A;  2D42 A;  2GEX A;  3EN1 B;  3NM7 A;  3OV4 A;  3PYJ A;  2IMJ A;  4HVN A;  1JRQ A;  3WOD G;  2Z7A A;  3KSP A;  5EQL A;  1SJW A;  3X3Y A;  2FNQ A;  1Q81 4;  5FGO A;  2CC3 A;  4WFO A;  1E3V A;  3EJV A;  1S72 3;  4K1U A;  3JUP A;  3SOY A;  2CK3 H;  2XGN A;  3GZB A;  3LT8 A;  2CIU A;  4N3V A;  4ORL A;  1GD3 A;  1W2Z A;  2CFD A;  2BMO B;  1VQ6 3;  2QA4 3;  2HMK B;  2OOV C;  1IVX A;  1Y4K A;  3HI7 A;  3V98 A;  2P05 A;  2Y73 A;  1VQL 3;  1Q40 A;  3OWU A;  3X3Z A;  4K61 A;  4RNY A;  1STD A;  1IV7 A;  4CCV A;  3J7Y d;  3MHE A;  1LXE A;  1TU5 A;  1LNH A;  2Y74 A;  3LOY A;  1CEW I;  1JN5 B;  2F98 A;  3B8L A;  4R80 A;  2W04 A;  3GZY B;  2F99 A;  3CNM A;  4NRE A;  2KRT A;  3G4S 3;  3CCV 3;  3F8X A;  2XSO B;  5CF2 A;  3CU3 A;  2BO9 B;  1N9E A;  1WMN A;  3T8U A;  3LZA A;  3JVC A;  3ROB A;  2GEY A;  1VQK 3;  2QGU A;  2L4V A;  2XFS A;  1LOX A;  1FUW A;  3FZW A;  4KFF A;  4R1K A;  2PNC A;  2W9Q A;  3CCQ 3;  5AYR B;  3K7C A;  3KE7 A;  3K9M C;  1MOL A;  2XH9 A;  3NXJ A;  5FW5 A;  8CHO A;  3GZR A;  1JB2 A;  3LTA A;  3WMD A;  5AII A;  4FR9 A;  5AIG A;  3LXU X;  5STD A;  1SQW A;  3HZP A;  3WA3 A;  3A76 A;  1A90 A;  1D6U A;  1W6C A;  5IG3 A;  1DMM A;  2CFW A;  1Q82 4;  1A2K A;  2I9W A;  3FF0 A;  3Q1C A;  3N8B A;  7STD A;  5IW9 A;  1NU3 A;  3N9H A;  1QVF 2;  4Q53 A;  2CH9 A;  4WYK B;  4EC6 A;  4O02 B;  2HMN B;  4XBX A;  2OQE C;  1IQY A;  1YIT 3;  1JN5 A;  3LTD A;  1IU7 A;  1Z1S A;  1EG9 B;  3DY5 A;  3CCM 3;  1FA3 A;  1VQO 3;  3GRD A;  1PFP A;  1NDO B;  4XM4 A;  2ZDJ A;  1TFO A;  3S5C A;  1KSI A;  1OHS A;  1FGM A;  4HM3 B;  5AEU B;  2WOF A;  4L7K A;  4AEQ A;  1OUN A;  3U1W A;  5HGR A;  2KXG A;  2E2V A;  3AMO B;  1YJ9 3;  2STD A;  2WGQ A;  1K8A 4;  4HZB B;  3STD A;  4BTX A;  1DVC A;  3ER7 A;  2GBX B;  2P0M A;  2OQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...