1YVBI

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
RLLGAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords falcipain 2
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yvbI00
3UL5A 3IMAB 1M9GA 1STFI 1FA3A 3PS8A 3UL6A 4N6OB 1N5HA 1MNLA 2W9PA 4N6TA 1ROAA 1N9JA 1R4CA 1CYVA 4CCVA 1MOLA 1NB5I 1PFPA 1WNHA 5LC6A 4N6LA 2OCTA 3QRDA 4TX4A 4EYCA 1KWIA 4N6UA 1CYUA 3Q2PA 4ZM8A 1GD3A 3MWZA 1NB3I 5ELUA 1G96A 4N6NB 1DVDA 3KSED 2CH9A 1DVCA 5EQLA 3PXMA 1IV7A 1CEWI 3SVAA 3GAXA 1LXEA 1A67A 2W9QA 3L0RA 5LC7A 3KFQC 3LH4A 3S67A 2O9UX 4IT7A 4N6MA 1FUWA 3PYJA 5ELJA 4LZIA 1EQKA 2BO9B 1IV9A 1YVBI 1GD4A 3NX0A 5A0OB 1RN7A 2KXGA 3K9MC 4N6V0 1N5PA 1A90A 1TIJA
chains in the Genus database with same CATH superfamily
1VQ73 1O7WB 2GBWB 4GL6A 1MWSA 2XFSA 1AVLA 1NO3A 3MKIA 3UL5A 1RTUA 2UX0A 1BRGA 1GY7A 1K9M4 3EN8A 1B20A 5M19A 4ILFA 1T3BA 1PY3A 2V1LA 3F8XA 3CD63 1RN4A 4KT3B 4OK0A 1Q42A 3K5TA 4XBYA 2K0MA 3NUVA 3SX1A 1BSAA 3BNDA 3KE7A 3I553 2YFLB 3T0UA 4O3VA 3WHOA 3RGRA 4LSOA 1HU9A 2HMJB 2OQEC 3JUQA 4N6TA 2INXA 3BNEA 2XGNA 1DMMA 3S27A 1BSEA 1ROAA 3D3LA 1IYYA 1WQLB 1AVKA 1IVUA 3MG1A 1OHOA 2HMKB 1BRKA 4MMYB 4CCVA 1E3VA 2Z7AA 1QVG2 3M8CA 1WNHA 1W2B2 4N6LA 1GMPA 5AI1A 1RGKA 1BOXA 2SARA 1W2ZA 1TTOA 1KWIA 1JZOA 3NV0B 2XGLA 5HGRA 3EBYA 4BL2A 2KF5A 4EBGA 2M7OA 3GZRA 1RLSA 4JRFA 4ZM8A 5M18A 1YJ93 1YVSA 3K0ZA 3OWSA 2OOVA 4FCZA 1GD3A 3RGAA 3MWZA 4MMZB 1NB3I 2FXTA 5CF1A 2F4YA 3G713 5DRVA 1FGTA 4HM0B 1I0XA 1FGRA 4IIAA 1BNJA 4DKIA 1UGIA 1VQQA 3A5EA 1M1K4 1DVCA 1BVIA 2JQ5A 1Q7HA 1ZO2A 2AAEA 3FH1A 3PXMA 4HOHA 3NBRA 4J8TA 4XDVA 2F56A 3OWUA 3DZLA 3AHWA 1WTHA 4HM1B 3EF8A 3LTDA 2Z6BA 2RBIA 3X40A 3BIRA 3VSYA 7RNTA 1VQ53 4CDLA 1JB2A 1LXEA 3ZFZA 3WOEB 2K54A 1F8NA 1O7NB 1B21A 3B8LA 1CQSA 2HMMB 2C10A 3FSDA 5LC7A 3VGNA 1JN5B 5M1AA 5IEPA 4HM5B 3S29A 3DM8A 3KFQC 4OUQA 3N8BA 1VQ63 1MWRA 2WGQA 4N3VA 1KD14 2RNTA 1UI8A 4L7KA 3DGOA 1TFKA 2C11A 2QEX3 4O02B 3OV4A 6GSPA 2A15A 3NBBA 4N6MA 3U1WA 5IENA 3BB9A 1JRQA 1FUWA 3PYJA 3LOYA 3MSOA 1RGEA 1BRNL 1I3FA 1K8A4 1GS3A 1Q9EA 1UUVB 1IVWA 2CFWA 1YVBI 3HI7A 4BIRA 1GD4A 1SPUA 3F7SA 3BNBA 1GOUA 1TP6A 1TU5A 3OW22 4J5KA 1GYBA 3SLUA 4HM6B 1W5ZA 3ROBA 2B1XB 4OVMA 2HMNB 4XBXA 3K9MC 2HMOB 3F7XA 1Q814 4G1MB 2W04A 1O7HB 1VQM3 1JKGB 4FCMA 1A90A 1TIJA 3HOHA 4XDWA 1T2IA 3CPOA 3F9SA 2L4VA 4NHFA 2IUKA 1RGGA 1UI7A 3KSPA 1UUGB 1M9GA 3LXUX 4RZMA 3ER7A 3WR2A 1Q40B 1FUTA 1SARA 2OWPA 4Q53A 2F86B 3PCRA 1RN1A 2STDA 2HMLB 1RDSA 1STFI 1K41A 1OHSA 3GRDA 1FA3A 5G2GA 1W01A 1T5YA 5G1LA 1LNIA 3DY5A 1TUHA 2BMOB 2CG1A 3NXJA 3SOYA 4BTXA 1RMSA 3WDGB 1HZ1A 4N6OB 3NV0A 1X1UA 4PEJA 1YIJ3 2B24B 2CG0A 4HKVB 1GMRA 3JUMA 1X1WA 2CX1A 2F5MA 3NQYA 4AEQA 1TJDA 1IQYA 1I70A 4J5GA 4L8PA 1R4CA 3SOAA 1S723 1SIIA 2BT3A 2HOHA 2OQEA 2QIYA 1MOLA 1AV4A 1JV2B 3GZYB 4KFEA 3UNLA 1ROVA 1A2PA 1RKYA 1YJN3 1TFOA 1NNVA 4K90B 4WP5A 3SYUA 2CK3H 4I4KA 5IW9A 1RGFA 1QAKA 5IG0A 2GEYA 2WGOA 5D83A 1C54A 4EYCA 1V74A 1BUQA 2W0QA 4KFDA 2CWTA 3AMOB 4HM8B 2KF3A 3MG2A 3AGNA 4I5QA 1OGXA 1RNBA 2XRXB 1W6CA 5CK6A 3KZTA 2O3OA 1BNFA 1G96A 1JNQA 3O8YA 2IY2A 1N8R4 3RNTA 1I8VA 2R41A 1RGCA 1DVDA 1W6YA 5STDA 8CHOA 3WODG 3CCV3 5AIFA 1I2GA 1RGHA 3LZAA 2E2UA 4LYLB 1A2VA 2H0IA 1PU4A 8RNTA 2XEPA 3LTCA 4K61A 3CCJ3 3SVAA 4KFFA 1YJW3 3DGLA 4WYKA 1RCKA 1AQZA 2UGIA 3V98A 4O2HA 1OUNA 5I97A 3CPW2 1EA2A 3CNMA 3BLZA 3G6E3 3DGYA 3IPTA 3OWYA 3D79A 2D42A 1G02A 3V99A 4CPKA 2O9UX 1W02A 1I2EA 1UCLA 3KKGA 2IUJA 3HZPA 1FUSA 3KCHA 1BSCA 1VZZA 2P09A 1FGMA 1FZUA 3WA2X 3GZXB 1RSNA 2PZVA 4AKYA 3CCS3 1Q7Y4 4HVNA 2BIRA 1JB5A 5ELJA 2MF7A 3CCE3 3F40A 1UCIA 1BRHA 1PYLA 2BO9B 1W00A 1YGEA 5IF6A 1JKGA 3T8NA 5EEOA 2KAAA 1V58A 4HM2B 2Y73A 2KF4A 4EW5A 1B3SA 7GSPA 1QVF2 2IMJA 1B2ZA 1BNGA 3FKAA 2GU1A 5TGNA 1LOXA 2CFLA 1DYUA 3ALAA 1DE3A 1IK3A 1LOWA 6RNTA 2CKFB 3CCU3 3RDEA 4MEIA 4R9LA 2J8XB 5AEUB 4FMAA 1YGWA 2Q07A 1WMOA 4FMBA 5BIRA 5IERA 3F14A 3GSPA 2GU3A 3NQZA 1DMQA 1BSBA 2CWUA 4XBTA 4BU4A 3LTBA 1GSPA 1KC84 2GSPA 1KQS2 2P38A 2WOHA 1N5PA 1OH0A 1OF5A 1BNIA 3AGOA 1IQXA 3JVCA 2WO0A 9RNTA 3NHXA 1LRAA 1LOVA 3DH2A 2R4IA 1Z1SA 3FG3A 3CC73 2Z77A 1VQ83 2AADA 1WMNA 1ULJB 4JF8A 2H0HA 1FGOA 3DUKA 1M1XB 1GOYA 1MGWA 3GZBA 3Q1CA 2E2TA 5JBSA 1JBRA 3UL6A 2KCDA 1OHPA 2BHMA 5AIIA 1G0TA 1MNLA 1N5HA 1U5OA 2XSHB 4BTWA 3EBTA 1T2HA 3KN4A 4HZ9B 3PGBA 3NM7A 1GMQA 1NDOB 2JDIH 4WWUC 3V92A 1IU7A 1N9JA 3WA3A 1CYVA 1B2SA 1O7PB 1IT7A 2UUGC 1JJ22 1NB5I 1X1XA 2RSXA 2CHCA 1PFPA 4XM4A 4HYZA 2XH9A 2KRTA 3JUNA 3CNXA 1KSIA 3FCSB 2OCTA 3QRDA 5AYRB 6STDA 1EEJA 2I9WA 2Y74A 1CH0A 1Q824 1FYSA 5G1KA 4RNZA 1UDII 5HOHA 1CYUA 1I3IA 2QGUA 3FGYA 3HX8A 3Q2PA 2CFDA 4R4KA 4KZ1A 2RGQA 2QA43 5DREA 1TRPA 2BMRB 1EG9B 3HK4A 4MMXB 5KP3A 2C4BA 3DGMA 3J7Yd 4H61A 3OX9A 3KSED 3UB1A 1EKMA 5EQLA 4RBNA 5IG4A 2IA7A 1BRIA 3X3XA 2W56B 1UCJA 3LMLA 1VQK3 5RNTA 5AEWB 3H51A 4QWTA 3EQQB 1OCVA 5JPPA 4LEHA 1IV7A 3CCL3 1UW1A 3N54B 3X41A 3DXOA 2XFTA 3WOFB 2GBXB 3B4PA 4FMDA 1E3RA 3X3YA 5KP1A 4RNYA 1M904 4IPBA 3PZWA 3B4OA 2BNGA 1SQWA 4XB5A 2LYXA 2F98A 1BSDA 3S67A 1D6UA 2KF6A 3KIIA 3U97A 4HZBB 2H0GA 3HIGA 4IT7A 1IQ8A 2D1WA 1JN5A 3LYGA 3PCSA 3CC43 2SBLA 2CIUA 2XSOB 4FR9A 4HM3B 3MPHA 1YI23 3CXC2 3N9HA 1ASKA 5IG5A 3FF0A 3CCQ3 1MGRA 1NJI4 3G0KA 1FW7A 2PNCA 1OGZA 3EC9A 1MWTA 3OXAA 4K1VA 1B2XA 3LT9A 1O7GB 3NX0A 5A0OB 1W6GA 1C7HA 3WMDA 1NWWA 1RN7A 1YNVX 4H3UA 5AIGA 4BTYA 2KXGA 3CMA3 3IJEB 2GXFA 1A2KA 2W2CA 3URPA 2P05A 2OTL3 1W4NA 5IG3A 1JBSA 1BGSA 1VQ43 1LQMB 2YFIB 3DMCA 3FG4A 4HAAA 3EB8A 1BUJA 1ZGXA 3CU3A 1QALA 3FF2A 4CJNA 1RJOA 4BL3A 5KP4A 3D5IA 2F5WA 1E97A 4MJDA 1YIT3 1OPYA 1JB4A 3IMAB 1L5GB 2IYJA 1IT8A 1ZX2A 2RCDA 3JUPA 3G8ZA 1VQN3 2CFKA 4NREA 4EXRA 1LVNA 5AYSC 3BU4A 1RRLA 1BNSA 1MWUA 3AHSA 1Q40A 3PS8A 3LT8A 1US1A 2FNQA 5BU4A 1BRJA 3H3HA 2K3DA 1HKXA 3FG1A 3EE1A 3E99A 3K7CA 5EVHA 1ULIB 2W9PA 5CXOA 3X42A 1D6YA 1I2FA 1D6ZA 2P0MA 3K63A 4HBRA 1IVVA 2CW9A 1QAFA 3D9RA 1JZDA 3S5CA 3ECFA 4KVHA 1V57A 3G4S3 4GHOA 4LMIA 5BXQA 3EN1B 1IDPA 2YX9A 5LC6A 1BANA 1ZS7A 4EC6A 5D81A 2W56A 2OOVC 1B2MA 4TX4A 5IEOA 4WHAA 1LQGC 1AR0A 1LNHA 2CWVA 2BMQB 1DETA 4N6UA 4X2OA 3CCM3 1VQO3 4O8SA 1RCLA 3NM2A 1IVXA 1O7MB 1STDA 3Q3FA 3Q90A 3I0YA 3A76A 3FLJA 1Y4KA 3JUOA 5ELUA 3S28A 1BIRA 3AMOA 5FGOA 4EV2A 3MYTA 4HJLB 3HIIA 4N6NB 3CME3 1BNRA 4FMCA 1N8QA 3EHCA 2MC8A 1VQP3 1VQL3 2CH9A 3DGNA 1RRHA 1UUWB 1W7CA 4WFOA 2F99A 1EUIC 4L8OA 4X2HA 3UJMA 4WYKB 1BAOA 1HYFA 2Z76A 4HM4B 3MHEA 1QJGA 4J9AA 1YHQ3 3G16A 1SIHA 1CEWI 2ZA4A 3BNCA 4HM7B 5CLKA 1Q864 3GAXA 5D82A 2W9QA 2GEXA 2WOFA 2ZL8A 2P0XA 3NBJA 1GOVA 1GY6A 2ZDJA 3L0RA 2RFRA 3SEDA 2LQVA 1VQ93 3TDGA 3CC23 4ORLA 3LH4A 1I0VA 3GWRA 1BNEA 1AY7A 1BRSA 3QK9A 2CFGA 5JPUA 1B27A 1S5AA 3MG3A 3CCR3 1OACA 1QMAA 1RNTA 2BU4A 4STDA 1GY5A 1N9EA 2CC3A 2CX0A 2ML6A 5BVBA 1UCKA 4LZIA 2W03A 4GSPA 1K734 1EQKA 1B2UA 4U13A 1UGHI 1J2BA 1RHLA 3D5GA 3B7CA 1U8CB 4GB5A 5AIHA 3T8UA 4NPBA 3EX9A 3SXXA 1K28A 4R80A 1IV9A 3F8HA 1LOYA 3STDA 5GSPA 1DMNA 1TRQA 1JBTA 1FGQA 2FGTA 3LTAA 4EV5A 2ML5A 3D4AA 1SJWA 4R9KA 2YFJB 5FW5A 1A67A 1RGLA 2ZHXB 4AKZA 2OTJ3 1WMPA 1OF5B 1X1YA 3ZG0A 1ISKA 2XF3A 4K1UA 4LGQA 3ZG5A 7STDA 3VF1A 4R1KA 4RNTA 4N6V0 3EJVA 3FZWA 5CF2A 3I563 1BU4A 1RGAA 2XR8B 3X3ZA 1R4YA 2E2VA 2L1SA 4FCJA 2W6JH 1NU3A
chains in the Genus database with same CATH topology
1VQ73 1O7WB 2GBWB 4GL6A 2XFSA 1AVLA 1NO3A 3MKIA 3UL5A 2UX0A 1GY7A 1K9M4 3EN8A 2V1LA 3F8XA 3CD63 4OK0A 1Q42A 3K5TA 4XBYA 2K0MA 3NUVA 3SX1A 3BNDA 3KE7A 3I553 2YFLB 3T0UA 4O3VA 3RGRA 4LSOA 1HU9A 2HMJB 2OQEC 3JUQA 4N6TA 2INXA 3BNEA 2XGNA 1DMMA 3S27A 1ROAA 3D3LA 1WQLB 1AVKA 1IVUA 3MG1A 1OHOA 2HMKB 4MMYB 4CCVA 1E3VA 2Z7AA 1QVG2 3M8CA 1WNHA 1W2B2 4N6LA 5AI1A 1W2ZA 1KWIA 3NV0B 2XGLA 5HGRA 3EBYA 4EBGA 2M7OA 3GZRA 4JRFA 1YJ93 4ZM8A 3K0ZA 3OWSA 2OOVA 4FCZA 1GD3A 3RGAA 3MWZA 4MMZB 1NB3I 2FXTA 5CF1A 3G713 5DRVA 1FGTA 4HM0B 1FGRA 4IIAA 1M1K4 1DVCA 2JQ5A 3J7Yd 1ZO2A 3FH1A 3PXMA 3NBRA 4J8TA 4XDVA 3OWUA 3DZLA 1WTHA 4HM1B 3EF8A 3LTDA 2Z6BA 3X40A 3VSYA 1VQ53 4CDLA 1JB2A 1LXEA 3WOEB 2K54A 1F8NA 1O7NB 3B8LA 1CQSA 2HMMB 2C10A 3FSDA 5LC7A 3VGNA 1JN5B 5IEPA 4HM5B 3S29A 3DM8A 3KFQC 4OUQA 3N8BA 1VQ63 2WGQA 4N3VA 1KD14 1UI8A 4L7KA 3DGOA 1TFKA 2C11A 2QEX3 4O02B 3OV4A 2A15A 3NBBA 4N6MA 3U1WA 5IENA 3BB9A 1JRQA 1FUWA 3PYJA 3LOYA 3MSOA 1K8A4 1GS3A 1UUVB 1IVWA 2CFWA 1YVBI 3HI7A 1GD4A 1SPUA 3F7SA 3BNBA 1TP6A 1TU5A 3OW22 1GYBA 3SLUA 4HM6B 1W5ZA 3ROBA 2B1XB 4OVMA 2HMNB 4XBXA 3K9MC 2HMOB 3F7XA 1Q814 4G1MB 2W04A 1O7HB 1VQM3 1JKGB 4FCMA 1A90A 1TIJA 4XDWA 3CPOA 3F9SA 2L4VA 4NHFA 2IUKA 3KSPA 1UI7A 3LXUX 4RZMA 1M9GA 3ER7A 1Q40B 2OWPA 4Q53A 2F86B 3PCRA 2STDA 2HMLB 1STFI 1K41A 1OHSA 3GRDA 1FA3A 5G2GA 1W01A 1T5YA 3DY5A 1TUHA 2BMOB 2CG1A 3NXJA 3SOYA 4BTXA 3WDGB 4N6OB 3NV0A 4PEJA 1YIJ3 2B24B 2CG0A 4HKVB 3JUMA 4AEQA 3NQYA 1IQYA 4L8PA 1R4CA 3SOAA 1S723 1SIIA 2BT3A 2OQEA 2QIYA 1MOLA 1AV4A 1JV2B 3GZYB 4KFEA 3UNLA 1ROVA 1RKYA 1YJN3 1TFOA 4K90B 4WP5A 2CK3H 4I4KA 5IW9A 5IG0A 1QAKA 2GEYA 2WGOA 5D83A 4EYCA 1V74A 1BUQA 2W0QA 4KFDA 2CWTA 3AMOB 4HM8B 3MG2A 1OGXA 2XRXB 1W6CA 5CK6A 3KZTA 2O3OA 1G96A 1JNQA 3O8YA 1N8R4 1DVDA 1W6YA 5STDA 8CHOA 3WODG 3CCV3 5AIFA 3LZAA 2E2UA 1A2VA 1PU4A 2XEPA 3LTCA 4K61A 3CCJ3 3SVAA 4KFFA 1YJW3 3DGLA 4WYKA 3V98A 4O2HA 1OUNA 5I97A 3CPW2 1EA2A 3CNMA 3BLZA 3G6E3 3IPTA 3OWYA 2D42A 3V99A 2O9UX 1W02A 3KKGA 2IUJA 3HZPA 1VZZA 2P09A 1FGMA 3WA2X 4AKYA 3GZXB 2PZVA 3CCS3 1Q7Y4 4HVNA 1JB5A 5ELJA 2MF7A 3CCE3 3F40A 2BO9B 1W00A 1YGEA 5IF6A 1JKGA 3T8NA 5EEOA 4HM2B 2Y73A 1QVF2 2IMJA 3FKAA 2GU1A 5TGNA 1LOXA 2CFLA 3ALAA 1DYUA 1IK3A 2CKFB 3CCU3 3RDEA 4MEIA 4R9LA 5AEUB 4FMAA 2Q07A 1WMOA 4FMBA 5IERA 3F14A 3NQZA 2GU3A 1DMQA 2CWUA 4XBTA 3LTBA 1KC84 1KQS2 2P38A 2WOHA 1N5PA 1OH0A 1OF5A 3JVCA 1IQXA 2WO0A 3NHXA 2R4IA 1Z1SA 3FG3A 3CC73 2Z77A 1VQ83 1WMNA 1ULJB 4JF8A 1FGOA 3DUKA 1M1XB 3GZBA 3Q1CA 2E2TA 5JBSA 3UL6A 2KCDA 1OHPA 2BHMA 5AIIA 1N5HA 1MNLA 1U5OA 2XSHB 4BTWA 3EBTA 3KN4A 4HZ9B 3PGBA 3NM7A 4WWUC 1NDOB 2JDIH 3V92A 1IU7A 1N9JA 3WA3A 1CYVA 1O7PB 1JJ22 1IT7A 1NB5I 2RSXA 2CHCA 1PFPA 4XM4A 4HYZA 2XH9A 2KRTA 3JUNA 3CNXA 1KSIA 3FCSB 2OCTA 3QRDA 5AYRB 6STDA 1Q824 2I9WA 2Y74A 4RNZA 1CYUA 2QGUA 3FGYA 3HX8A 3Q2PA 2CFDA 4R4KA 4KZ1A 2RGQA 2QA43 5DREA 2BMRB 1EG9B 3HK4A 4MMXB 5KP3A 3DGMA 4H61A 3OX9A 3KSED 3UB1A 1EKMA 5EQLA 4RBNA 5IG4A 2IA7A 3X3XA 2W56B 3LMLA 1VQK3 5AEWB 3H51A 4QWTA 3EQQB 1OCVA 5JPPA 4LEHA 1IV7A 3CCL3 1UW1A 3N54B 3X41A 3DXOA 2XFTA 3WOFB 2GBXB 3B4PA 4FMDA 1E3RA 3X3YA 5KP1A 4RNYA 1M904 4IPBA 3PZWA 3B4OA 2BNGA 1SQWA 4XB5A 2LYXA 2F98A 3S67A 1D6UA 3U97A 3KIIA 4HZBB 3HIGA 4IT7A 1IQ8A 2D1WA 1JN5A 3LYGA 3PCSA 3CC43 2SBLA 2CIUA 2XSOB 4FR9A 4HM3B 3MPHA 1YI23 3CXC2 3N9HA 1ASKA 5IG5A 3FF0A 3CCQ3 1NJI4 3G0KA 2PNCA 1OGZA 3EC9A 3OXAA 4K1VA 3LT9A 1O7GB 3NX0A 5A0OB 1C7HA 1W6GA 3WMDA 1NWWA 1RN7A 5AIGA 4H3UA 4BTYA 2KXGA 3CMA3 3IJEB 2GXFA 1A2KA 2W2CA 2P05A 2OTL3 1W4NA 5IG3A 1VQ43 2YFIB 3DMCA 3FG4A 3EB8A 3CU3A 1QALA 3FF2A 1RJOA 5KP4A 1E97A 4MJDA 1YIT3 1OPYA 1JB4A 3IMAB 1L5GB 1IT8A 1ZX2A 2RCDA 3JUPA 3G8ZA 1VQN3 2CFKA 4NREA 4EXRA 1LVNA 5AYSC 1RRLA 1Q40A 3PS8A 3LT8A 1US1A 2FNQA 3H3HA 1HKXA 3FG1A 3EE1A 3E99A 3K7CA 5EVHA 1ULIB 2W9PA 5CXOA 3X42A 1D6YA 2P0MA 1D6ZA 3K63A 4HBRA 1IVVA 2CW9A 1QAFA 3D9RA 3S5CA 3ECFA 4KVHA 3G4S3 4LMIA 5BXQA 3EN1B 1IDPA 2YX9A 5LC6A 4EC6A 5D81A 2W56A 2OOVC 4TX4A 5IEOA 4WHAA 1AR0A 1LNHA 2CWVA 2BMQB 4N6UA 4X2OA 3CCM3 1VQO3 4O8SA 3NM2A 1IVXA 1O7MB 1STDA 3Q90A 3I0YA 3A76A 3FLJA 1Y4KA 3JUOA 5ELUA 3S28A 3AMOA 5FGOA 4EV2A 3MYTA 4HJLB 3HIIA 4N6NB 3CME3 4FMCA 1N8QA 3EHCA 2MC8A 1VQP3 1VQL3 2CH9A 3DGNA 1RRHA 1UUWB 1W7CA 4WFOA 2F99A 4L8OA 4X2HA 3UJMA 4WYKB 2Z76A 4J9AA 1YHQ3 4HM4B 3MHEA 1QJGA 3G16A 1SIHA 1CEWI 3BNCA 4HM7B 5CLKA 1Q864 3GAXA 5D82A 2W9QA 2GEXA 2WOFA 2ZL8A 2P0XA 3NBJA 1GY6A 2ZDJA 1A67A 3L0RA 2RFRA 3SEDA 2LQVA 1VQ93 3TDGA 3CC23 4ORLA 3LH4A 3GWRA 3QK9A 5JPUA 2CFGA 1S5AA 3MG3A 3CCR3 1OACA 1QMAA 4STDA 1GY5A 1N9EA 2CC3A 5BVBA 2ML6A 4LZIA 2W03A 1K734 1EQKA 4U13A 1J2BA 3B7CA 1U8CB 4GB5A 5AIHA 3T8UA 3EX9A 3SXXA 1K28A 4R80A 1IV9A 3F8HA 3STDA 1DMNA 1FGQA 2FGTA 3LTAA 4EV5A 2ML5A 1SJWA 4R9KA 2YFJB 5FW5A 4AKZA 2OTJ3 1WMPA 1OF5B 1ISKA 2XF3A 4K1UA 4LGQA 7STDA 3VF1A 4R1KA 4N6V0 3EJVA 3FZWA 5CF2A 3I563 2XR8B 3X3ZA 2E2VA 4FCJA 2W6JH 1NU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL5 A;  3IMA B;  1M9G A;  1STF I;  1FA3 A;  3PS8 A;  3UL6 A;  4N6O B;  1N5H A;  1MNL A;  2W9P A;  4N6T A;  1ROA A;  1N9J A;  1R4C A;  1CYV A;  4CCV A;  1MOL A;  1NB5 I;  1PFP A;  1WNH A;  5LC6 A;  4N6L A;  2OCT A;  3QRD A;  4TX4 A;  4EYC A;  1KWI A;  4N6U A;  1CYU A;  3Q2P A;  4ZM8 A;  1GD3 A;  3MWZ A;  1NB3 I;  5ELU A;  1G96 A;  4N6N B;  1DVD A;  3KSE D;  2CH9 A;  1DVC A;  5EQL A;  3PXM A;  1IV7 A;  1CEW I;  3SVA A;  3GAX A;  1LXE A;  1A67 A;  2W9Q A;  3L0R A;  5LC7 A;  3KFQ C;  3LH4 A;  3S67 A;  2O9U X;  4IT7 A;  4N6M A;  1FUW A;  3PYJ A;  5ELJ A;  4LZI A;  1EQK A;  2BO9 B;  1IV9 A;  1YVB I;  1GD4 A;  3NX0 A;  5A0O B;  1RN7 A;  2KXG A;  3K9M C;  4N6V 0;  1N5P A;  1A90 A;  1TIJ A; 
#chains in the Genus database with same CATH topology
 1VQ7 3;  1O7W B;  2GBW B;  4GL6 A;  1MWS A;  2XFS A;  1AVL A;  1NO3 A;  3MKI A;  3UL5 A;  1RTU A;  2UX0 A;  1BRG A;  1GY7 A;  1K9M 4;  3EN8 A;  1B20 A;  5M19 A;  4ILF A;  1T3B A;  1PY3 A;  2V1L A;  3F8X A;  3CD6 3;  1RN4 A;  4KT3 B;  4OK0 A;  1Q42 A;  3K5T A;  4XBY A;  2K0M A;  3NUV A;  3SX1 A;  1BSA A;  3BND A;  3KE7 A;  3I55 3;  2YFL B;  3T0U A;  4O3V A;  3WHO A;  3RGR A;  4LSO A;  1HU9 A;  2HMJ B;  2OQE C;  3JUQ A;  4N6T A;  2INX A;  3BNE A;  2XGN A;  1DMM A;  3S27 A;  1BSE A;  1ROA A;  3D3L A;  1IYY A;  1WQL B;  1AVK A;  1IVU A;  3MG1 A;  1OHO A;  2HMK B;  1BRK A;  4MMY B;  4CCV A;  1E3V A;  2Z7A A;  1QVG 2;  3M8C A;  1WNH A;  1W2B 2;  4N6L A;  1GMP A;  5AI1 A;  1RGK A;  1BOX A;  2SAR A;  1W2Z A;  1TTO A;  1KWI A;  1JZO A;  3NV0 B;  2XGL A;  5HGR A;  3EBY A;  4BL2 A;  2KF5 A;  4EBG A;  2M7O A;  3GZR A;  1RLS A;  4JRF A;  4ZM8 A;  5M18 A;  1YJ9 3;  1YVS A;  3K0Z A;  3OWS A;  2OOV A;  4FCZ A;  1GD3 A;  3RGA A;  3MWZ A;  4MMZ B;  1NB3 I;  2FXT A;  5CF1 A;  2F4Y A;  3G71 3;  5DRV A;  1FGT A;  4HM0 B;  1I0X A;  1FGR A;  4IIA A;  1BNJ A;  4DKI A;  1UGI A;  1VQQ A;  3A5E A;  1M1K 4;  1DVC A;  1BVI A;  2JQ5 A;  1Q7H A;  1ZO2 A;  2AAE A;  3FH1 A;  3PXM A;  4HOH A;  3NBR A;  4J8T A;  4XDV A;  2F56 A;  3OWU A;  3DZL A;  3AHW A;  1WTH A;  4HM1 B;  3EF8 A;  3LTD A;  2Z6B A;  2RBI A;  3X40 A;  3BIR A;  3VSY A;  7RNT A;  1VQ5 3;  4CDL A;  1JB2 A;  1LXE A;  3ZFZ A;  3WOE B;  2K54 A;  1F8N A;  1O7N B;  1B21 A;  3B8L A;  1CQS A;  2HMM B;  2C10 A;  3FSD A;  5LC7 A;  3VGN A;  1JN5 B;  5M1A A;  5IEP A;  4HM5 B;  3S29 A;  3DM8 A;  3KFQ C;  4OUQ A;  3N8B A;  1VQ6 3;  1MWR A;  2WGQ A;  4N3V A;  1KD1 4;  2RNT A;  1UI8 A;  4L7K A;  3DGO A;  1TFK A;  2C11 A;  2QEX 3;  4O02 B;  3OV4 A;  6GSP A;  2A15 A;  3NBB A;  4N6M A;  3U1W A;  5IEN A;  3BB9 A;  1JRQ A;  1FUW A;  3PYJ A;  3LOY A;  3MSO A;  1RGE A;  1BRN L;  1I3F A;  1K8A 4;  1GS3 A;  1Q9E A;  1UUV B;  1IVW A;  2CFW A;  1YVB I;  3HI7 A;  4BIR A;  1GD4 A;  1SPU A;  3F7S A;  3BNB A;  1GOU A;  1TP6 A;  1TU5 A;  3OW2 2;  4J5K A;  1GYB A;  3SLU A;  4HM6 B;  1W5Z A;  3ROB A;  2B1X B;  4OVM A;  2HMN B;  4XBX A;  3K9M C;  2HMO B;  3F7X A;  1Q81 4;  4G1M B;  2W04 A;  1O7H B;  1VQM 3;  1JKG B;  4FCM A;  1A90 A;  1TIJ A;  3HOH A;  4XDW A;  1T2I A;  3CPO A;  3F9S A;  2L4V A;  4NHF A;  2IUK A;  1RGG A;  1UI7 A;  3KSP A;  1UUG B;  1M9G A;  3LXU X;  4RZM A;  3ER7 A;  3WR2 A;  1Q40 B;  1FUT A;  1SAR A;  2OWP A;  4Q53 A;  2F86 B;  3PCR A;  1RN1 A;  2STD A;  2HML B;  1RDS A;  1STF I;  1K41 A;  1OHS A;  3GRD A;  1FA3 A;  5G2G A;  1W01 A;  1T5Y A;  5G1L A;  1LNI A;  3DY5 A;  1TUH A;  2BMO B;  2CG1 A;  3NXJ A;  3SOY A;  4BTX A;  1RMS A;  3WDG B;  1HZ1 A;  4N6O B;  3NV0 A;  1X1U A;  4PEJ A;  1YIJ 3;  2B24 B;  2CG0 A;  4HKV B;  1GMR A;  3JUM A;  1X1W A;  2CX1 A;  2F5M A;  3NQY A;  4AEQ A;  1TJD A;  1IQY A;  1I70 A;  4J5G A;  4L8P A;  1R4C A;  3SOA A;  1S72 3;  1SII A;  2BT3 A;  2HOH A;  2OQE A;  2QIY A;  1MOL A;  1AV4 A;  1JV2 B;  3GZY B;  4KFE A;  3UNL A;  1ROV A;  1A2P A;  1RKY A;  1YJN 3;  1TFO A;  1NNV A;  4K90 B;  4WP5 A;  3SYU A;  2CK3 H;  4I4K A;  5IW9 A;  1RGF A;  1QAK A;  5IG0 A;  2GEY A;  2WGO A;  5D83 A;  1C54 A;  4EYC A;  1V74 A;  1BUQ A;  2W0Q A;  4KFD A;  2CWT A;  3AMO B;  4HM8 B;  2KF3 A;  3MG2 A;  3AGN A;  4I5Q A;  1OGX A;  1RNB A;  2XRX B;  1W6C A;  5CK6 A;  3KZT A;  2O3O A;  1BNF A;  1G96 A;  1JNQ A;  3O8Y A;  2IY2 A;  1N8R 4;  3RNT A;  1I8V A;  2R41 A;  1RGC A;  1DVD A;  1W6Y A;  5STD A;  8CHO A;  3WOD G;  3CCV 3;  5AIF A;  1I2G A;  1RGH A;  3LZA A;  2E2U A;  4LYL B;  1A2V A;  2H0I A;  1PU4 A;  8RNT A;  2XEP A;  3LTC A;  4K61 A;  3CCJ 3;  3SVA A;  4KFF A;  1YJW 3;  3DGL A;  4WYK A;  1RCK A;  1AQZ A;  2UGI A;  3V98 A;  4O2H A;  1OUN A;  5I97 A;  3CPW 2;  1EA2 A;  3CNM A;  3BLZ A;  3G6E 3;  3DGY A;  3IPT A;  3OWY A;  3D79 A;  2D42 A;  1G02 A;  3V99 A;  4CPK A;  2O9U X;  1W02 A;  1I2E A;  1UCL A;  3KKG A;  2IUJ A;  3HZP A;  1FUS A;  3KCH A;  1BSC A;  1VZZ A;  2P09 A;  1FGM A;  1FZU A;  3WA2 X;  3GZX B;  1RSN A;  2PZV A;  4AKY A;  3CCS 3;  1Q7Y 4;  4HVN A;  2BIR A;  1JB5 A;  5ELJ A;  2MF7 A;  3CCE 3;  3F40 A;  1UCI A;  1BRH A;  1PYL A;  2BO9 B;  1W00 A;  1YGE A;  5IF6 A;  1JKG A;  3T8N A;  5EEO A;  2KAA A;  1V58 A;  4HM2 B;  2Y73 A;  2KF4 A;  4EW5 A;  1B3S A;  7GSP A;  1QVF 2;  2IMJ A;  1B2Z A;  1BNG A;  3FKA A;  2GU1 A;  5TGN A;  1LOX A;  2CFL A;  1DYU A;  3ALA A;  1DE3 A;  1IK3 A;  1LOW A;  6RNT A;  2CKF B;  3CCU 3;  3RDE A;  4MEI A;  4R9L A;  2J8X B;  5AEU B;  4FMA A;  1YGW A;  2Q07 A;  1WMO A;  4FMB A;  5BIR A;  5IER A;  3F14 A;  3GSP A;  2GU3 A;  3NQZ A;  1DMQ A;  1BSB A;  2CWU A;  4XBT A;  4BU4 A;  3LTB A;  1GSP A;  1KC8 4;  2GSP A;  1KQS 2;  2P38 A;  2WOH A;  1N5P A;  1OH0 A;  1OF5 A;  1BNI A;  3AGO A;  1IQX A;  3JVC A;  2WO0 A;  9RNT A;  3NHX A;  1LRA A;  1LOV A;  3DH2 A;  2R4I A;  1Z1S A;  3FG3 A;  3CC7 3;  2Z77 A;  1VQ8 3;  2AAD A;  1WMN A;  1ULJ B;  4JF8 A;  2H0H A;  1FGO A;  3DUK A;  1M1X B;  1GOY A;  1MGW A;  3GZB A;  3Q1C A;  2E2T A;  5JBS A;  1JBR A;  3UL6 A;  2KCD A;  1OHP A;  2BHM A;  5AII A;  1G0T A;  1MNL A;  1N5H A;  1U5O A;  2XSH B;  4BTW A;  3EBT A;  1T2H A;  3KN4 A;  4HZ9 B;  3PGB A;  3NM7 A;  1GMQ A;  1NDO B;  2JDI H;  4WWU C;  3V92 A;  1IU7 A;  1N9J A;  3WA3 A;  1CYV A;  1B2S A;  1O7P B;  1IT7 A;  2UUG C;  1JJ2 2;  1NB5 I;  1X1X A;  2RSX A;  2CHC A;  1PFP A;  4XM4 A;  4HYZ A;  2XH9 A;  2KRT A;  3JUN A;  3CNX A;  1KSI A;  3FCS B;  2OCT A;  3QRD A;  5AYR B;  6STD A;  1EEJ A;  2I9W A;  2Y74 A;  1CH0 A;  1Q82 4;  1FYS A;  5G1K A;  4RNZ A;  1UDI I;  5HOH A;  1CYU A;  1I3I A;  2QGU A;  3FGY A;  3HX8 A;  3Q2P A;  2CFD A;  4R4K A;  4KZ1 A;  2RGQ A;  2QA4 3;  5DRE A;  1TRP A;  2BMR B;  1EG9 B;  3HK4 A;  4MMX B;  5KP3 A;  2C4B A;  3DGM A;  3J7Y d;  4H61 A;  3OX9 A;  3KSE D;  3UB1 A;  1EKM A;  5EQL A;  4RBN A;  5IG4 A;  2IA7 A;  1BRI A;  3X3X A;  2W56 B;  1UCJ A;  3LML A;  1VQK 3;  5RNT A;  5AEW B;  3H51 A;  4QWT A;  3EQQ B;  1OCV A;  5JPP A;  4LEH A;  1IV7 A;  3CCL 3;  1UW1 A;  3N54 B;  3X41 A;  3DXO A;  2XFT A;  3WOF B;  2GBX B;  3B4P A;  4FMD A;  1E3R A;  3X3Y A;  5KP1 A;  4RNY A;  1M90 4;  4IPB A;  3PZW A;  3B4O A;  2BNG A;  1SQW A;  4XB5 A;  2LYX A;  2F98 A;  1BSD A;  3S67 A;  1D6U A;  2KF6 A;  3KII A;  3U97 A;  4HZB B;  2H0G A;  3HIG A;  4IT7 A;  1IQ8 A;  2D1W A;  1JN5 A;  3LYG A;  3PCS A;  3CC4 3;  2SBL A;  2CIU A;  2XSO B;  4FR9 A;  4HM3 B;  3MPH A;  1YI2 3;  3CXC 2;  3N9H A;  1ASK A;  5IG5 A;  3FF0 A;  3CCQ 3;  1MGR A;  1NJI 4;  3G0K A;  1FW7 A;  2PNC A;  1OGZ A;  3EC9 A;  1MWT A;  3OXA A;  4K1V A;  1B2X A;  3LT9 A;  1O7G B;  3NX0 A;  5A0O B;  1W6G A;  1C7H A;  3WMD A;  1NWW A;  1RN7 A;  1YNV X;  4H3U A;  5AIG A;  4BTY A;  2KXG A;  3CMA 3;  3IJE B;  2GXF A;  1A2K A;  2W2C A;  3URP A;  2P05 A;  2OTL 3;  1W4N A;  5IG3 A;  1JBS A;  1BGS A;  1VQ4 3;  1LQM B;  2YFI B;  3DMC A;  3FG4 A;  4HAA A;  3EB8 A;  1BUJ A;  1ZGX A;  3CU3 A;  1QAL A;  3FF2 A;  4CJN A;  1RJO A;  4BL3 A;  5KP4 A;  3D5I A;  2F5W A;  1E97 A;  4MJD A;  1YIT 3;  1OPY A;  1JB4 A;  3IMA B;  1L5G B;  2IYJ A;  1IT8 A;  1ZX2 A;  2RCD A;  3JUP A;  3G8Z A;  1VQN 3;  2CFK A;  4NRE A;  4EXR A;  1LVN A;  5AYS C;  3BU4 A;  1RRL A;  1BNS A;  1MWU A;  3AHS A;  1Q40 A;  3PS8 A;  3LT8 A;  1US1 A;  2FNQ A;  5BU4 A;  1BRJ A;  3H3H A;  2K3D A;  1HKX A;  3FG1 A;  3EE1 A;  3E99 A;  3K7C A;  5EVH A;  1ULI B;  2W9P A;  5CXO A;  3X42 A;  1D6Y A;  1I2F A;  1D6Z A;  2P0M A;  3K63 A;  4HBR A;  1IVV A;  2CW9 A;  1QAF A;  3D9R A;  1JZD A;  3S5C A;  3ECF A;  4KVH A;  1V57 A;  3G4S 3;  4GHO A;  4LMI A;  5BXQ A;  3EN1 B;  1IDP A;  2YX9 A;  5LC6 A;  1BAN A;  1ZS7 A;  4EC6 A;  5D81 A;  2W56 A;  2OOV C;  1B2M A;  4TX4 A;  5IEO A;  4WHA A;  1LQG C;  1AR0 A;  1LNH A;  2CWV A;  2BMQ B;  1DET A;  4N6U A;  4X2O A;  3CCM 3;  1VQO 3;  4O8S A;  1RCL A;  3NM2 A;  1IVX A;  1O7M B;  1STD A;  3Q3F A;  3Q90 A;  3I0Y A;  3A76 A;  3FLJ A;  1Y4K A;  3JUO A;  5ELU A;  3S28 A;  1BIR A;  3AMO A;  5FGO A;  4EV2 A;  3MYT A;  4HJL B;  3HII A;  4N6N B;  3CME 3;  1BNR A;  4FMC A;  1N8Q A;  3EHC A;  2MC8 A;  1VQP 3;  1VQL 3;  2CH9 A;  3DGN A;  1RRH A;  1UUW B;  1W7C A;  4WFO A;  2F99 A;  1EUI C;  4L8O A;  4X2H A;  3UJM A;  4WYK B;  1BAO A;  1HYF A;  2Z76 A;  4HM4 B;  3MHE A;  1QJG A;  4J9A A;  1YHQ 3;  3G16 A;  1SIH A;  1CEW I;  2ZA4 A;  3BNC A;  4HM7 B;  5CLK A;  1Q86 4;  3GAX A;  5D82 A;  2W9Q A;  2GEX A;  2WOF A;  2ZL8 A;  2P0X A;  3NBJ A;  1GOV A;  1GY6 A;  2ZDJ A;  3L0R A;  2RFR A;  3SED A;  2LQV A;  1VQ9 3;  3TDG A;  3CC2 3;  4ORL A;  3LH4 A;  1I0V A;  3GWR A;  1BNE A;  1AY7 A;  1BRS A;  3QK9 A;  2CFG A;  5JPU A;  1B27 A;  1S5A A;  3MG3 A;  3CCR 3;  1OAC A;  1QMA A;  1RNT A;  2BU4 A;  4STD A;  1GY5 A;  1N9E A;  2CC3 A;  2CX0 A;  2ML6 A;  5BVB A;  1UCK A;  4LZI A;  2W03 A;  4GSP A;  1K73 4;  1EQK A;  1B2U A;  4U13 A;  1UGH I;  1J2B A;  1RHL A;  3D5G A;  3B7C A;  1U8C B;  4GB5 A;  5AIH A;  3T8U A;  4NPB A;  3EX9 A;  3SXX A;  1K28 A;  4R80 A;  1IV9 A;  3F8H A;  1LOY A;  3STD A;  5GSP A;  1DMN A;  1TRQ A;  1JBT A;  1FGQ A;  2FGT A;  3LTA A;  4EV5 A;  2ML5 A;  3D4A A;  1SJW A;  4R9K A;  2YFJ B;  5FW5 A;  1A67 A;  1RGL A;  2ZHX B;  4AKZ A;  2OTJ 3;  1WMP A;  1OF5 B;  1X1Y A;  3ZG0 A;  1ISK A;  2XF3 A;  4K1U A;  4LGQ A;  3ZG5 A;  7STD A;  3VF1 A;  4R1K A;  4RNT A;  4N6V 0;  3EJV A;  3FZW A;  5CF2 A;  3I56 3;  1BU4 A;  1RGA A;  2XR8 B;  3X3Z A;  1R4Y A;  2E2V A;  2L1S A;  4FCJ A;  2W6J H;  1NU3 A; 
#chains in the Genus database with same CATH homology
 1VQ7 3;  1O7W B;  2GBW B;  4GL6 A;  2XFS A;  1AVL A;  1NO3 A;  3MKI A;  3UL5 A;  2UX0 A;  1GY7 A;  1K9M 4;  3EN8 A;  2V1L A;  3F8X A;  3CD6 3;  4OK0 A;  1Q42 A;  3K5T A;  4XBY A;  2K0M A;  3NUV A;  3SX1 A;  3BND A;  3KE7 A;  3I55 3;  2YFL B;  3T0U A;  4O3V A;  3RGR A;  4LSO A;  1HU9 A;  2HMJ B;  2OQE C;  3JUQ A;  4N6T A;  2INX A;  3BNE A;  2XGN A;  1DMM A;  3S27 A;  1ROA A;  3D3L A;  1WQL B;  1AVK A;  1IVU A;  3MG1 A;  1OHO A;  2HMK B;  4MMY B;  4CCV A;  1E3V A;  2Z7A A;  1QVG 2;  3M8C A;  1WNH A;  1W2B 2;  4N6L A;  5AI1 A;  1W2Z A;  1KWI A;  3NV0 B;  2XGL A;  5HGR A;  3EBY A;  4EBG A;  2M7O A;  3GZR A;  4JRF A;  1YJ9 3;  4ZM8 A;  3K0Z A;  3OWS A;  2OOV A;  4FCZ A;  1GD3 A;  3RGA A;  3MWZ A;  4MMZ B;  1NB3 I;  2FXT A;  5CF1 A;  3G71 3;  5DRV A;  1FGT A;  4HM0 B;  1FGR A;  4IIA A;  1M1K 4;  1DVC A;  2JQ5 A;  3J7Y d;  1ZO2 A;  3FH1 A;  3PXM A;  3NBR A;  4J8T A;  4XDV A;  3OWU A;  3DZL A;  1WTH A;  4HM1 B;  3EF8 A;  3LTD A;  2Z6B A;  3X40 A;  3VSY A;  1VQ5 3;  4CDL A;  1JB2 A;  1LXE A;  3WOE B;  2K54 A;  1F8N A;  1O7N B;  3B8L A;  1CQS A;  2HMM B;  2C10 A;  3FSD A;  5LC7 A;  3VGN A;  1JN5 B;  5IEP A;  4HM5 B;  3S29 A;  3DM8 A;  3KFQ C;  4OUQ A;  3N8B A;  1VQ6 3;  2WGQ A;  4N3V A;  1KD1 4;  1UI8 A;  4L7K A;  3DGO A;  1TFK A;  2C11 A;  2QEX 3;  4O02 B;  3OV4 A;  2A15 A;  3NBB A;  4N6M A;  3U1W A;  5IEN A;  3BB9 A;  1JRQ A;  1FUW A;  3PYJ A;  3LOY A;  3MSO A;  1K8A 4;  1GS3 A;  1UUV B;  1IVW A;  2CFW A;  1YVB I;  3HI7 A;  1GD4 A;  1SPU A;  3F7S A;  3BNB A;  1TP6 A;  1TU5 A;  3OW2 2;  1GYB A;  3SLU A;  4HM6 B;  1W5Z A;  3ROB A;  2B1X B;  4OVM A;  2HMN B;  4XBX A;  3K9M C;  2HMO B;  3F7X A;  1Q81 4;  4G1M B;  2W04 A;  1O7H B;  1VQM 3;  1JKG B;  4FCM A;  1A90 A;  1TIJ A;  4XDW A;  3CPO A;  3F9S A;  2L4V A;  4NHF A;  2IUK A;  3KSP A;  1UI7 A;  3LXU X;  4RZM A;  1M9G A;  3ER7 A;  1Q40 B;  2OWP A;  4Q53 A;  2F86 B;  3PCR A;  2STD A;  2HML B;  1STF I;  1K41 A;  1OHS A;  3GRD A;  1FA3 A;  5G2G A;  1W01 A;  1T5Y A;  3DY5 A;  1TUH A;  2BMO B;  2CG1 A;  3NXJ A;  3SOY A;  4BTX A;  3WDG B;  4N6O B;  3NV0 A;  4PEJ A;  1YIJ 3;  2B24 B;  2CG0 A;  4HKV B;  3JUM A;  4AEQ A;  3NQY A;  1IQY A;  4L8P A;  1R4C A;  3SOA A;  1S72 3;  1SII A;  2BT3 A;  2OQE A;  2QIY A;  1MOL A;  1AV4 A;  1JV2 B;  3GZY B;  4KFE A;  3UNL A;  1ROV A;  1RKY A;  1YJN 3;  1TFO A;  4K90 B;  4WP5 A;  2CK3 H;  4I4K A;  5IW9 A;  5IG0 A;  1QAK A;  2GEY A;  2WGO A;  5D83 A;  4EYC A;  1V74 A;  1BUQ A;  2W0Q A;  4KFD A;  2CWT A;  3AMO B;  4HM8 B;  3MG2 A;  1OGX A;  2XRX B;  1W6C A;  5CK6 A;  3KZT A;  2O3O A;  1G96 A;  1JNQ A;  3O8Y A;  1N8R 4;  1DVD A;  1W6Y A;  5STD A;  8CHO A;  3WOD G;  3CCV 3;  5AIF A;  3LZA A;  2E2U A;  1A2V A;  1PU4 A;  2XEP A;  3LTC A;  4K61 A;  3CCJ 3;  3SVA A;  4KFF A;  1YJW 3;  3DGL A;  4WYK A;  3V98 A;  4O2H A;  1OUN A;  5I97 A;  3CPW 2;  1EA2 A;  3CNM A;  3BLZ A;  3G6E 3;  3IPT A;  3OWY A;  2D42 A;  3V99 A;  2O9U X;  1W02 A;  3KKG A;  2IUJ A;  3HZP A;  1VZZ A;  2P09 A;  1FGM A;  3WA2 X;  4AKY A;  3GZX B;  2PZV A;  3CCS 3;  1Q7Y 4;  4HVN A;  1JB5 A;  5ELJ A;  2MF7 A;  3CCE 3;  3F40 A;  2BO9 B;  1W00 A;  1YGE A;  5IF6 A;  1JKG A;  3T8N A;  5EEO A;  4HM2 B;  2Y73 A;  1QVF 2;  2IMJ A;  3FKA A;  2GU1 A;  5TGN A;  1LOX A;  2CFL A;  3ALA A;  1DYU A;  1IK3 A;  2CKF B;  3CCU 3;  3RDE A;  4MEI A;  4R9L A;  5AEU B;  4FMA A;  2Q07 A;  1WMO A;  4FMB A;  5IER A;  3F14 A;  3NQZ A;  2GU3 A;  1DMQ A;  2CWU A;  4XBT A;  3LTB A;  1KC8 4;  1KQS 2;  2P38 A;  2WOH A;  1N5P A;  1OH0 A;  1OF5 A;  3JVC A;  1IQX A;  2WO0 A;  3NHX A;  2R4I A;  1Z1S A;  3FG3 A;  3CC7 3;  2Z77 A;  1VQ8 3;  1WMN A;  1ULJ B;  4JF8 A;  1FGO A;  3DUK A;  1M1X B;  3GZB A;  3Q1C A;  2E2T A;  5JBS A;  3UL6 A;  2KCD A;  1OHP A;  2BHM A;  5AII A;  1N5H A;  1MNL A;  1U5O A;  2XSH B;  4BTW A;  3EBT A;  3KN4 A;  4HZ9 B;  3PGB A;  3NM7 A;  4WWU C;  1NDO B;  2JDI H;  3V92 A;  1IU7 A;  1N9J A;  3WA3 A;  1CYV A;  1O7P B;  1JJ2 2;  1IT7 A;  1NB5 I;  2RSX A;  2CHC A;  1PFP A;  4XM4 A;  4HYZ A;  2XH9 A;  2KRT A;  3JUN A;  3CNX A;  1KSI A;  3FCS B;  2OCT A;  3QRD A;  5AYR B;  6STD A;  1Q82 4;  2I9W A;  2Y74 A;  4RNZ A;  1CYU A;  2QGU A;  3FGY A;  3HX8 A;  3Q2P A;  2CFD A;  4R4K A;  4KZ1 A;  2RGQ A;  2QA4 3;  5DRE A;  2BMR B;  1EG9 B;  3HK4 A;  4MMX B;  5KP3 A;  3DGM A;  4H61 A;  3OX9 A;  3KSE D;  3UB1 A;  1EKM A;  5EQL A;  4RBN A;  5IG4 A;  2IA7 A;  3X3X A;  2W56 B;  3LML A;  1VQK 3;  5AEW B;  3H51 A;  4QWT A;  3EQQ B;  1OCV A;  5JPP A;  4LEH A;  1IV7 A;  3CCL 3;  1UW1 A;  3N54 B;  3X41 A;  3DXO A;  2XFT A;  3WOF B;  2GBX B;  3B4P A;  4FMD A;  1E3R A;  3X3Y A;  5KP1 A;  4RNY A;  1M90 4;  4IPB A;  3PZW A;  3B4O A;  2BNG A;  1SQW A;  4XB5 A;  2LYX A;  2F98 A;  3S67 A;  1D6U A;  3U97 A;  3KII A;  4HZB B;  3HIG A;  4IT7 A;  1IQ8 A;  2D1W A;  1JN5 A;  3LYG A;  3PCS A;  3CC4 3;  2SBL A;  2CIU A;  2XSO B;  4FR9 A;  4HM3 B;  3MPH A;  1YI2 3;  3CXC 2;  3N9H A;  1ASK A;  5IG5 A;  3FF0 A;  3CCQ 3;  1NJI 4;  3G0K A;  2PNC A;  1OGZ A;  3EC9 A;  3OXA A;  4K1V A;  3LT9 A;  1O7G B;  3NX0 A;  5A0O B;  1C7H A;  1W6G A;  3WMD A;  1NWW A;  1RN7 A;  5AIG A;  4H3U A;  4BTY A;  2KXG A;  3CMA 3;  3IJE B;  2GXF A;  1A2K A;  2W2C A;  2P05 A;  2OTL 3;  1W4N A;  5IG3 A;  1VQ4 3;  2YFI B;  3DMC A;  3FG4 A;  3EB8 A;  3CU3 A;  1QAL A;  3FF2 A;  1RJO A;  5KP4 A;  1E97 A;  4MJD A;  1YIT 3;  1OPY A;  1JB4 A;  3IMA B;  1L5G B;  1IT8 A;  1ZX2 A;  2RCD A;  3JUP A;  3G8Z A;  1VQN 3;  2CFK A;  4NRE A;  4EXR A;  1LVN A;  5AYS C;  1RRL A;  1Q40 A;  3PS8 A;  3LT8 A;  1US1 A;  2FNQ A;  3H3H A;  1HKX A;  3FG1 A;  3EE1 A;  3E99 A;  3K7C A;  5EVH A;  1ULI B;  2W9P A;  5CXO A;  3X42 A;  1D6Y A;  2P0M A;  1D6Z A;  3K63 A;  4HBR A;  1IVV A;  2CW9 A;  1QAF A;  3D9R A;  3S5C A;  3ECF A;  4KVH A;  3G4S 3;  4LMI A;  5BXQ A;  3EN1 B;  1IDP A;  2YX9 A;  5LC6 A;  4EC6 A;  5D81 A;  2W56 A;  2OOV C;  4TX4 A;  5IEO A;  4WHA A;  1AR0 A;  1LNH A;  2CWV A;  2BMQ B;  4N6U A;  4X2O A;  3CCM 3;  1VQO 3;  4O8S A;  3NM2 A;  1IVX A;  1O7M B;  1STD A;  3Q90 A;  3I0Y A;  3A76 A;  3FLJ A;  1Y4K A;  3JUO A;  5ELU A;  3S28 A;  3AMO A;  5FGO A;  4EV2 A;  3MYT A;  4HJL B;  3HII A;  4N6N B;  3CME 3;  4FMC A;  1N8Q A;  3EHC A;  2MC8 A;  1VQP 3;  1VQL 3;  2CH9 A;  3DGN A;  1RRH A;  1UUW B;  1W7C A;  4WFO A;  2F99 A;  4L8O A;  4X2H A;  3UJM A;  4WYK B;  2Z76 A;  4J9A A;  1YHQ 3;  4HM4 B;  3MHE A;  1QJG A;  3G16 A;  1SIH A;  1CEW I;  3BNC A;  4HM7 B;  5CLK A;  1Q86 4;  3GAX A;  5D82 A;  2W9Q A;  2GEX A;  2WOF A;  2ZL8 A;  2P0X A;  3NBJ A;  1GY6 A;  2ZDJ A;  1A67 A;  3L0R A;  2RFR A;  3SED A;  2LQV A;  1VQ9 3;  3TDG A;  3CC2 3;  4ORL A;  3LH4 A;  3GWR A;  3QK9 A;  5JPU A;  2CFG A;  1S5A A;  3MG3 A;  3CCR 3;  1OAC A;  1QMA A;  4STD A;  1GY5 A;  1N9E A;  2CC3 A;  5BVB A;  2ML6 A;  4LZI A;  2W03 A;  1K73 4;  1EQK A;  4U13 A;  1J2B A;  3B7C A;  1U8C B;  4GB5 A;  5AIH A;  3T8U A;  3EX9 A;  3SXX A;  1K28 A;  4R80 A;  1IV9 A;  3F8H A;  3STD A;  1DMN A;  1FGQ A;  2FGT A;  3LTA A;  4EV5 A;  2ML5 A;  1SJW A;  4R9K A;  2YFJ B;  5FW5 A;  4AKZ A;  2OTJ 3;  1WMP A;  1OF5 B;  1ISK A;  2XF3 A;  4K1U A;  4LGQ A;  7STD A;  3VF1 A;  4R1K A;  4N6V 0;  3EJV A;  3FZW A;  5CF2 A;  3I56 3;  2XR8 B;  3X3Z A;  2E2V A;  4FCJ A;  2W6J H;  1NU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...