1YVBI

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
RLLGAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords falcipain 2
total genus 22
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yvbI00
1LXEA 5A0OB 3LH4A 1N5HA 3S67A 1PFPA 1CYUA 1N9JA 1A90A 1M9GA 3Q2PA 1N5PA 3KSED 1STFI 4TX4A 1FA3A 3QRDA 1A67A 4N6V0 4LZIA 1MOLA 1DVCA 2O9UX 2W9PA 3MWZA 4IT7A 3UL6A 3PXMA 4EYCA 4N6NB 4CCVA 3K9MC 2CH9A 3IMAB 3SVAA 1DVDA 1WNHA 1G96A 2W9QA 3PYJA 5ELJA 1IV9A 1CEWI 4N6OB 5LC6A 3KFQC 3L0RA 5ELUA 1FUWA 2KXGA 4N6UA 2BO9B 3NX0A 3GAXA 1EQKA 5EQLA 1IV7A 1MNLA 1TIJA 1RN7A 5LC7A 3UL5A 1NB5I 4N6MA 4ZM8A 3PS8A 1YVBI 2OCTA 1CYVA 1KWIA 1GD3A 1NB3I 4N6LA 1GD4A 1ROAA 4N6TA 1R4CA
chains in the Genus database with same CATH superfamily
1ULIB 2GU3A 2ML6A 4R9LA 1CQSA 1TFKA 3GWRA 4GB5A 1YIT3 4HM5B 5AIHA 1JV2B 1BU4A 3RDEA 1N5PA 3VGNA 2XGNA 4LMIA 4JRFA 1B20A 5G1KA 3VSYA 3HK4A 1VQ73 4L8PA 3ZG5A 1GY7A 1RCLA 3MWZA 2OTJ3 1BNGA 1BNJA 1Q42A 2CHCA 5IG3A 1O7HB 2BIRA 5EEOA 3G4S3 4WYKA 1VQ63 1VQP3 3L0RA 2BU4A 4BL3A 3MKIA 1EQKA 1TFOA 3U97A 3A76A 1VZZA 1I3FA 1BOXA 1SARA 3OV4A 1GS3A 1KWIA 1O7NB 1OACA 4NREA 1BRIA 1Z1SA 4XBTA 3I553 3DGOA 4H61A 2OOVC 3JUPA 3FG3A 1JZDA 2M7OA 3LXUX 1YHQ3 1UCKA 2RFRA 4HOHA 1LRAA 1TP6A 1RGFA 1RNTA 1AVLA 1JN5B 1T2IA 2UUGC 3FKAA 4FCMA 4OVMA 2OTL3 1BNEA 1BUJA 1Q9EA 4LYLB 1DVCA 2KRTA 2LYXA 4BIRA 1OH0A 4BL2A 3ECFA 3KKGA 2IA7A 4HZ9B 1KSIA 3FG1A 3EBTA 3S27A 3S28A 3U1WA 1Q864 3JVCA 3NHXA 3MPHA 2CX1A 1RN7A 4U13A 3FF2A 4I4KA 4KT3B 1GMPA 1T3BA 1GYBA 3LTAA 2K3DA 3DXOA 5D81A 3NQZA 1R4CA 1NDOB 5I97A 5A0OB 1N5HA 2L4VA 1ULJB 4EXRA 1M9GA 1TRQA 1IVXA 1YGWA 2PNCA 3AGOA 1B3SA 1F8NA 2OQEC 3EBYA 3NV0B 3PGBA 4TX4A 6STDA 2XFTA 4FCZA 1GMRA 1B2ZA 2CKFB 3HI7A 1IK3A 1RN4A 1UCIA 3N8BA 4FMBA 1OCVA 1JBRA 3EN1B 1M1K4 3N9HA 3CCE3 2HMKB 4KFDA 4R80A 2K54A 5IG4A 1FUWA 3UB1A 5EVHA 4GSPA 3T0UA 5STDA 4BTYA 3UL5A 2Z76A 9RNTA 5M18A 2F5WA 1VQ93 1BSDA 2OCTA 3D5IA 2H0HA 3WOFB 2Z7AA 1DVDA 1GOVA 1YGEA 1LXEA 1AY7A 1JRQA 1US1A 1FGMA 1WMNA 2W03A 1BRGA 3FF0A 4XM4A 3V99A 4CJNA 3WA3A 5FW5A 1W5ZA 3NXJA 1JKGA 2RGQA 2SBLA 3BB9A 2YFJB 1MOLA 3D4AA 3SXXA 3TDGA 3JUNA 4IT7A 2OWPA 3X3XA 2E2VA 3K9MC 1C7HA 1NJI4 5DRVA 4L7KA 4RZMA 2CX0A 2Y74A 1RGGA 3BNDA 3EE1A 4WHAA 3WDGB 2BMRB 2ML5A 4G1MB 1K734 3PZWA 1E3RA 5IEOA 1WQLB 1VQL3 3BU4A 2BO9B 1BAOA 2YFLB 3EHCA 1SIHA 3NX0A 1TIJA 3BNEA 1KC84 1AR0A 2I9WA 3FG4A 3MG2A 3CNMA 1ZS7A 4MMYB 3E99A 2WOFA 5D83A 2IUJA 4KFEA 1ROAA 3BNCA 2CFGA 3NM2A 1V74A 2KCDA 4NPBA 1I8VA 3NUVA 4X2HA 1OPYA 1I0XA 1SQWA 2HMJB 5AEWB 2QEX3 1RRHA 3KE7A 4LSOA 2XF3A 2W2CA 3NV0A 1DMMA 2O9UX 1EA2A 3CC23 4LGQA 5IEPA 1BUQA 2A15A 1BIRA 1BSBA 1VQ43 3N54B 3D3LA 3SLUA 4XDWA 3BIRA 3EQQB 3GSPA 1IV9A 1CEWI 1W6YA 1LOWA 4O3VA 3G8ZA 1UI8A 3KFQC 3F40A 3F7SA 5AI1A 1LVNA 1NU3A 1D6UA 1BRNL 1RDSA 1NB5I 2PZVA 2E2TA 1BNRA 2OQEA 4HAAA 2WGQA 2HMNB 5CF2A 1E3VA 2GXFA 2H0GA 2P38A 1C54A 3CU3A 2HMOB 1GSPA 1Y4KA 1O7PB 1TJDA 3GZRA 3CCV3 3SEDA 1RGCA 3KSED 3NBRA 1N9EA 1FZUA 1AV4A 4ILFA 1CH0A 4KFFA 1QVG2 1K28A 1JKGB 3LYGA 3RGAA 1BSEA 5GSPA 3NBJA 1EKMA 4XBYA 8CHOA 1RN1A 2KF4A 4WP5A 1WNHA 4XBXA 1RHLA 3CPW2 5ELJA 1JBSA 3NM7A 1WMOA 3FCSB 5BVBA 1SJWA 1LOVA 1ZO2A 1G0TA 1RLSA 4MMZB 1JBTA 2XR8B 4ZM8A 1UCLA 2CK3H 3CMA3 4J5KA 3EX9A 2XEPA 3K63A 1GD4A 2XGLA 2F5MA 2P09A 3Q1CA 1DMNA 3FGYA 1SIIA 1UUWB 4CDLA 3JUQA 3VF1A 2W56A 3AGNA 4AKZA 1W7CA 1MGWA 4BTXA 1W00A 4FMCA 6RNTA 4K1VA 3T8NA 7GSPA 4HM6B 2CWUA 2CFDA 1BNSA 3DGMA 3CC73 3DMCA 2GEXA 2INXA 3CCJ3 3HZPA 3WOEB 2CH9A 1RGLA 1LNHA 3BLZA 3ER7A 3DH2A 4HM0B 3HOHA 3FLJA 3HIGA 1O7WB 3PCRA 4Q53A 5AIGA 1S5AA 1X1UA 2XFSA 3DZLA 3V98A 1QAFA 1U8CB 2BHMA 1DETA 1I2EA 3M8CA 4FR9A 4O8SA 1A2KA 4XB5A 1MWTA 5M19A 2AAEA 2KF3A 1LOYA 1MGRA 1NNVA 1UDII 1RGKA 1B27A 1X1XA 2B24B 1UUGB 1YVSA 1IVUA 1LNIA 2MC8A 4MJDA 3GZYB 2YX9A 1SPUA 5BXQA 4H3UA 1RMSA 1RTUA 3MYTA 4J9AA 3DGLA 1IVVA 2RCDA 3K5TA 1UI7A 4DKIA 5CK6A 1LOXA 4XDVA 3MHEA 5IG5A 3FZWA 3NQYA 3I563 1BSCA 7STDA 1ROVA 1K41A 2IMJA 5HOHA 1FUSA 1D6YA 1IV7A 5AYRB 1GOUA 1MWUA 2FNQA 3X42A 1I2GA 1NB3I 5M1AA 4CPKA 1V57A 3DGNA 6GSPA 1QAKA 1PY3A 2UGIA 1PU4A 3JUMA 3LTCA 3X3YA 2RBIA 3PCSA 4HVNA 3KIIA 4EV2A 2BT3A 1WMPA 1B2SA 1IU7A 3MG3A 4KZ1A 5G2GA 1B2UA 1FA3A 1M904 4N6V0 1V58A 1Q824 4FMDA 1IT8A 4R9KA 1HKXA 1RGHA 2GBXB 3EJVA 4RNTA 1FYSA 4QWTA 5HGRA 1FUTA 5KP3A 3G16A 2CW9A 1GY5A 1IDPA 4FCJA 5LC6A 1WTHA 4HM4B 1YJ93 5ELUA 2C11A 2P0XA 3GZXB 2B1XB 2J8XB 2AADA 1FGRA 1G02A 1MNLA 2W04A 1EEJA 2ZA4A 1YNVX 1NO3A 2YFIB 3UNLA 3J7Yd 2V1LA 1R4YA 3KSPA 2JQ5A 1FW7A 2E2UA 1BGSA 3EN8A 4STDA 2Y73A 2WOHA 4N6TA 1KD14 2K0MA 2L1SA 3MSOA 4MMXB 3F8HA 1IT7A 4BTWA 8RNTA 2QGUA 3OXAA 3OX9A 4K90B 1AVKA 2BMQB 5JPUA 2ZL8A 2CG0A 1FGTA 2D42A 2W6JH 3D5GA 3ROBA 2Z6BA 3OWYA 1A2PA 1N8QA 3WR2A 3G6E3 3CC43 3PXMA 1BRJA 3RGRA 1UUVB 2CFKA 3AMOA 1HU9A 3WHOA 1BRSA 1TRPA 1UGHI 3AHSA 4HKVB 3F8XA 2MF7A 2UX0A 1B2MA 4HBRA 1RKYA 1D6ZA 1I2FA 2W0QA 3GZBA 5AIFA 5IERA 4OUQA 2KAAA 3K7CA 1UGIA 1RRLA 4J8TA 1Q7Y4 2R41A 3GRDA 1MWRA 1STDA 4RNYA 2QA43 2RNTA 1EG9B 1VQQA 2IYJA 2WO0A 2ZHXB 4EC6A 3Q3FA 5IF6A 3LTDA 4RNZA 5KP4A 3F14A 1RNBA 4EYCA 3S29A 2BMOB 1W2ZA 1FGOA 3X3ZA 3B4OA 5IW9A 3H3HA 3DGYA 3HX8A 1IYYA 1Q7HA 3EB8A 3X40A 3LOYA 1GMQA 3D9RA 4OK0A 2CWTA 1PYLA 5BU4A 3CNXA 5JPPA 1GY6A 4R4KA 4L8OA 4I5QA 3DUKA 2F4YA 1FGQA 1IQXA 3CME3 3SOYA 1VQN3 2P05A 2HMMB 3RNTA 3LH4A 3S67A 1YJN3 1YJW3 1RGAA 1Q40B 2W56B 3QRDA 3LZAA 4LZIA 2CWVA 1VQK3 1RSNA 1OF5A 2F86B 3DY5A 1QALA 2CFLA 3B7CA 3K0ZA 4HJLB 3URPA 3NBBA 3KCHA 1LQMB 4BU4A 4CCVA 5RNTA 1M1XB 3FH1A 4WYKB 1G96A 3AMOB 4HYZA 1BRHA 3O8YA 2ZDJA 2F99A 2GBWB 3LT9A 1T2HA 1IVWA 2D1WA 1IQYA 3WA2X 4HM8B 2HMLB 3A5EA 2SARA 3I0YA 1S723 3B8LA 1CYVA 4N6LA 1ZGXA 3CCL3 2RSXA 5AYSC 5JBSA 1JN5A 5IENA 5FGOA 3UJMA 1L5GB 3S5CA 1EUIC 1TUHA 4K61A 2LQVA 5KP1A 1RGEA 3UL6A 2WGOA 4IPBA 4HM3B 2R4IA 4X2OA 1MWSA 2OOVA 2IUKA 2XSHB 3SOAA 5CXOA 1UCJA 3OWSA 3D79A 3STDA 3HIIA 3X41A 5AIIA 3H51A 3CCM3 3CXC2 1BVIA 4N3VA 4GL6A 1J2BA 5EQLA 2C10A 3CCR3 1UW1A 4EV5A 4N6MA 4WFOA 3F7XA 1U5OA 1BNIA 1GD3A 1OGXA 1W02A 3IPTA 3PYJA 5D82A 5IG0A 1N8R4 1DE3A 3ALAA 1JB5A 2GU1A 3CCS3 1K8A4 3CCQ3 1JB2A 2CFWA 1PFPA 1CYUA 4K1UA 2STDA 1W01A 2F98A 1GOYA 1STFI 3LT8A 1Q40A 5TGNA 2GEYA 1A67A 3ZG0A 1OUNA 4R1KA 2XSOB 4MEIA 2XH9A 5AEUB 1JB4A 5G1LA 1TTOA 3SVAA 1OF5B 4PEJA 1W2B2 2H0IA 1KQS2 2IY2A 1ZX2A 3IJEB 3OW22 4HZBB 4N6OB 1K9M4 1RJOA 4NHFA 1JZOA 4GHOA 1JNQA 4AEQA 7RNTA 1BNFA 3GAXA 2Q07A 4HM2B 5LC7A 2O3OA 3ZFZA 2QIYA 4RBNA 3EC9A 1AQZA 3LMLA 1NWWA 1OGZA 3FSDA 4FMAA 1W6CA 3F9SA 1E97A 1DMQA 3G0KA 1BSAA 1N9JA 1LQGC 3SYUA 3Q2PA 3WMDA 1JJ22 3QK9A 3MG1A 3SX1A 1HYFA 2XRXB 3DM8A 1B21A 3KZTA 2HOHA 3CPOA 1OHSA 4EBGA 1QJGA 2Z77A 1Q814 1BANA 1ASKA 2F56A 4ORLA 1VQ53 1DYUA 3IMAB 1W6GA 3JUOA 3G713 1YIJ3 1RCKA 1TU5A 1OHPA 4AKYA 2P0MA 1I3IA 3BNBA 4N6UA 2C4BA 3OWUA 1VQM3 1A2VA 2FXTA 4EW5A 1B2XA 4WWUC 3PS8A 4O2HA 3AHWA 3Q90A 3CD63 1T5YA 1YI23 1BRKA 1X1WA 1QMAA 4IIAA 4O02B 1IQ8A 1VQO3 1QVF2 3LTBA 3CCU3 4HM7B 3EF8A 1I70A 1A90A 1I0VA 1ISKA 4LEHA 1HZ1A 3KN4A 5CLKA 2W9PA 2BNGA 4JF8A 4N6NB 2CG1A 3T8UA 5BIRA 2KF5A 5DREA 4J5GA 2W9QA 1O7MB 2CIUA 2KF6A 1OHOA 2JDIH 1O7GB 1W4NA 4KVHA 2KXGA 3B4PA 2FGTA 5CF1A 1VQ83 3WODG 3V92A 1YVBI 4HM1B 1X1YA 2CC3A 2GSPA
chains in the Genus database with same CATH topology
1ULIB 2GU3A 2ML6A 4R9LA 1CQSA 1TFKA 3GWRA 4GB5A 1YIT3 4HM5B 5AIHA 1JV2B 3RDEA 1N5PA 3VGNA 2XGNA 4LMIA 4JRFA 3VSYA 1VQ73 3HK4A 4L8PA 1GY7A 3MWZA 2OTJ3 1Q42A 2CHCA 5IG3A 1O7HB 5EEOA 3G4S3 4WYKA 1VQ63 1VQP3 3L0RA 1EQKA 3MKIA 1TFOA 3U97A 3A76A 1VZZA 3OV4A 1GS3A 1KWIA 1O7NB 1OACA 4NREA 1Z1SA 4XBTA 3I553 3DGOA 4H61A 2OOVC 3JUPA 3FG3A 2M7OA 3LXUX 1YHQ3 2RFRA 1TP6A 1AVLA 1JN5B 3FKAA 4OVMA 2OTL3 1DVCA 2KRTA 2LYXA 1OH0A 3ECFA 3KKGA 2IA7A 4HZ9B 1KSIA 3FG1A 3EBTA 3S27A 3S28A 3U1WA 1Q864 3JVCA 3NHXA 3MPHA 1RN7A 4U13A 3FF2A 4I4KA 1GYBA 3LTAA 3DXOA 5D81A 3NQZA 1R4CA 1NDOB 5I97A 5A0OB 1N5HA 2L4VA 1ULJB 4EXRA 1M9GA 2PNCA 1IVXA 3PGBA 3NV0B 4WFOA 3EBYA 1F8NA 2OQEC 4TX4A 6STDA 2XFTA 4FCZA 2CKFB 3HI7A 1IK3A 3N8BA 4FMBA 1OCVA 3EN1B 1M1K4 3N9HA 3CCE3 2HMKB 4KFDA 4R80A 2K54A 5IG4A 1FUWA 3UB1A 5EVHA 3T0UA 4BTYA 5STDA 3UL5A 2Z76A 1VQ93 2OCTA 3WOFB 2Z7AA 1DVDA 1LXEA 1YGEA 1US1A 1JRQA 1WMNA 1FGMA 2W03A 4FCMA 4XM4A 3V99A 3FF0A 3WA3A 5FW5A 1W5ZA 3NXJA 1JKGA 2RGQA 2SBLA 3BB9A 2YFJB 1MOLA 3TDGA 3SXXA 3JUNA 4IT7A 2OWPA 3X3XA 2E2VA 3K9MC 1C7HA 1NJI4 5DRVA 4L7KA 4RZMA 2Y74A 3BNDA 3EE1A 3WDGB 4WHAA 2BMRB 2ML5A 4G1MB 1K734 3PZWA 1E3RA 5IEOA 1WQLB 1VQL3 3EHCA 2BO9B 2YFLB 3NX0A 1SIHA 1TIJA 3BNEA 1KC84 1AR0A 2I9WA 3FG4A 3MG2A 3CNMA 4MMYB 3E99A 2WOFA 5D83A 2IUJA 4KFEA 1ROAA 3BNCA 2CFGA 3NM2A 1V74A 2KCDA 3NUVA 4X2HA 1OPYA 2HMJB 1SQWA 5AEWB 2QEX3 1RRHA 3KE7A 4LSOA 2XF3A 2W2CA 3NV0A 1DMMA 2O9UX 1EA2A 3CC23 4LGQA 5IEPA 1BUQA 2A15A 1VQ43 3N54B 3D3LA 3SLUA 4XDWA 3EQQB 1IV9A 1CEWI 1W6YA 4O3VA 3G8ZA 1UI8A 3KFQC 3F40A 3F7SA 5AI1A 1LVNA 1NU3A 1D6UA 1NB5I 2PZVA 2E2TA 2OQEA 5CF2A 2WGQA 2HMNB 1E3VA 2GXFA 2P38A 3CU3A 2HMOB 1Y4KA 1O7PB 3GZRA 3CCV3 3SEDA 3KSED 3NBRA 1N9EA 1AV4A 4KFFA 1QVG2 1K28A 1JKGB 3LYGA 3RGAA 3NBJA 1EKMA 4XBYA 8CHOA 4WP5A 1WNHA 4XBXA 3CPW2 5ELJA 3NM7A 1WMOA 3FCSB 5BVBA 1SJWA 1ZO2A 4MMZB 2XR8B 4ZM8A 2CK3H 3CMA3 3EX9A 2XEPA 3K63A 1GD4A 2XGLA 2P09A 3Q1CA 1DMNA 3FGYA 1SIIA 1UUWB 4CDLA 3JUQA 3VF1A 2W56A 4AKZA 1W7CA 4BTXA 1W00A 4FMCA 4K1VA 3T8NA 4HM6B 2CWUA 2CFDA 3DGMA 3CC73 3DMCA 2GEXA 2INXA 3CCJ3 3HZPA 3WOEB 2CH9A 1LNHA 3BLZA 3ER7A 4HM0B 3HIGA 3FLJA 1O7WB 3PCRA 4Q53A 5AIGA 1S5AA 2XFSA 3DZLA 3V98A 1QAFA 1U8CB 2BHMA 3M8CA 4XB5A 4O8SA 4FR9A 1A2KA 2B24B 1IVUA 2MC8A 4MJDA 3GZYB 2YX9A 1SPUA 5BXQA 4H3UA 3MYTA 4J9AA 3DGLA 1IVVA 2RCDA 3K5TA 1UI7A 5CK6A 1LOXA 4XDVA 3MHEA 5IG5A 3FZWA 3NQYA 3I563 7STDA 1ROVA 1K41A 2IMJA 1D6YA 1IV7A 5AYRB 2FNQA 3X42A 1NB3I 3DGNA 1QAKA 1PU4A 3JUMA 3LTCA 3X3YA 3PCSA 4HVNA 3KIIA 4EV2A 2BT3A 1WMPA 1IU7A 3MG3A 4KZ1A 5G2GA 1FA3A 1M904 4N6V0 1Q824 4FMDA 1IT8A 4R9KA 1HKXA 2GBXB 3EJVA 4QWTA 5HGRA 5KP3A 3G16A 2CW9A 1GY5A 1IDPA 4FCJA 5LC6A 1WTHA 4HM4B 1YJ93 5ELUA 2C11A 2P0XA 3GZXB 2B1XB 1FGRA 1MNLA 2W04A 3UNLA 3J7Yd 1NO3A 2YFIB 2V1LA 3KSPA 2JQ5A 2E2UA 3EN8A 4STDA 2Y73A 2WOHA 4N6TA 1KD14 2K0MA 3MSOA 4MMXB 3F8HA 1IT7A 4BTWA 2QGUA 3OXAA 3OX9A 4K90B 1AVKA 2BMQB 5JPUA 2ZL8A 2CG0A 1FGTA 2D42A 2W6JH 3ROBA 2Z6BA 3OWYA 1N8QA 3CC43 3G6E3 3PXMA 3RGRA 1UUVB 2CFKA 3AMOA 1HU9A 4HKVB 3F8XA 2MF7A 2UX0A 4HBRA 1RKYA 1D6ZA 3GZBA 2W0QA 5AIFA 5IERA 4OUQA 3K7CA 1RRLA 4J8TA 1Q7Y4 3GRDA 1STDA 4RNYA 2QA43 2WO0A 1EG9B 4EC6A 5KP4A 5IF6A 3LTDA 4RNZA 3F14A 4EYCA 3S29A 2BMOB 1W2ZA 1FGOA 3X3ZA 3B4OA 5IW9A 3H3HA 3HX8A 3EB8A 3X40A 3LOYA 3D9RA 4OK0A 2CWTA 3CNXA 5JPPA 1GY6A 4R4KA 4L8OA 3DUKA 1FGQA 1IQXA 3CME3 3SOYA 1VQN3 2P05A 2HMMB 3LH4A 3S67A 1YJN3 1YJW3 1Q40B 2W56B 3QRDA 3LZAA 4LZIA 2CWVA 1VQK3 1OF5A 2F86B 3DY5A 1QALA 2CFLA 3B7CA 3K0ZA 4HJLB 4CCVA 3NBBA 1M1XB 3FH1A 4WYKB 1G96A 3AMOB 4HYZA 3O8YA 2ZDJA 2F99A 2GBWB 3LT9A 1IVWA 2D1WA 1IQYA 3WA2X 4HM8B 2HMLB 3I0YA 1S723 3B8LA 1CYVA 4N6LA 3CCL3 2RSXA 5AYSC 5JBSA 1JN5A 5IENA 5FGOA 3UJMA 1L5GB 3S5CA 1TUHA 4K61A 2LQVA 5KP1A 3UL6A 2WGOA 4IPBA 4HM3B 2R4IA 4X2OA 2OOVA 2IUKA 2XSHB 3SOAA 5CXOA 3OWSA 3STDA 3HIIA 3X41A 5AIIA 3H51A 3CCM3 3CXC2 4N3VA 1J2BA 4GL6A 5EQLA 2C10A 3CCR3 1UW1A 4EV5A 4N6MA 3F7XA 1U5OA 1OGXA 1GD3A 1W02A 3IPTA 3PYJA 5D82A 5IG0A 1N8R4 3ALAA 1JB5A 2GU1A 3CCS3 1K8A4 3CCQ3 1JB2A 2CFWA 1PFPA 1CYUA 4K1UA 2STDA 1W01A 2F98A 3LT8A 1STFI 1Q40A 5TGNA 2GEYA 1A67A 1OUNA 4R1KA 2XSOB 4MEIA 2XH9A 5AEUB 1JB4A 3SVAA 1OF5B 4PEJA 1W2B2 1KQS2 3IJEB 1ZX2A 1K9M4 3OW22 4HZBB 4N6OB 1RJOA 4NHFA 1JNQA 4AEQA 3GAXA 2Q07A 4HM2B 5LC7A 2O3OA 2QIYA 4RBNA 3EC9A 3LMLA 1NWWA 1OGZA 3FSDA 4FMAA 1W6CA 3F9SA 1E97A 1DMQA 3G0KA 3WMDA 1N9JA 1JJ22 3Q2PA 3QK9A 3MG1A 3SX1A 2XRXB 3DM8A 3KZTA 3CPOA 1OHSA 4EBGA 1QJGA 2Z77A 1Q814 1ASKA 4ORLA 1VQ53 1DYUA 3IMAB 1W6GA 3JUOA 3G713 1YIJ3 1TU5A 1OHPA 4AKYA 2P0MA 3BNBA 4N6UA 3OWUA 1VQM3 1A2VA 2FXTA 4WWUC 3PS8A 4O2HA 3Q90A 3CD63 1T5YA 1YI23 1QMAA 4IIAA 4O02B 1IQ8A 1VQO3 1QVF2 3LTBA 3CCU3 4HM7B 3EF8A 1A90A 1ISKA 4LEHA 3KN4A 5CLKA 2W9PA 2BNGA 4JF8A 4N6NB 2CG1A 3T8UA 5DREA 2W9QA 1O7MB 2CIUA 1OHOA 2JDIH 1O7GB 1W4NA 4KVHA 2KXGA 3B4PA 2FGTA 5CF1A 1VQ83 3WODG 3V92A 1YVBI 4HM1B 2CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXE A;  5A0O B;  3LH4 A;  1N5H A;  3S67 A;  1PFP A;  1CYU A;  1N9J A;  1A90 A;  1M9G A;  3Q2P A;  1N5P A;  3KSE D;  1STF I;  4TX4 A;  1FA3 A;  3QRD A;  1A67 A;  4N6V 0;  4LZI A;  1MOL A;  1DVC A;  2O9U X;  2W9P A;  3MWZ A;  4IT7 A;  3UL6 A;  3PXM A;  4EYC A;  4N6N B;  4CCV A;  3K9M C;  2CH9 A;  3IMA B;  3SVA A;  1DVD A;  1WNH A;  1G96 A;  2W9Q A;  3PYJ A;  5ELJ A;  1IV9 A;  1CEW I;  4N6O B;  5LC6 A;  3KFQ C;  3L0R A;  5ELU A;  1FUW A;  2KXG A;  4N6U A;  2BO9 B;  3NX0 A;  3GAX A;  1EQK A;  5EQL A;  1IV7 A;  1MNL A;  1TIJ A;  1RN7 A;  5LC7 A;  3UL5 A;  1NB5 I;  4N6M A;  4ZM8 A;  3PS8 A;  1YVB I;  2OCT A;  1CYV A;  1KWI A;  1GD3 A;  1NB3 I;  4N6L A;  1GD4 A;  1ROA A;  4N6T A;  1R4C A; 
#chains in the Genus database with same CATH topology
 1ULI B;  2GU3 A;  2ML6 A;  4R9L A;  1CQS A;  1TFK A;  3GWR A;  4GB5 A;  1YIT 3;  4HM5 B;  5AIH A;  1JV2 B;  1BU4 A;  3RDE A;  1N5P A;  3VGN A;  2XGN A;  4LMI A;  4JRF A;  1B20 A;  5G1K A;  3VSY A;  3HK4 A;  1VQ7 3;  4L8P A;  3ZG5 A;  1GY7 A;  1RCL A;  3MWZ A;  2OTJ 3;  1BNG A;  1BNJ A;  1Q42 A;  2CHC A;  5IG3 A;  1O7H B;  2BIR A;  5EEO A;  3G4S 3;  4WYK A;  1VQ6 3;  1VQP 3;  3L0R A;  2BU4 A;  4BL3 A;  3MKI A;  1EQK A;  1TFO A;  3U97 A;  3A76 A;  1VZZ A;  1I3F A;  1BOX A;  1SAR A;  3OV4 A;  1GS3 A;  1KWI A;  1O7N B;  1OAC A;  4NRE A;  1BRI A;  1Z1S A;  4XBT A;  3I55 3;  3DGO A;  4H61 A;  2OOV C;  3JUP A;  3FG3 A;  1JZD A;  2M7O A;  3LXU X;  1YHQ 3;  1UCK A;  2RFR A;  4HOH A;  1LRA A;  1TP6 A;  1RGF A;  1RNT A;  1AVL A;  1JN5 B;  1T2I A;  2UUG C;  3FKA A;  4FCM A;  4OVM A;  2OTL 3;  1BNE A;  1BUJ A;  1Q9E A;  4LYL B;  1DVC A;  2KRT A;  2LYX A;  4BIR A;  1OH0 A;  4BL2 A;  3ECF A;  3KKG A;  2IA7 A;  4HZ9 B;  1KSI A;  3FG1 A;  3EBT A;  3S27 A;  3S28 A;  3U1W A;  1Q86 4;  3JVC A;  3NHX A;  3MPH A;  2CX1 A;  1RN7 A;  4U13 A;  3FF2 A;  4I4K A;  4KT3 B;  1GMP A;  1T3B A;  1GYB A;  3LTA A;  2K3D A;  3DXO A;  5D81 A;  3NQZ A;  1R4C A;  1NDO B;  5I97 A;  5A0O B;  1N5H A;  2L4V A;  1ULJ B;  4EXR A;  1M9G A;  1TRQ A;  1IVX A;  1YGW A;  2PNC A;  3AGO A;  1B3S A;  1F8N A;  2OQE C;  3EBY A;  3NV0 B;  3PGB A;  4TX4 A;  6STD A;  2XFT A;  4FCZ A;  1GMR A;  1B2Z A;  2CKF B;  3HI7 A;  1IK3 A;  1RN4 A;  1UCI A;  3N8B A;  4FMB A;  1OCV A;  1JBR A;  3EN1 B;  1M1K 4;  3N9H A;  3CCE 3;  2HMK B;  4KFD A;  4R80 A;  2K54 A;  5IG4 A;  1FUW A;  3UB1 A;  5EVH A;  4GSP A;  3T0U A;  5STD A;  4BTY A;  3UL5 A;  2Z76 A;  9RNT A;  5M18 A;  2F5W A;  1VQ9 3;  1BSD A;  2OCT A;  3D5I A;  2H0H A;  3WOF B;  2Z7A A;  1DVD A;  1GOV A;  1YGE A;  1LXE A;  1AY7 A;  1JRQ A;  1US1 A;  1FGM A;  1WMN A;  2W03 A;  1BRG A;  3FF0 A;  4XM4 A;  3V99 A;  4CJN A;  3WA3 A;  5FW5 A;  1W5Z A;  3NXJ A;  1JKG A;  2RGQ A;  2SBL A;  3BB9 A;  2YFJ B;  1MOL A;  3D4A A;  3SXX A;  3TDG A;  3JUN A;  4IT7 A;  2OWP A;  3X3X A;  2E2V A;  3K9M C;  1C7H A;  1NJI 4;  5DRV A;  4L7K A;  4RZM A;  2CX0 A;  2Y74 A;  1RGG A;  3BND A;  3EE1 A;  4WHA A;  3WDG B;  2BMR B;  2ML5 A;  4G1M B;  1K73 4;  3PZW A;  1E3R A;  5IEO A;  1WQL B;  1VQL 3;  3BU4 A;  2BO9 B;  1BAO A;  2YFL B;  3EHC A;  1SIH A;  3NX0 A;  1TIJ A;  3BNE A;  1KC8 4;  1AR0 A;  2I9W A;  3FG4 A;  3MG2 A;  3CNM A;  1ZS7 A;  4MMY B;  3E99 A;  2WOF A;  5D83 A;  2IUJ A;  4KFE A;  1ROA A;  3BNC A;  2CFG A;  3NM2 A;  1V74 A;  2KCD A;  4NPB A;  1I8V A;  3NUV A;  4X2H A;  1OPY A;  1I0X A;  1SQW A;  2HMJ B;  5AEW B;  2QEX 3;  1RRH A;  3KE7 A;  4LSO A;  2XF3 A;  2W2C A;  3NV0 A;  1DMM A;  2O9U X;  1EA2 A;  3CC2 3;  4LGQ A;  5IEP A;  1BUQ A;  2A15 A;  1BIR A;  1BSB A;  1VQ4 3;  3N54 B;  3D3L A;  3SLU A;  4XDW A;  3BIR A;  3EQQ B;  3GSP A;  1IV9 A;  1CEW I;  1W6Y A;  1LOW A;  4O3V A;  3G8Z A;  1UI8 A;  3KFQ C;  3F40 A;  3F7S A;  5AI1 A;  1LVN A;  1NU3 A;  1D6U A;  1BRN L;  1RDS A;  1NB5 I;  2PZV A;  2E2T A;  1BNR A;  2OQE A;  4HAA A;  2WGQ A;  2HMN B;  5CF2 A;  1E3V A;  2GXF A;  2H0G A;  2P38 A;  1C54 A;  3CU3 A;  2HMO B;  1GSP A;  1Y4K A;  1O7P B;  1TJD A;  3GZR A;  3CCV 3;  3SED A;  1RGC A;  3KSE D;  3NBR A;  1N9E A;  1FZU A;  1AV4 A;  4ILF A;  1CH0 A;  4KFF A;  1QVG 2;  1K28 A;  1JKG B;  3LYG A;  3RGA A;  1BSE A;  5GSP A;  3NBJ A;  1EKM A;  4XBY A;  8CHO A;  1RN1 A;  2KF4 A;  4WP5 A;  1WNH A;  4XBX A;  1RHL A;  3CPW 2;  5ELJ A;  1JBS A;  3NM7 A;  1WMO A;  3FCS B;  5BVB A;  1SJW A;  1LOV A;  1ZO2 A;  1G0T A;  1RLS A;  4MMZ B;  1JBT A;  2XR8 B;  4ZM8 A;  1UCL A;  2CK3 H;  3CMA 3;  4J5K A;  3EX9 A;  2XEP A;  3K63 A;  1GD4 A;  2XGL A;  2F5M A;  2P09 A;  3Q1C A;  1DMN A;  3FGY A;  1SII A;  1UUW B;  4CDL A;  3JUQ A;  3VF1 A;  2W56 A;  3AGN A;  4AKZ A;  1W7C A;  1MGW A;  4BTX A;  1W00 A;  4FMC A;  6RNT A;  4K1V A;  3T8N A;  7GSP A;  4HM6 B;  2CWU A;  2CFD A;  1BNS A;  3DGM A;  3CC7 3;  3DMC A;  2GEX A;  2INX A;  3CCJ 3;  3HZP A;  3WOE B;  2CH9 A;  1RGL A;  1LNH A;  3BLZ A;  3ER7 A;  3DH2 A;  4HM0 B;  3HOH A;  3FLJ A;  3HIG A;  1O7W B;  3PCR A;  4Q53 A;  5AIG A;  1S5A A;  1X1U A;  2XFS A;  3DZL A;  3V98 A;  1QAF A;  1U8C B;  2BHM A;  1DET A;  1I2E A;  3M8C A;  4FR9 A;  4O8S A;  1A2K A;  4XB5 A;  1MWT A;  5M19 A;  2AAE A;  2KF3 A;  1LOY A;  1MGR A;  1NNV A;  1UDI I;  1RGK A;  1B27 A;  1X1X A;  2B24 B;  1UUG B;  1YVS A;  1IVU A;  1LNI A;  2MC8 A;  4MJD A;  3GZY B;  2YX9 A;  1SPU A;  5BXQ A;  4H3U A;  1RMS A;  1RTU A;  3MYT A;  4J9A A;  3DGL A;  1IVV A;  2RCD A;  3K5T A;  1UI7 A;  4DKI A;  5CK6 A;  1LOX A;  4XDV A;  3MHE A;  5IG5 A;  3FZW A;  3NQY A;  3I56 3;  1BSC A;  7STD A;  1ROV A;  1K41 A;  2IMJ A;  5HOH A;  1FUS A;  1D6Y A;  1IV7 A;  5AYR B;  1GOU A;  1MWU A;  2FNQ A;  3X42 A;  1I2G A;  1NB3 I;  5M1A A;  4CPK A;  1V57 A;  3DGN A;  6GSP A;  1QAK A;  1PY3 A;  2UGI A;  1PU4 A;  3JUM A;  3LTC A;  3X3Y A;  2RBI A;  3PCS A;  4HVN A;  3KII A;  4EV2 A;  2BT3 A;  1WMP A;  1B2S A;  1IU7 A;  3MG3 A;  4KZ1 A;  5G2G A;  1B2U A;  1FA3 A;  1M90 4;  4N6V 0;  1V58 A;  1Q82 4;  4FMD A;  1IT8 A;  4R9K A;  1HKX A;  1RGH A;  2GBX B;  3EJV A;  4RNT A;  1FYS A;  4QWT A;  5HGR A;  1FUT A;  5KP3 A;  3G16 A;  2CW9 A;  1GY5 A;  1IDP A;  4FCJ A;  5LC6 A;  1WTH A;  4HM4 B;  1YJ9 3;  5ELU A;  2C11 A;  2P0X A;  3GZX B;  2B1X B;  2J8X B;  2AAD A;  1FGR A;  1G02 A;  1MNL A;  2W04 A;  1EEJ A;  2ZA4 A;  1YNV X;  1NO3 A;  2YFI B;  3UNL A;  3J7Y d;  2V1L A;  1R4Y A;  3KSP A;  2JQ5 A;  1FW7 A;  2E2U A;  1BGS A;  3EN8 A;  4STD A;  2Y73 A;  2WOH A;  4N6T A;  1KD1 4;  2K0M A;  2L1S A;  3MSO A;  4MMX B;  3F8H A;  1IT7 A;  4BTW A;  8RNT A;  2QGU A;  3OXA A;  3OX9 A;  4K90 B;  1AVK A;  2BMQ B;  5JPU A;  2ZL8 A;  2CG0 A;  1FGT A;  2D42 A;  2W6J H;  3D5G A;  3ROB A;  2Z6B A;  3OWY A;  1A2P A;  1N8Q A;  3WR2 A;  3G6E 3;  3CC4 3;  3PXM A;  1BRJ A;  3RGR A;  1UUV B;  2CFK A;  3AMO A;  1HU9 A;  3WHO A;  1BRS A;  1TRP A;  1UGH I;  3AHS A;  4HKV B;  3F8X A;  2MF7 A;  2UX0 A;  1B2M A;  4HBR A;  1RKY A;  1D6Z A;  1I2F A;  2W0Q A;  3GZB A;  5AIF A;  5IER A;  4OUQ A;  2KAA A;  3K7C A;  1UGI A;  1RRL A;  4J8T A;  1Q7Y 4;  2R41 A;  3GRD A;  1MWR A;  1STD A;  4RNY A;  2QA4 3;  2RNT A;  1EG9 B;  1VQQ A;  2IYJ A;  2WO0 A;  2ZHX B;  4EC6 A;  3Q3F A;  5IF6 A;  3LTD A;  4RNZ A;  5KP4 A;  3F14 A;  1RNB A;  4EYC A;  3S29 A;  2BMO B;  1W2Z A;  1FGO A;  3X3Z A;  3B4O A;  5IW9 A;  3H3H A;  3DGY A;  3HX8 A;  1IYY A;  1Q7H A;  3EB8 A;  3X40 A;  3LOY A;  1GMQ A;  3D9R A;  4OK0 A;  2CWT A;  1PYL A;  5BU4 A;  3CNX A;  5JPP A;  1GY6 A;  4R4K A;  4L8O A;  4I5Q A;  3DUK A;  2F4Y A;  1FGQ A;  1IQX A;  3CME 3;  3SOY A;  1VQN 3;  2P05 A;  2HMM B;  3RNT A;  3LH4 A;  3S67 A;  1YJN 3;  1YJW 3;  1RGA A;  1Q40 B;  2W56 B;  3QRD A;  3LZA A;  4LZI A;  2CWV A;  1VQK 3;  1RSN A;  1OF5 A;  2F86 B;  3DY5 A;  1QAL A;  2CFL A;  3B7C A;  3K0Z A;  4HJL B;  3URP A;  3NBB A;  3KCH A;  1LQM B;  4BU4 A;  4CCV A;  5RNT A;  1M1X B;  3FH1 A;  4WYK B;  1G96 A;  3AMO B;  4HYZ A;  1BRH A;  3O8Y A;  2ZDJ A;  2F99 A;  2GBW B;  3LT9 A;  1T2H A;  1IVW A;  2D1W A;  1IQY A;  3WA2 X;  4HM8 B;  2HML B;  3A5E A;  2SAR A;  3I0Y A;  1S72 3;  3B8L A;  1CYV A;  4N6L A;  1ZGX A;  3CCL 3;  2RSX A;  5AYS C;  5JBS A;  1JN5 A;  5IEN A;  5FGO A;  3UJM A;  1L5G B;  3S5C A;  1EUI C;  1TUH A;  4K61 A;  2LQV A;  5KP1 A;  1RGE A;  3UL6 A;  2WGO A;  4IPB A;  4HM3 B;  2R4I A;  4X2O A;  1MWS A;  2OOV A;  2IUK A;  2XSH B;  3SOA A;  5CXO A;  1UCJ A;  3OWS A;  3D79 A;  3STD A;  3HII A;  3X41 A;  5AII A;  3H51 A;  3CCM 3;  3CXC 2;  1BVI A;  4N3V A;  4GL6 A;  1J2B A;  5EQL A;  2C10 A;  3CCR 3;  1UW1 A;  4EV5 A;  4N6M A;  4WFO A;  3F7X A;  1U5O A;  1BNI A;  1GD3 A;  1OGX A;  1W02 A;  3IPT A;  3PYJ A;  5D82 A;  5IG0 A;  1N8R 4;  1DE3 A;  3ALA A;  1JB5 A;  2GU1 A;  3CCS 3;  1K8A 4;  3CCQ 3;  1JB2 A;  2CFW A;  1PFP A;  1CYU A;  4K1U A;  2STD A;  1W01 A;  2F98 A;  1GOY A;  1STF I;  3LT8 A;  1Q40 A;  5TGN A;  2GEY A;  1A67 A;  3ZG0 A;  1OUN A;  4R1K A;  2XSO B;  4MEI A;  2XH9 A;  5AEU B;  1JB4 A;  5G1L A;  1TTO A;  3SVA A;  1OF5 B;  4PEJ A;  1W2B 2;  2H0I A;  1KQS 2;  2IY2 A;  1ZX2 A;  3IJE B;  3OW2 2;  4HZB B;  4N6O B;  1K9M 4;  1RJO A;  4NHF A;  1JZO A;  4GHO A;  1JNQ A;  4AEQ A;  7RNT A;  1BNF A;  3GAX A;  2Q07 A;  4HM2 B;  5LC7 A;  2O3O A;  3ZFZ A;  2QIY A;  4RBN A;  3EC9 A;  1AQZ A;  3LML A;  1NWW A;  1OGZ A;  3FSD A;  4FMA A;  1W6C A;  3F9S A;  1E97 A;  1DMQ A;  3G0K A;  1BSA A;  1N9J A;  1LQG C;  3SYU A;  3Q2P A;  3WMD A;  1JJ2 2;  3QK9 A;  3MG1 A;  3SX1 A;  1HYF A;  2XRX B;  3DM8 A;  1B21 A;  3KZT A;  2HOH A;  3CPO A;  1OHS A;  4EBG A;  1QJG A;  2Z77 A;  1Q81 4;  1BAN A;  1ASK A;  2F56 A;  4ORL A;  1VQ5 3;  1DYU A;  3IMA B;  1W6G A;  3JUO A;  3G71 3;  1YIJ 3;  1RCK A;  1TU5 A;  1OHP A;  4AKY A;  2P0M A;  1I3I A;  3BNB A;  4N6U A;  2C4B A;  3OWU A;  1VQM 3;  1A2V A;  2FXT A;  4EW5 A;  1B2X A;  4WWU C;  3PS8 A;  4O2H A;  3AHW A;  3Q90 A;  3CD6 3;  1T5Y A;  1YI2 3;  1BRK A;  1X1W A;  1QMA A;  4IIA A;  4O02 B;  1IQ8 A;  1VQO 3;  1QVF 2;  3LTB A;  3CCU 3;  4HM7 B;  3EF8 A;  1I70 A;  1A90 A;  1I0V A;  1ISK A;  4LEH A;  1HZ1 A;  3KN4 A;  5CLK A;  2W9P A;  2BNG A;  4JF8 A;  4N6N B;  2CG1 A;  3T8U A;  5BIR A;  2KF5 A;  5DRE A;  4J5G A;  2W9Q A;  1O7M B;  2CIU A;  2KF6 A;  1OHO A;  2JDI H;  1O7G B;  1W4N A;  4KVH A;  2KXG A;  3B4P A;  2FGT A;  5CF1 A;  1VQ8 3;  3WOD G;  3V92 A;  1YVB I;  4HM1 B;  1X1Y A;  2CC3 A;  2GSP A; 
#chains in the Genus database with same CATH homology
 1ULI B;  2GU3 A;  2ML6 A;  4R9L A;  1CQS A;  1TFK A;  3GWR A;  4GB5 A;  1YIT 3;  4HM5 B;  5AIH A;  1JV2 B;  3RDE A;  1N5P A;  3VGN A;  2XGN A;  4LMI A;  4JRF A;  3VSY A;  1VQ7 3;  3HK4 A;  4L8P A;  1GY7 A;  3MWZ A;  2OTJ 3;  1Q42 A;  2CHC A;  5IG3 A;  1O7H B;  5EEO A;  3G4S 3;  4WYK A;  1VQ6 3;  1VQP 3;  3L0R A;  1EQK A;  3MKI A;  1TFO A;  3U97 A;  3A76 A;  1VZZ A;  3OV4 A;  1GS3 A;  1KWI A;  1O7N B;  1OAC A;  4NRE A;  1Z1S A;  4XBT A;  3I55 3;  3DGO A;  4H61 A;  2OOV C;  3JUP A;  3FG3 A;  2M7O A;  3LXU X;  1YHQ 3;  2RFR A;  1TP6 A;  1AVL A;  1JN5 B;  3FKA A;  4OVM A;  2OTL 3;  1DVC A;  2KRT A;  2LYX A;  1OH0 A;  3ECF A;  3KKG A;  2IA7 A;  4HZ9 B;  1KSI A;  3FG1 A;  3EBT A;  3S27 A;  3S28 A;  3U1W A;  1Q86 4;  3JVC A;  3NHX A;  3MPH A;  1RN7 A;  4U13 A;  3FF2 A;  4I4K A;  1GYB A;  3LTA A;  3DXO A;  5D81 A;  3NQZ A;  1R4C A;  1NDO B;  5I97 A;  5A0O B;  1N5H A;  2L4V A;  1ULJ B;  4EXR A;  1M9G A;  2PNC A;  1IVX A;  3PGB A;  3NV0 B;  4WFO A;  3EBY A;  1F8N A;  2OQE C;  4TX4 A;  6STD A;  2XFT A;  4FCZ A;  2CKF B;  3HI7 A;  1IK3 A;  3N8B A;  4FMB A;  1OCV A;  3EN1 B;  1M1K 4;  3N9H A;  3CCE 3;  2HMK B;  4KFD A;  4R80 A;  2K54 A;  5IG4 A;  1FUW A;  3UB1 A;  5EVH A;  3T0U A;  4BTY A;  5STD A;  3UL5 A;  2Z76 A;  1VQ9 3;  2OCT A;  3WOF B;  2Z7A A;  1DVD A;  1LXE A;  1YGE A;  1US1 A;  1JRQ A;  1WMN A;  1FGM A;  2W03 A;  4FCM A;  4XM4 A;  3V99 A;  3FF0 A;  3WA3 A;  5FW5 A;  1W5Z A;  3NXJ A;  1JKG A;  2RGQ A;  2SBL A;  3BB9 A;  2YFJ B;  1MOL A;  3TDG A;  3SXX A;  3JUN A;  4IT7 A;  2OWP A;  3X3X A;  2E2V A;  3K9M C;  1C7H A;  1NJI 4;  5DRV A;  4L7K A;  4RZM A;  2Y74 A;  3BND A;  3EE1 A;  3WDG B;  4WHA A;  2BMR B;  2ML5 A;  4G1M B;  1K73 4;  3PZW A;  1E3R A;  5IEO A;  1WQL B;  1VQL 3;  3EHC A;  2BO9 B;  2YFL B;  3NX0 A;  1SIH A;  1TIJ A;  3BNE A;  1KC8 4;  1AR0 A;  2I9W A;  3FG4 A;  3MG2 A;  3CNM A;  4MMY B;  3E99 A;  2WOF A;  5D83 A;  2IUJ A;  4KFE A;  1ROA A;  3BNC A;  2CFG A;  3NM2 A;  1V74 A;  2KCD A;  3NUV A;  4X2H A;  1OPY A;  2HMJ B;  1SQW A;  5AEW B;  2QEX 3;  1RRH A;  3KE7 A;  4LSO A;  2XF3 A;  2W2C A;  3NV0 A;  1DMM A;  2O9U X;  1EA2 A;  3CC2 3;  4LGQ A;  5IEP A;  1BUQ A;  2A15 A;  1VQ4 3;  3N54 B;  3D3L A;  3SLU A;  4XDW A;  3EQQ B;  1IV9 A;  1CEW I;  1W6Y A;  4O3V A;  3G8Z A;  1UI8 A;  3KFQ C;  3F40 A;  3F7S A;  5AI1 A;  1LVN A;  1NU3 A;  1D6U A;  1NB5 I;  2PZV A;  2E2T A;  2OQE A;  5CF2 A;  2WGQ A;  2HMN B;  1E3V A;  2GXF A;  2P38 A;  3CU3 A;  2HMO B;  1Y4K A;  1O7P B;  3GZR A;  3CCV 3;  3SED A;  3KSE D;  3NBR A;  1N9E A;  1AV4 A;  4KFF A;  1QVG 2;  1K28 A;  1JKG B;  3LYG A;  3RGA A;  3NBJ A;  1EKM A;  4XBY A;  8CHO A;  4WP5 A;  1WNH A;  4XBX A;  3CPW 2;  5ELJ A;  3NM7 A;  1WMO A;  3FCS B;  5BVB A;  1SJW A;  1ZO2 A;  4MMZ B;  2XR8 B;  4ZM8 A;  2CK3 H;  3CMA 3;  3EX9 A;  2XEP A;  3K63 A;  1GD4 A;  2XGL A;  2P09 A;  3Q1C A;  1DMN A;  3FGY A;  1SII A;  1UUW B;  4CDL A;  3JUQ A;  3VF1 A;  2W56 A;  4AKZ A;  1W7C A;  4BTX A;  1W00 A;  4FMC A;  4K1V A;  3T8N A;  4HM6 B;  2CWU A;  2CFD A;  3DGM A;  3CC7 3;  3DMC A;  2GEX A;  2INX A;  3CCJ 3;  3HZP A;  3WOE B;  2CH9 A;  1LNH A;  3BLZ A;  3ER7 A;  4HM0 B;  3HIG A;  3FLJ A;  1O7W B;  3PCR A;  4Q53 A;  5AIG A;  1S5A A;  2XFS A;  3DZL A;  3V98 A;  1QAF A;  1U8C B;  2BHM A;  3M8C A;  4XB5 A;  4O8S A;  4FR9 A;  1A2K A;  2B24 B;  1IVU A;  2MC8 A;  4MJD A;  3GZY B;  2YX9 A;  1SPU A;  5BXQ A;  4H3U A;  3MYT A;  4J9A A;  3DGL A;  1IVV A;  2RCD A;  3K5T A;  1UI7 A;  5CK6 A;  1LOX A;  4XDV A;  3MHE A;  5IG5 A;  3FZW A;  3NQY A;  3I56 3;  7STD A;  1ROV A;  1K41 A;  2IMJ A;  1D6Y A;  1IV7 A;  5AYR B;  2FNQ A;  3X42 A;  1NB3 I;  3DGN A;  1QAK A;  1PU4 A;  3JUM A;  3LTC A;  3X3Y A;  3PCS A;  4HVN A;  3KII A;  4EV2 A;  2BT3 A;  1WMP A;  1IU7 A;  3MG3 A;  4KZ1 A;  5G2G A;  1FA3 A;  1M90 4;  4N6V 0;  1Q82 4;  4FMD A;  1IT8 A;  4R9K A;  1HKX A;  2GBX B;  3EJV A;  4QWT A;  5HGR A;  5KP3 A;  3G16 A;  2CW9 A;  1GY5 A;  1IDP A;  4FCJ A;  5LC6 A;  1WTH A;  4HM4 B;  1YJ9 3;  5ELU A;  2C11 A;  2P0X A;  3GZX B;  2B1X B;  1FGR A;  1MNL A;  2W04 A;  3UNL A;  3J7Y d;  1NO3 A;  2YFI B;  2V1L A;  3KSP A;  2JQ5 A;  2E2U A;  3EN8 A;  4STD A;  2Y73 A;  2WOH A;  4N6T A;  1KD1 4;  2K0M A;  3MSO A;  4MMX B;  3F8H A;  1IT7 A;  4BTW A;  2QGU A;  3OXA A;  3OX9 A;  4K90 B;  1AVK A;  2BMQ B;  5JPU A;  2ZL8 A;  2CG0 A;  1FGT A;  2D42 A;  2W6J H;  3ROB A;  2Z6B A;  3OWY A;  1N8Q A;  3CC4 3;  3G6E 3;  3PXM A;  3RGR A;  1UUV B;  2CFK A;  3AMO A;  1HU9 A;  4HKV B;  3F8X A;  2MF7 A;  2UX0 A;  4HBR A;  1RKY A;  1D6Z A;  3GZB A;  2W0Q A;  5AIF A;  5IER A;  4OUQ A;  3K7C A;  1RRL A;  4J8T A;  1Q7Y 4;  3GRD A;  1STD A;  4RNY A;  2QA4 3;  2WO0 A;  1EG9 B;  4EC6 A;  5KP4 A;  5IF6 A;  3LTD A;  4RNZ A;  3F14 A;  4EYC A;  3S29 A;  2BMO B;  1W2Z A;  1FGO A;  3X3Z A;  3B4O A;  5IW9 A;  3H3H A;  3HX8 A;  3EB8 A;  3X40 A;  3LOY A;  3D9R A;  4OK0 A;  2CWT A;  3CNX A;  5JPP A;  1GY6 A;  4R4K A;  4L8O A;  3DUK A;  1FGQ A;  1IQX A;  3CME 3;  3SOY A;  1VQN 3;  2P05 A;  2HMM B;  3LH4 A;  3S67 A;  1YJN 3;  1YJW 3;  1Q40 B;  2W56 B;  3QRD A;  3LZA A;  4LZI A;  2CWV A;  1VQK 3;  1OF5 A;  2F86 B;  3DY5 A;  1QAL A;  2CFL A;  3B7C A;  3K0Z A;  4HJL B;  4CCV A;  3NBB A;  1M1X B;  3FH1 A;  4WYK B;  1G96 A;  3AMO B;  4HYZ A;  3O8Y A;  2ZDJ A;  2F99 A;  2GBW B;  3LT9 A;  1IVW A;  2D1W A;  1IQY A;  3WA2 X;  4HM8 B;  2HML B;  3I0Y A;  1S72 3;  3B8L A;  1CYV A;  4N6L A;  3CCL 3;  2RSX A;  5AYS C;  5JBS A;  1JN5 A;  5IEN A;  5FGO A;  3UJM A;  1L5G B;  3S5C A;  1TUH A;  4K61 A;  2LQV A;  5KP1 A;  3UL6 A;  2WGO A;  4IPB A;  4HM3 B;  2R4I A;  4X2O A;  2OOV A;  2IUK A;  2XSH B;  3SOA A;  5CXO A;  3OWS A;  3STD A;  3HII A;  3X41 A;  5AII A;  3H51 A;  3CCM 3;  3CXC 2;  4N3V A;  1J2B A;  4GL6 A;  5EQL A;  2C10 A;  3CCR 3;  1UW1 A;  4EV5 A;  4N6M A;  3F7X A;  1U5O A;  1OGX A;  1GD3 A;  1W02 A;  3IPT A;  3PYJ A;  5D82 A;  5IG0 A;  1N8R 4;  3ALA A;  1JB5 A;  2GU1 A;  3CCS 3;  1K8A 4;  3CCQ 3;  1JB2 A;  2CFW A;  1PFP A;  1CYU A;  4K1U A;  2STD A;  1W01 A;  2F98 A;  3LT8 A;  1STF I;  1Q40 A;  5TGN A;  2GEY A;  1A67 A;  1OUN A;  4R1K A;  2XSO B;  4MEI A;  2XH9 A;  5AEU B;  1JB4 A;  3SVA A;  1OF5 B;  4PEJ A;  1W2B 2;  1KQS 2;  3IJE B;  1ZX2 A;  1K9M 4;  3OW2 2;  4HZB B;  4N6O B;  1RJO A;  4NHF A;  1JNQ A;  4AEQ A;  3GAX A;  2Q07 A;  4HM2 B;  5LC7 A;  2O3O A;  2QIY A;  4RBN A;  3EC9 A;  3LML A;  1NWW A;  1OGZ A;  3FSD A;  4FMA A;  1W6C A;  3F9S A;  1E97 A;  1DMQ A;  3G0K A;  3WMD A;  1N9J A;  1JJ2 2;  3Q2P A;  3QK9 A;  3MG1 A;  3SX1 A;  2XRX B;  3DM8 A;  3KZT A;  3CPO A;  1OHS A;  4EBG A;  1QJG A;  2Z77 A;  1Q81 4;  1ASK A;  4ORL A;  1VQ5 3;  1DYU A;  3IMA B;  1W6G A;  3JUO A;  3G71 3;  1YIJ 3;  1TU5 A;  1OHP A;  4AKY A;  2P0M A;  3BNB A;  4N6U A;  3OWU A;  1VQM 3;  1A2V A;  2FXT A;  4WWU C;  3PS8 A;  4O2H A;  3Q90 A;  3CD6 3;  1T5Y A;  1YI2 3;  1QMA A;  4IIA A;  4O02 B;  1IQ8 A;  1VQO 3;  1QVF 2;  3LTB A;  3CCU 3;  4HM7 B;  3EF8 A;  1A90 A;  1ISK A;  4LEH A;  3KN4 A;  5CLK A;  2W9P A;  2BNG A;  4JF8 A;  4N6N B;  2CG1 A;  3T8U A;  5DRE A;  2W9Q A;  1O7M B;  2CIU A;  1OHO A;  2JDI H;  1O7G B;  1W4N A;  4KVH A;  2KXG A;  3B4P A;  2FGT A;  5CF1 A;  1VQ8 3;  3WOD G;  3V92 A;  1YVB I;  4HM1 B;  2CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...