4H3UA

Crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
MTTPEIVTAWAAAWTGTNPNALGTLFAADGTYVDHAIGATMTGREQISGWKARTDAMIENVHVTITKAYRAGDHVTIEAVYGGHIKGAPTPFAVPMATLLRTRGEEITSDQDYYSLSSVLAQSGLPADWTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Structural characterization of a hypothetical protein: a potential agent involved in trimethylamine metabolism in Catenulispora acidiphila.
pubmed doi rcsb
source organism Catenulispora acidiphila
total genus 34
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4h3uA00
3DZLA 4X2HA 3HZPA 3VGNA 3EBYA 5AIGA 3F40A 3VSYA 4HM3B 1Q40A 4HM2B 1TP6A 4HM6B 2CHCA 5IEOA 5IG0A 2RGQA 1ZX2A 1STDA 2Z77A 1E3VA 5AEWB 2BMQB 5BXQA 1UUWB 4CDLA 2BMRB 5KP3A 5IF6A 4MJDA 1O7NB 1ULIB 3S5CA 4XB5A 4U13A 3H3HA 4FCJA 3EJVA 2GBWB 3DMCA 2XR8B 3GWRA 1O7PB 4HM8B 3E99A 3HX8A 1OHPA 7STDA 4WYKA 1JN5A 5IG3A 3GZRA 3ECFA 3NHXA 2R4IA 4IIAA 6STDA 4HM4B 3SOAA 1CQSA 3OV4A 2HMMB 4HJLB 1GYBA 1OH0A 1Q42A 1Q40B 4HZBB 4XDWA 3EN1B 3KZTA 2B1XB 1W6YA 4R9KA 3G0KA 3SEDA 3FH1A 3KE7A 4HM0B 1QJGA 1OGXA 3B8LA 4L7KA 1TUHA 3OX9A 3MG1A 3HK4A 4H3UA 1OUNA 3K0ZA 4HKVB 4WWUC 4WYKB 1GS3A 1JN5B 4HVNA 4K1UA 2YFLB 5IERA 3NXJA 2F99A 2RFRA 5IEPA 1DMNA 2CKFB 4LEHA 2QGUA 1W00A 1JKGA 1HKXA 2GXFA 1DMQA 3G16A 2OWPA 2BMOB 3RGRA 2QIYA 2YFJB 5D81A 3MG2A 5D83A 1GY6A 3EF8A 3GZBA 2W2CA 1JB2A 1WQLB 2Z7AA 2I9WA 2GEXA 4LMIA 4R1KA 2RCDA 4I4KA 1ASKA 3FKAA 4R9LA 3F7XA 3EBTA 4ORLA 4OVMA 3SOYA 5IG5A 3FF0A 3DXOA 1GY7A 3G8ZA 2HMNB 3FZWA 3B4PA 3I0YA 3RGAA 2UX0A 3UJMA 5JPUA 1JKGB 3NUVA 2PZVA 4XBTA 1NDOB 3F7SA 3MHEA 4XDVA 1E3RA 1O7WB 3Q90A 3MYTA 3KSPA 2INXA 8CHOA 3F8XA 3IPTA 3CU3A 3BLZA 3A76A 4OUQA 5AIIA 2XRXB 3GZXB 5AIFA 1NWWA 2GBXB 3ROBA 4STDA 4WP5A 1QMAA 3NV0A 1OCVA 3BB9A 1UUVB 4XBXA 4GB5A 1EG9B 2Z76A 3OWUA 4J8TA 1JB4A 3F14A 5CLKA 5CXOA 1A2KA 2HMOB 5BVBA 5JPPA 3EX9A 3F9SA 5AEUB 1AR0A 5DRVA 2YFIB 1DMMA 4J9AA 4HZ9B 3T8UA 4HM5B 1O7MB 3T8NA 1O7HB 2B24B 1ZO2A 3EC9A 3LZAA 3FLJA 5G2GA 1E97A 3EQQB 2STDA 1BUQA 3NV0B 5CF1A 4PEJA 1U5OA 5DREA 4L8OA 5FW5A 5IG4A 1OF5A 5CK6A 5KP4A 2K54A 3FSDA 1C7HA 3GZYB 4Q53A 1W02A 4L8PA 5HGRA 3NBRA 2HMLB 3JUQA 3CPOA 3ER7A 3JUMA 1W01A 3JUNA 3OWYA 4XM4A 1OHOA 3MKIA 2XSHB 2A15A 4FCMA 4K1VA 4LGQA 2HMJB 1K41A 4X2OA 1OPYA 5KP1A 3UNLA 3KKGA 1EA2A 1S5AA 3MG3A 2JQ5A 3EHCA 3B7CA 3M8CA 1O7GB 3JUPA 3CNXA 1OGZA 2BNGA 1ULJB 1VZZA 5D82A 5TGNA 3OWSA 4XBYA 2F86B 1ISKA 2XSOB 4HM7B 5IENA 3FF2A 4N3VA 1OF5B 3H51A 3NM2A 3LYGA 1GY5A 3DM8A 4KVHA 3STDA 3DUKA 1SJWA 3F8HA 5AI1A 3FGYA 2F98A 3D9RA 3WMDA 4HM1B 3OXAA 3JUOA 1JB5A 1IDPA 3MSOA 5EVHA 5CF2A 2GEYA 1OHSA 5AIHA 1NU3A 3CNMA 3K7CA 3GRDA 1Z1SA 5STDA 3B4OA 2HMKB 4RZMA 2IMJA 3EN8A
chains in the Genus database with same CATH superfamily
3DZLA 4X2HA 3HZPA 3VGNA 1QAFA 3EBYA 5AIGA 1VQO3 3AMOB 3F40A 4HOHA 3VSYA 3X42A 4HM3B 1BNIA 1Q40A 1U8CB 2OOVC 3K63A 4HM2B 4FMAA 4N6OB 1TP6A 3RDEA 3KN4A 4HM6B 2CHCA 4NPBA 5IEOA 1BNSA 2RGQA 5IG0A 1ZX2A 4BL2A 1STDA 2YX9A 2Z77A 1AQZA 1E3VA 3AHWA 1DYUA 5AEWB 1FGMA 2BMQB 1S723 3CPW2 1AV4A 1EEJA 3CCQ3 1KQS2 3CCL3 2GU3A 2OQEA 5BXQA 1UUWB 4OK0A 3VF1A 2BMRB 1WMPA 5KP3A 4CDLA 2F56A 5IF6A 4HAAA 4MJDA 1D6UA 1LXEA 4EBGA 2MF7A 1YI23 1O7NB 1ULIB 2HOHA 2XH9A 4XB5A 4U13A 3LXUX 3IMAB 3PCSA 2AADA 3S5CA 3H3HA 1G0TA 4FCJA 1JRQA 3U1WA 4EV5A 1JNQA 3EJVA 1I70A 2GBWB 3DMCA 4QWTA 4CPKA 2ZDJA 3RNTA 1BNGA 1B27A 1TFOA 3ZG0A 1GOUA 1Q9EA 1YGWA 1B2ZA 2AAEA 2CFWA 2XR8B 3GWRA 5M1AA 1O7PB 4MMYB 2XGNA 1I3FA 1BSBA 2KRTA 2UUGC 3CCM3 4J5GA 1FUSA 7GSPA 3NQZA 3E99A 1RGCA 3HX8A 4HM8B 1OHPA 1RN4A 4J5KA 5A0OB 1SARA 3PCRA 7STDA 2CK3H 3KIIA 1I3IA 1PFPA 4WYKA 1Q7Y4 1K9M4 6GSPA 2E2UA 1LOYA 1JN5A 5JBSA 3UL5A 1BNJA 1L5GB 3GZRA 5IG3A 1KC84 3S29A 4K90B 3AHSA 5M19A 3BNDA 3ECFA 3NHXA 1A2PA 2R4IA 1M904 2CC3A 3LT9A 3LTDA 4IIAA 1N5PA 3S27A 4HM4B 6STDA 3SOAA 1GSPA 3J7Yd 1CQSA 3KCHA 2HMMB 1TJDA 3LTBA 3OV4A 4H61A 4HJLB 4HYZA 1LVNA 2MC8A 1YIT3 1GYBA 1NNVA 1OH0A 3ZFZA 1CYUA 2J8XB 1LNHA 1Q42A 1Q40B 2FXTA 2XFSA 2CFDA 4HZBB 2CWTA 2ZHXB 3BIRA 3CC73 4XDWA 1JJ22 1RRLA 1C54A 3EN1B 2PNCA 3LOYA 5I97A 1RLSA 1UI8A 1RGEA 4NHFA 3KZTA 2B1XB 1W6YA 4I5QA 4R9KA 3G0KA 1RCLA 2W56A 5G1KA 1W2B2 3SEDA 3FH1A 1BNRA 1YVSA 1Y4KA 3BU4A 3KE7A 4HM0B 1WMOA 2BIRA 2WO0A 1RGGA 2CWUA 4CJNA 1DVDA 1GOVA 2CFGA 2OTJ3 3CCV3 2UGIA 1YJN3 1QJGA 1DE3A 2KF4A 1MGRA 1OGXA 3B8LA 2K0MA 2P05A 4O2HA 4L7KA 6RNTA 3G6E3 4FMBA 3S67A 3DGOA 1FGTA 3X3YA 1TUHA 2ZA4A 4HBRA 3OX9A 1F8NA 2H0IA 1RGFA 1X1YA 5EQLA 4CCVA 3CCJ3 1X1UA 3FCSB 1FUWA 1IV7A 3MG1A 2OOVA 3HK4A 2P0XA 5IW9A 1BIRA 4H3UA 3V98A 2ML6A 1OUNA 3K0ZA 3EE1A 4HKVB 2V1LA 4WWUC 4WYKB 1MWUA 1RGKA 1GS3A 1BSCA 1JN5B 2IUKA 4HVNA 1Q814 1YNVX 4K1UA 2Y73A 1RRHA 2YFLB 5IERA 3NXJA 1KSIA 3K5TA 1YIJ3 1EQKA 2F99A 2RFRA 2XFTA 1EUIC 5IEPA 1VQ63 3DH2A 3Q1CA 4FMDA 1DMNA 1W2ZA 1IVWA 2CKFB 5LC7A 1DETA 2CWVA 1SPUA 1W5ZA 2QGUA 4LEHA 1W00A 1JKGA 4N6MA 1HKXA 1VQ53 1Q864 3S28A 4JF8A 1W6CA 1AVLA 2GXFA 5ELUA 1DMQA 3GSPA 1W4NA 2CX1A 2FNQA 1VQM3 3G16A 2OWPA 2BMOB 3RGRA 1R4YA 3NBJA 2QIYA 4KFDA 3QRDA 2IUJA 2YFJB 3LTAA 5D81A 1VQL3 1D6YA 1W6GA 3MG2A 1I0VA 2F5MA 4RNTA 5D83A 1BSEA 1I2EA 4R4KA 1HYFA 1R4CA 1IV9A 1YHQ3 1BANA 1V57A 3CXC2 1GY6A 4ZM8A 3NBBA 3WODG 3EF8A 1B20A 3GZBA 2W2CA 4WFOA 1Q824 1JB2A 1WQLB 1J2BA 2M7OA 1FYSA 1RDSA 2Z7AA 5BU4A 1BRIA 1TRQA 3GAXA 3SLUA 1LOXA 5AYRB 2I9WA 1A90A 2GEXA 4LMIA 1I0XA 3BNCA 4R1KA 4EXRA 1NJI4 2O9UX 1N9JA 3O8YA 2C10A 2RCDA 2C11A 4MEIA 4I4KA 1LQMB 1ASKA 3FKAA 4R9LA 3F7XA 3SYUA 4RBNA 2W0QA 1FZUA 3EBTA 4O02B 1GD3A 3A5EA 1UUGB 4ORLA 4OVMA 1V58A 3SOYA 5IG5A 1PU4A 3CC23 3FF0A 1ROVA 3DXOA 3UL6A 1GY7A 1RGHA 3PGBA 3G8ZA 2HMNB 3FZWA 3B4PA 3I0YA 3RGAA 2UX0A 3Q2PA 4DKIA 2P38A 3X3XA 3UJMA 5JPUA 1BRSA 1BVIA 1JKGB 1GD4A 3NUVA 2W9PA 1JBRA 2PZVA 4XBTA 1CYVA 3I563 1NDOB 3F7SA 4RNZA 1MWTA 3MHEA 2KXGA 1IU7A 4XDVA 1E3RA 1O7WB 2BO9B 3HI7A 3MYTA 1MWSA 3Q90A 1A2VA 3KSPA 2D42A 2C4BA 2INXA 3G4S3 4ILFA 8CHOA 3F8XA 2WOFA 2SBLA 2P0MA 3IPTA 1KD14 1FGOA 1N9EA 1LRAA 4EW5A 1KWIA 3ALAA 7RNTA 2CIUA 2LYXA 1GOYA 3CU3A 3BLZA 3A76A 3X3ZA 4AKYA 1UDII 4OUQA 1SIIA 4GHOA 5AIIA 2XRXB 1RN7A 2LQVA 1N8R4 3GZXB 3CME3 3I553 5AIFA 1NWWA 2GBXB 3ROBA 4STDA 1K734 3FG3A 1CH0A 1V74A 4BU4A 1UCLA 1QMAA 4WP5A 3NV0A 3SXXA 2RBIA 1OCVA 2RSXA 4LSOA 1TIJA 2Q07A 1YVBI 4N6NB 4N6TA 3HIGA 3BB9A 2Z6BA 3KSED 4IT7A 4JRFA 1RCKA 1UUVB 4XBXA 1SQWA 2BHMA 1VQP3 2IA7A 1YGEA 3V99A 2FGTA 1MWRA 1MGWA 4GB5A 1NB5I 1SIHA 3SVAA 1US1A 1EG9B 4EV2A 3QK9A 1PYLA 2Z76A 1I2FA 4O3VA 1BU4A 3DGYA 3MPHA 3OWUA 1M1K4 1RHLA 1T3BA 2BU4A 4FCZA 4J8TA 1JB4A 2JDIH 3F14A 1IVXA 5CLKA 5CXOA 2GU1A 1A2KA 2E2TA 2HMOB 4O8SA 3DGMA 2XGLA 5BVBA 5JPPA 3L0RA 1QALA 3PYJA 1BSDA 3EX9A 3F9SA 3KFQC 1BAOA 5AEUB 1AR0A 1IVVA 5DRVA 1RGLA 1IQXA 4WHAA 1UGHI 1WTHA 1GMRA 1QVF2 3D3LA 2QA43 1TRPA 2YFIB 1VQN3 1DMMA 4J9AA 1X1WA 4HZ9B 3T8UA 2KAAA 2WGOA 8RNTA 1NB3I 1B2UA 1JZOA 2K3DA 1STFI 1O7MB 4HM5B 4FR9A 1G02A 1VQ73 3T8NA 5FGOA 1O7HB 4BL3A 5RNTA 2B24B 1LQGC 2IYJA 1BSAA 2W03A 1MNLA 3WR2A 1BRHA 1ZO2A 3EC9A 3LZAA 4RNYA 2W56B 3FLJA 3CMA3 1IYYA 2CFLA 1HZ1A 1UW1A 1JV2B 5G2GA 1RTUA 3CD63 1E97A 1M9GA 4G1MB 5BIRA 3EQQB 4EC6A 2STDA 2D1WA 1RNTA 2KF6A 1VQ83 2CX0A 3NV0B 1JBSA 4KFFA 1BUQA 5CF1A 4PEJA 1ZGXA 1FW7A 1RN1A 1U5OA 3WA3A 1G96A 5DREA 3CCU3 1ROAA 4L8OA 9RNTA 3MWZA 2H0GA 1BRGA 5FW5A 1AY7A 2KF5A 5IG4A 2BT3A 2Y74A 1OF5A 1LNIA 1RGAA 1GMQA 5CK6A 5KP4A 2K54A 2P09A 3FSDA 3N9HA 1C7HA 3GZYB 4Q53A 1Q7HA 1W02A 4L8PA 5HGRA 3LTCA 2WOHA 3NBRA 4TX4A 1T2HA 2HMLB 3JUQA 2W9QA 3WOEB 3CPOA 1BNEA 3T0UA 1M1XB 2H0HA 1IQ8A 1BGSA 3ER7A 3JUMA 1W01A 1NO3A 2O3OA 3TDGA 1UCJA 1ZS7A 3WHOA 1BRKA 3PXMA 2XEPA 3JUNA 1UCKA 3OWYA 1TU5A 3D5GA 1VQ43 1VQ93 1FGRA 1RKYA 1RJOA 1OACA 1B2MA 3CCS3 4XM4A 1OHOA 3MKIA 2XSHB 4BTWA 1I2GA 4BTYA 3CCR3 1YJW3 5AYSC 2A15A 4MMXB 4FCMA 4K1VA 3EB8A 3U97A 1JBTA 4BIRA 3CCE3 4LGQA 2HMJB 1K41A 3X41A 4X2OA 2R41A 1OPYA 3WDGB 2W04A 5KP1A 2QEX3 1WMNA 3DY5A 1QVG2 1YJ93 2RNTA 3UNLA 3KKGA 1EA2A 1S5AA 3MG3A 2JQ5A 1VQQA 3DGLA 2ML5A 2GSPA 3B7CA 3EHCA 3M8CA 2CG1A 1O7GB 1QAKA 1T5YA 3LT8A 3OW22 3JUPA 3V92A 1JZDA 1K28A 3CNXA 4EYCA 1IQYA 3ZG5A 1OGZA 1B2XA 3D79A 5HOHA 2OQEC 1BRJA 1RMSA 2BNGA 2L1SA 1ULJB 1TTOA 1VZZA 5D82A 5TGNA 3BNBA 3PZWA 3OWSA 1UI7A 4XBYA 2F86B 3D5IA 1W7CA 1ISKA 2XSOB 4HM7B 1IVUA 4K61A 2KCDA 5IENA 4IPBA 2F4YA 3PS8A 3FF2A 1BRNL 2WGQA 4MMZB 4GL6A 1FGQA 4NREA 4N3VA 1OF5B 1T2IA 3H51A 3SX1A 3CC43 2E2VA 3NM2A 4N6LA 1N8QA 2CW9A 3FG1A 3LYGA 3D4AA 4N6UA 1GY5A 3DM8A 1D6ZA 5GSPA 4KVHA 3AMOA 1LOVA 3STDA 1FUTA 1PY3A 3DUKA 1GMPA 1SJWA 3F8HA 5AI1A 3WOFB 1TFKA 3FGYA 1RNBA 3AGOA 2F98A 4LZIA 3NQYA 3D9RA 3BNEA 5EEOA 1RSNA 4KFEA 1A67A 3N54B 3NM7A 3WMDA 3HOHA 2ZL8A 1B2SA 2OTL3 1BNFA 2CH9A 5M18A 1CEWI 5LC6A 1UCIA 1UGIA 3JVCA 4HM1B 5G1LA 1IT7A 3NX0A 3X40A 3URPA 4KZ1A 3DGNA 3OXAA 4AEQA 1BUJA 3FG4A 2W6JH 1HU9A 1AVKA 3JUOA 2CG0A 1FA3A 1BOXA 1WNHA 1EKMA 1LOWA 1JB5A 2F5WA 3LMLA 2OCTA 3N8BA 3IJEB 1IT8A 1IDPA 4R80A 3Q3FA 1MOLA 2IY2A 3MSOA 1B21A 5EVHA 1IK3A 5CF2A 2GEYA 2L4VA 1I8VA 1OHSA 2SARA 4LYLB 1NU3A 3CNMA 3K7CA 4KT3B 5AIHA 4BTXA 1B3SA 2KF3A 3LH4A 3WA2X 3K9MC 4AKZA 3GRDA 1Z1SA 3B4OA 1X1XA 5STDA 1DVCA 5ELJA 2HMKB 1N5HA 3AGNA 2XF3A 3HIIA 1K8A4 4GSPA 2CFKA 4RZMA 2IMJA 3UB1A 3G713 3EN8A 1VQK3 4N6V0 4FMCA
chains in the Genus database with same CATH topology
3DZLA 4X2HA 3HZPA 3VGNA 1QAFA 3EBYA 5AIGA 1VQO3 3AMOB 3F40A 3VSYA 3X42A 4HM3B 1Q40A 1U8CB 2OOVC 3K63A 4HM2B 4FMAA 4N6OB 1TP6A 3RDEA 3KN4A 4HM6B 2CHCA 5IEOA 5IG0A 2RGQA 1ZX2A 1STDA 2YX9A 2Z77A 1E3VA 1DYUA 5AEWB 1FGMA 2BMQB 1S723 3CPW2 1AV4A 1KQS2 3CCQ3 3CCL3 2GU3A 2OQEA 5BXQA 1UUWB 4OK0A 3VF1A 2BMRB 1WMPA 5KP3A 4CDLA 5IF6A 4MJDA 1D6UA 1LXEA 4EBGA 2MF7A 1YI23 1O7NB 1ULIB 2XH9A 4XB5A 3S5CA 4U13A 3LXUX 3IMAB 3PCSA 3U1WA 3H3HA 4EV5A 4FCJA 1JRQA 1JNQA 3EJVA 2GBWB 3DMCA 4QWTA 2ZDJA 1TFOA 2CFWA 2XR8B 3GWRA 1O7PB 4MMYB 2XGNA 2KRTA 3CCM3 1QVG2 3NQZA 3E99A 4HM8B 3HX8A 1OHPA 5A0OB 3PCRA 7STDA 2CK3H 3KIIA 4WYKA 1PFPA 1K9M4 1Q7Y4 2E2UA 1JN5A 5JBSA 3UL5A 1L5GB 5IG3A 3GZRA 1KC84 3S29A 4K90B 3BNDA 3ECFA 3NHXA 2R4IA 1M904 2CC3A 3LT9A 3LTDA 4IIAA 1N5PA 3S27A 4HM4B 6STDA 3SOAA 3J7Yd 1CQSA 3OV4A 2HMMB 4HJLB 3LTBA 4H61A 4HYZA 1LVNA 2MC8A 1YIT3 1GYBA 1OH0A 1CYUA 1LNHA 1Q42A 1Q40B 2FXTA 2XFSA 2CFDA 4HZBB 2CWTA 3CC73 4XDWA 1JJ22 1RRLA 3EN1B 2PNCA 3LOYA 5I97A 1UI8A 4NHFA 3KZTA 2B1XB 1W6YA 4R9KA 3G0KA 2W56A 1W2B2 3SEDA 3FH1A 1Y4KA 3KE7A 4HM0B 1WMOA 2WO0A 1DVDA 2CWUA 2CFGA 2OTJ3 3CCV3 1YJN3 1QJGA 1OGXA 3B8LA 2K0MA 2P05A 4O2HA 4L7KA 3G6E3 4FMBA 3S67A 3DGOA 1FGTA 3X3YA 1TUHA 4HBRA 3OX9A 1F8NA 4CCVA 5EQLA 3CCJ3 1FUWA 3FCSB 1IV7A 3MG1A 2OOVA 3HK4A 2P0XA 5IW9A 4H3UA 3V98A 2ML6A 1OUNA 3K0ZA 3EE1A 4HKVB 2V1LA 4WWUC 4WYKB 1GS3A 1JN5B 2IUKA 4HVNA 1Q814 4K1UA 2Y73A 1RRHA 2YFLB 5IERA 3NXJA 1KSIA 3K5TA 1YIJ3 1EQKA 2F99A 2RFRA 2XFTA 5IEPA 1VQ63 3Q1CA 4FMDA 1DMNA 1W2ZA 1IVWA 2CKFB 5LC7A 2CWVA 4LEHA 1SPUA 1W5ZA 2QGUA 1W00A 1JKGA 4N6MA 1HKXA 1VQ53 1Q864 3S28A 4JF8A 1W6CA 1AVLA 2GXFA 5ELUA 1DMQA 1W4NA 2FNQA 1VQM3 3G16A 2OWPA 2BMOB 3RGRA 3NBJA 2QIYA 4KFDA 3QRDA 2IUJA 2YFJB 3LTAA 5D81A 1VQL3 1D6YA 1W6GA 3MG2A 5D83A 4R4KA 1R4CA 1IV9A 1YHQ3 3CXC2 1GY6A 4ZM8A 3NBBA 3WODG 3EF8A 3GZBA 2W2CA 4WFOA 1Q824 1JB2A 1WQLB 1J2BA 2M7OA 2Z7AA 3GAXA 3SLUA 1LOXA 5AYRB 2I9WA 1A90A 2GEXA 4LMIA 3BNCA 4R1KA 4EXRA 1NJI4 2O9UX 1N9JA 3O8YA 2C10A 2RCDA 2C11A 4MEIA 4I4KA 1ASKA 3FKAA 4R9LA 3F7XA 4RBNA 2W0QA 3EBTA 4O02B 1GD3A 4ORLA 4OVMA 3SOYA 5IG5A 3CC23 3FF0A 1ROVA 3DXOA 3UL6A 1GY7A 3PGBA 3G8ZA 2HMNB 3FZWA 3B4PA 3I0YA 3RGAA 2UX0A 3Q2PA 2P38A 3X3XA 3UJMA 5JPUA 1JKGB 1GD4A 3NUVA 2W9PA 2PZVA 4XBTA 1CYVA 3I563 1NDOB 3F7SA 4RNZA 3MHEA 2KXGA 1IU7A 4XDVA 1E3RA 1O7WB 2BO9B 3HI7A 3MYTA 3Q90A 1A2VA 3KSPA 2D42A 2INXA 3G4S3 8CHOA 3F8XA 2WOFA 2SBLA 2P0MA 3IPTA 1KD14 1FGOA 1N9EA 1KWIA 3ALAA 2CIUA 2LYXA 3CU3A 3BLZA 3A76A 3X3ZA 4AKYA 4OUQA 1SIIA 5AIIA 2XRXB 1RN7A 2LQVA 1N8R4 3GZXB 3CME3 3I553 5AIFA 1NWWA 2GBXB 3ROBA 4STDA 1K734 3FG3A 1V74A 4WP5A 1QMAA 3SXXA 3NV0A 1OCVA 2RSXA 4LSOA 1TIJA 2Q07A 1YVBI 4N6NB 4N6TA 3HIGA 3BB9A 2Z6BA 3KSED 4IT7A 4JRFA 1UUVB 4XBXA 1SQWA 2BHMA 1VQP3 2IA7A 1YGEA 3V99A 2FGTA 4GB5A 1NB5I 1SIHA 3SVAA 1US1A 1EG9B 4EV2A 3QK9A 2Z76A 4O3VA 3MPHA 3OWUA 1M1K4 4FCZA 4J8TA 1JB4A 2JDIH 3F14A 1IVXA 5CLKA 5CXOA 2GU1A 1A2KA 2E2TA 2HMOB 4O8SA 3DGMA 2XGLA 5BVBA 5JPPA 3L0RA 1QALA 3PYJA 3EX9A 3F9SA 3KFQC 5AEUB 1AR0A 1IVVA 5DRVA 1IQXA 4WHAA 1WTHA 1QVF2 3D3LA 2QA43 2YFIB 1VQN3 1DMMA 4J9AA 4HZ9B 3T8UA 2WGOA 1NB3I 4HM5B 1STFI 1O7MB 4FR9A 1VQ73 3T8NA 5FGOA 1O7HB 2B24B 2W03A 1MNLA 1ZO2A 3EC9A 3LZAA 4RNYA 2W56B 3FLJA 3CMA3 2CFLA 1UW1A 5G2GA 1JV2B 3CD63 1E97A 1M9GA 4G1MB 3EQQB 4EC6A 2STDA 2D1WA 1VQ83 3NV0B 1BUQA 4KFFA 5CF1A 4PEJA 1U5OA 3WA3A 1G96A 5DREA 3CCU3 1ROAA 4L8OA 3MWZA 5FW5A 5IG4A 2BT3A 2Y74A 1OF5A 5CK6A 5KP4A 2K54A 2P09A 3FSDA 3N9HA 1C7HA 3GZYB 4Q53A 1W02A 4L8PA 5HGRA 3LTCA 2WOHA 3NBRA 4TX4A 2HMLB 3JUQA 2W9QA 3WOEB 3CPOA 3T0UA 1M1XB 1IQ8A 3ER7A 3JUMA 1W01A 1NO3A 2O3OA 3TDGA 3PXMA 2XEPA 3JUNA 3OWYA 1TU5A 1VQ43 1VQ93 1FGRA 1RKYA 1RJOA 1OACA 3CCS3 4XM4A 1OHOA 3MKIA 2XSHB 4BTWA 4BTYA 3CCR3 1YJW3 5AYSC 2A15A 4MMXB 4FCMA 4K1VA 3EB8A 3U97A 3CCE3 4LGQA 2HMJB 1K41A 3X41A 4X2OA 1OPYA 3WDGB 2W04A 5KP1A 2QEX3 1WMNA 3DY5A 1YJ93 3UNLA 3KKGA 1EA2A 1S5AA 3MG3A 2JQ5A 3DGLA 2ML5A 3B7CA 3EHCA 3M8CA 2CG1A 1O7GB 1QAKA 1T5YA 3LT8A 3OW22 3JUPA 3V92A 1K28A 3CNXA 4EYCA 1IQYA 1OGZA 2OQEC 2BNGA 1PU4A 1ULJB 1VZZA 5D82A 5TGNA 3BNBA 3PZWA 3OWSA 1UI7A 4XBYA 2F86B 1ISKA 1W7CA 2XSOB 4HM7B 1IVUA 4K61A 2KCDA 5IENA 4IPBA 3PS8A 3FF2A 2WGQA 4MMZB 4GL6A 1FGQA 4NREA 4N3VA 1OF5B 3H51A 3SX1A 3CC43 2E2VA 3NM2A 4N6LA 1N8QA 2CW9A 3FG1A 3LYGA 4N6UA 1GY5A 3DM8A 1D6ZA 4KVHA 3AMOA 3STDA 3DUKA 1SJWA 3F8HA 5AI1A 3WOFB 1TFKA 3FGYA 2F98A 4LZIA 3NQYA 3D9RA 3BNEA 5EEOA 1A67A 4KFEA 3N54B 3NM7A 3WMDA 2ZL8A 2OTL3 2CH9A 1CEWI 5LC6A 3JVCA 4HM1B 1IT7A 3NX0A 3X40A 4KZ1A 3DGNA 3OXAA 4AEQA 3FG4A 2W6JH 1HU9A 1AVKA 3JUOA 2CG0A 1FA3A 1WNHA 1EKMA 1JB5A 3LMLA 2OCTA 3N8BA 3IJEB 1IT8A 1IDPA 4R80A 1MOLA 3MSOA 1IK3A 5EVHA 5CF2A 2GEYA 2L4VA 1OHSA 5AIHA 1NU3A 3CNMA 3K7CA 4BTXA 3WA2X 3LH4A 3K9MC 4AKZA 3GRDA 3B4OA 1Z1SA 5STDA 1DVCA 5ELJA 2HMKB 1N5HA 2XF3A 3HIIA 1K8A4 2CFKA 4RZMA 2IMJA 3UB1A 3G713 3EN8A 1VQK3 4N6V0 4FMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZL A;  4X2H A;  3HZP A;  3VGN A;  3EBY A;  5AIG A;  3F40 A;  3VSY A;  4HM3 B;  1Q40 A;  4HM2 B;  1TP6 A;  4HM6 B;  2CHC A;  5IEO A;  5IG0 A;  2RGQ A;  1ZX2 A;  1STD A;  2Z77 A;  1E3V A;  5AEW B;  2BMQ B;  5BXQ A;  1UUW B;  4CDL A;  2BMR B;  5KP3 A;  5IF6 A;  4MJD A;  1O7N B;  1ULI B;  3S5C A;  4XB5 A;  4U13 A;  3H3H A;  4FCJ A;  3EJV A;  2GBW B;  3DMC A;  2XR8 B;  3GWR A;  1O7P B;  4HM8 B;  3E99 A;  3HX8 A;  1OHP A;  7STD A;  4WYK A;  1JN5 A;  5IG3 A;  3GZR A;  3ECF A;  3NHX A;  2R4I A;  4IIA A;  6STD A;  4HM4 B;  3SOA A;  1CQS A;  3OV4 A;  2HMM B;  4HJL B;  1GYB A;  1OH0 A;  1Q42 A;  1Q40 B;  4HZB B;  4XDW A;  3EN1 B;  3KZT A;  2B1X B;  1W6Y A;  4R9K A;  3G0K A;  3SED A;  3FH1 A;  3KE7 A;  4HM0 B;  1QJG A;  1OGX A;  3B8L A;  4L7K A;  1TUH A;  3OX9 A;  3MG1 A;  3HK4 A;  4H3U A;  1OUN A;  3K0Z A;  4HKV B;  4WWU C;  4WYK B;  1GS3 A;  1JN5 B;  4HVN A;  4K1U A;  2YFL B;  5IER A;  3NXJ A;  2F99 A;  2RFR A;  5IEP A;  1DMN A;  2CKF B;  4LEH A;  2QGU A;  1W00 A;  1JKG A;  1HKX A;  2GXF A;  1DMQ A;  3G16 A;  2OWP A;  2BMO B;  3RGR A;  2QIY A;  2YFJ B;  5D81 A;  3MG2 A;  5D83 A;  1GY6 A;  3EF8 A;  3GZB A;  2W2C A;  1JB2 A;  1WQL B;  2Z7A A;  2I9W A;  2GEX A;  4LMI A;  4R1K A;  2RCD A;  4I4K A;  1ASK A;  3FKA A;  4R9L A;  3F7X A;  3EBT A;  4ORL A;  4OVM A;  3SOY A;  5IG5 A;  3FF0 A;  3DXO A;  1GY7 A;  3G8Z A;  2HMN B;  3FZW A;  3B4P A;  3I0Y A;  3RGA A;  2UX0 A;  3UJM A;  5JPU A;  1JKG B;  3NUV A;  2PZV A;  4XBT A;  1NDO B;  3F7S A;  3MHE A;  4XDV A;  1E3R A;  1O7W B;  3Q90 A;  3MYT A;  3KSP A;  2INX A;  8CHO A;  3F8X A;  3IPT A;  3CU3 A;  3BLZ A;  3A76 A;  4OUQ A;  5AII A;  2XRX B;  3GZX B;  5AIF A;  1NWW A;  2GBX B;  3ROB A;  4STD A;  4WP5 A;  1QMA A;  3NV0 A;  1OCV A;  3BB9 A;  1UUV B;  4XBX A;  4GB5 A;  1EG9 B;  2Z76 A;  3OWU A;  4J8T A;  1JB4 A;  3F14 A;  5CLK A;  5CXO A;  1A2K A;  2HMO B;  5BVB A;  5JPP A;  3EX9 A;  3F9S A;  5AEU B;  1AR0 A;  5DRV A;  2YFI B;  1DMM A;  4J9A A;  4HZ9 B;  3T8U A;  4HM5 B;  1O7M B;  3T8N A;  1O7H B;  2B24 B;  1ZO2 A;  3EC9 A;  3LZA A;  3FLJ A;  5G2G A;  1E97 A;  3EQQ B;  2STD A;  1BUQ A;  3NV0 B;  5CF1 A;  4PEJ A;  1U5O A;  5DRE A;  4L8O A;  5FW5 A;  5IG4 A;  1OF5 A;  5CK6 A;  5KP4 A;  2K54 A;  3FSD A;  1C7H A;  3GZY B;  4Q53 A;  1W02 A;  4L8P A;  5HGR A;  3NBR A;  2HML B;  3JUQ A;  3CPO A;  3ER7 A;  3JUM A;  1W01 A;  3JUN A;  3OWY A;  4XM4 A;  1OHO A;  3MKI A;  2XSH B;  2A15 A;  4FCM A;  4K1V A;  4LGQ A;  2HMJ B;  1K41 A;  4X2O A;  1OPY A;  5KP1 A;  3UNL A;  3KKG A;  1EA2 A;  1S5A A;  3MG3 A;  2JQ5 A;  3EHC A;  3B7C A;  3M8C A;  1O7G B;  3JUP A;  3CNX A;  1OGZ A;  2BNG A;  1ULJ B;  1VZZ A;  5D82 A;  5TGN A;  3OWS A;  4XBY A;  2F86 B;  1ISK A;  2XSO B;  4HM7 B;  5IEN A;  3FF2 A;  4N3V A;  1OF5 B;  3H51 A;  3NM2 A;  3LYG A;  1GY5 A;  3DM8 A;  4KVH A;  3STD A;  3DUK A;  1SJW A;  3F8H A;  5AI1 A;  3FGY A;  2F98 A;  3D9R A;  3WMD A;  4HM1 B;  3OXA A;  3JUO A;  1JB5 A;  1IDP A;  3MSO A;  5EVH A;  5CF2 A;  2GEY A;  1OHS A;  5AIH A;  1NU3 A;  3CNM A;  3K7C A;  3GRD A;  1Z1S A;  5STD A;  3B4O A;  2HMK B;  4RZM A;  2IMJ A;  3EN8 A; 
#chains in the Genus database with same CATH topology
 3DZL A;  4X2H A;  3HZP A;  3VGN A;  1QAF A;  3EBY A;  5AIG A;  1VQO 3;  3AMO B;  3F40 A;  4HOH A;  3VSY A;  3X42 A;  4HM3 B;  1BNI A;  1Q40 A;  1U8C B;  2OOV C;  3K63 A;  4HM2 B;  4FMA A;  4N6O B;  1TP6 A;  3RDE A;  3KN4 A;  4HM6 B;  2CHC A;  4NPB A;  5IEO A;  1BNS A;  2RGQ A;  5IG0 A;  1ZX2 A;  4BL2 A;  1STD A;  2YX9 A;  2Z77 A;  1AQZ A;  1E3V A;  3AHW A;  1DYU A;  5AEW B;  1FGM A;  2BMQ B;  1S72 3;  3CPW 2;  1AV4 A;  1EEJ A;  3CCQ 3;  1KQS 2;  3CCL 3;  2GU3 A;  2OQE A;  5BXQ A;  1UUW B;  4OK0 A;  3VF1 A;  2BMR B;  1WMP A;  5KP3 A;  4CDL A;  2F56 A;  5IF6 A;  4HAA A;  4MJD A;  1D6U A;  1LXE A;  4EBG A;  2MF7 A;  1YI2 3;  1O7N B;  1ULI B;  2HOH A;  2XH9 A;  4XB5 A;  4U13 A;  3LXU X;  3IMA B;  3PCS A;  2AAD A;  3S5C A;  3H3H A;  1G0T A;  4FCJ A;  1JRQ A;  3U1W A;  4EV5 A;  1JNQ A;  3EJV A;  1I70 A;  2GBW B;  3DMC A;  4QWT A;  4CPK A;  2ZDJ A;  3RNT A;  1BNG A;  1B27 A;  1TFO A;  3ZG0 A;  1GOU A;  1Q9E A;  1YGW A;  1B2Z A;  2AAE A;  2CFW A;  2XR8 B;  3GWR A;  5M1A A;  1O7P B;  4MMY B;  2XGN A;  1I3F A;  1BSB A;  2KRT A;  2UUG C;  3CCM 3;  4J5G A;  1FUS A;  7GSP A;  3NQZ A;  3E99 A;  1RGC A;  3HX8 A;  4HM8 B;  1OHP A;  1RN4 A;  4J5K A;  5A0O B;  1SAR A;  3PCR A;  7STD A;  2CK3 H;  3KII A;  1I3I A;  1PFP A;  4WYK A;  1Q7Y 4;  1K9M 4;  6GSP A;  2E2U A;  1LOY A;  1JN5 A;  5JBS A;  3UL5 A;  1BNJ A;  1L5G B;  3GZR A;  5IG3 A;  1KC8 4;  3S29 A;  4K90 B;  3AHS A;  5M19 A;  3BND A;  3ECF A;  3NHX A;  1A2P A;  2R4I A;  1M90 4;  2CC3 A;  3LT9 A;  3LTD A;  4IIA A;  1N5P A;  3S27 A;  4HM4 B;  6STD A;  3SOA A;  1GSP A;  3J7Y d;  1CQS A;  3KCH A;  2HMM B;  1TJD A;  3LTB A;  3OV4 A;  4H61 A;  4HJL B;  4HYZ A;  1LVN A;  2MC8 A;  1YIT 3;  1GYB A;  1NNV A;  1OH0 A;  3ZFZ A;  1CYU A;  2J8X B;  1LNH A;  1Q42 A;  1Q40 B;  2FXT A;  2XFS A;  2CFD A;  4HZB B;  2CWT A;  2ZHX B;  3BIR A;  3CC7 3;  4XDW A;  1JJ2 2;  1RRL A;  1C54 A;  3EN1 B;  2PNC A;  3LOY A;  5I97 A;  1RLS A;  1UI8 A;  1RGE A;  4NHF A;  3KZT A;  2B1X B;  1W6Y A;  4I5Q A;  4R9K A;  3G0K A;  1RCL A;  2W56 A;  5G1K A;  1W2B 2;  3SED A;  3FH1 A;  1BNR A;  1YVS A;  1Y4K A;  3BU4 A;  3KE7 A;  4HM0 B;  1WMO A;  2BIR A;  2WO0 A;  1RGG A;  2CWU A;  4CJN A;  1DVD A;  1GOV A;  2CFG A;  2OTJ 3;  3CCV 3;  2UGI A;  1YJN 3;  1QJG A;  1DE3 A;  2KF4 A;  1MGR A;  1OGX A;  3B8L A;  2K0M A;  2P05 A;  4O2H A;  4L7K A;  6RNT A;  3G6E 3;  4FMB A;  3S67 A;  3DGO A;  1FGT A;  3X3Y A;  1TUH A;  2ZA4 A;  4HBR A;  3OX9 A;  1F8N A;  2H0I A;  1RGF A;  1X1Y A;  5EQL A;  4CCV A;  3CCJ 3;  1X1U A;  3FCS B;  1FUW A;  1IV7 A;  3MG1 A;  2OOV A;  3HK4 A;  2P0X A;  5IW9 A;  1BIR A;  4H3U A;  3V98 A;  2ML6 A;  1OUN A;  3K0Z A;  3EE1 A;  4HKV B;  2V1L A;  4WWU C;  4WYK B;  1MWU A;  1RGK A;  1GS3 A;  1BSC A;  1JN5 B;  2IUK A;  4HVN A;  1Q81 4;  1YNV X;  4K1U A;  2Y73 A;  1RRH A;  2YFL B;  5IER A;  3NXJ A;  1KSI A;  3K5T A;  1YIJ 3;  1EQK A;  2F99 A;  2RFR A;  2XFT A;  1EUI C;  5IEP A;  1VQ6 3;  3DH2 A;  3Q1C A;  4FMD A;  1DMN A;  1W2Z A;  1IVW A;  2CKF B;  5LC7 A;  1DET A;  2CWV A;  1SPU A;  1W5Z A;  2QGU A;  4LEH A;  1W00 A;  1JKG A;  4N6M A;  1HKX A;  1VQ5 3;  1Q86 4;  3S28 A;  4JF8 A;  1W6C A;  1AVL A;  2GXF A;  5ELU A;  1DMQ A;  3GSP A;  1W4N A;  2CX1 A;  2FNQ A;  1VQM 3;  3G16 A;  2OWP A;  2BMO B;  3RGR A;  1R4Y A;  3NBJ A;  2QIY A;  4KFD A;  3QRD A;  2IUJ A;  2YFJ B;  3LTA A;  5D81 A;  1VQL 3;  1D6Y A;  1W6G A;  3MG2 A;  1I0V A;  2F5M A;  4RNT A;  5D83 A;  1BSE A;  1I2E A;  4R4K A;  1HYF A;  1R4C A;  1IV9 A;  1YHQ 3;  1BAN A;  1V57 A;  3CXC 2;  1GY6 A;  4ZM8 A;  3NBB A;  3WOD G;  3EF8 A;  1B20 A;  3GZB A;  2W2C A;  4WFO A;  1Q82 4;  1JB2 A;  1WQL B;  1J2B A;  2M7O A;  1FYS A;  1RDS A;  2Z7A A;  5BU4 A;  1BRI A;  1TRQ A;  3GAX A;  3SLU A;  1LOX A;  5AYR B;  2I9W A;  1A90 A;  2GEX A;  4LMI A;  1I0X A;  3BNC A;  4R1K A;  4EXR A;  1NJI 4;  2O9U X;  1N9J A;  3O8Y A;  2C10 A;  2RCD A;  2C11 A;  4MEI A;  4I4K A;  1LQM B;  1ASK A;  3FKA A;  4R9L A;  3F7X A;  3SYU A;  4RBN A;  2W0Q A;  1FZU A;  3EBT A;  4O02 B;  1GD3 A;  3A5E A;  1UUG B;  4ORL A;  4OVM A;  1V58 A;  3SOY A;  5IG5 A;  1PU4 A;  3CC2 3;  3FF0 A;  1ROV A;  3DXO A;  3UL6 A;  1GY7 A;  1RGH A;  3PGB A;  3G8Z A;  2HMN B;  3FZW A;  3B4P A;  3I0Y A;  3RGA A;  2UX0 A;  3Q2P A;  4DKI A;  2P38 A;  3X3X A;  3UJM A;  5JPU A;  1BRS A;  1BVI A;  1JKG B;  1GD4 A;  3NUV A;  2W9P A;  1JBR A;  2PZV A;  4XBT A;  1CYV A;  3I56 3;  1NDO B;  3F7S A;  4RNZ A;  1MWT A;  3MHE A;  2KXG A;  1IU7 A;  4XDV A;  1E3R A;  1O7W B;  2BO9 B;  3HI7 A;  3MYT A;  1MWS A;  3Q90 A;  1A2V A;  3KSP A;  2D42 A;  2C4B A;  2INX A;  3G4S 3;  4ILF A;  8CHO A;  3F8X A;  2WOF A;  2SBL A;  2P0M A;  3IPT A;  1KD1 4;  1FGO A;  1N9E A;  1LRA A;  4EW5 A;  1KWI A;  3ALA A;  7RNT A;  2CIU A;  2LYX A;  1GOY A;  3CU3 A;  3BLZ A;  3A76 A;  3X3Z A;  4AKY A;  1UDI I;  4OUQ A;  1SII A;  4GHO A;  5AII A;  2XRX B;  1RN7 A;  2LQV A;  1N8R 4;  3GZX B;  3CME 3;  3I55 3;  5AIF A;  1NWW A;  2GBX B;  3ROB A;  4STD A;  1K73 4;  3FG3 A;  1CH0 A;  1V74 A;  4BU4 A;  1UCL A;  1QMA A;  4WP5 A;  3NV0 A;  3SXX A;  2RBI A;  1OCV A;  2RSX A;  4LSO A;  1TIJ A;  2Q07 A;  1YVB I;  4N6N B;  4N6T A;  3HIG A;  3BB9 A;  2Z6B A;  3KSE D;  4IT7 A;  4JRF A;  1RCK A;  1UUV B;  4XBX A;  1SQW A;  2BHM A;  1VQP 3;  2IA7 A;  1YGE A;  3V99 A;  2FGT A;  1MWR A;  1MGW A;  4GB5 A;  1NB5 I;  1SIH A;  3SVA A;  1US1 A;  1EG9 B;  4EV2 A;  3QK9 A;  1PYL A;  2Z76 A;  1I2F A;  4O3V A;  1BU4 A;  3DGY A;  3MPH A;  3OWU A;  1M1K 4;  1RHL A;  1T3B A;  2BU4 A;  4FCZ A;  4J8T A;  1JB4 A;  2JDI H;  3F14 A;  1IVX A;  5CLK A;  5CXO A;  2GU1 A;  1A2K A;  2E2T A;  2HMO B;  4O8S A;  3DGM A;  2XGL A;  5BVB A;  5JPP A;  3L0R A;  1QAL A;  3PYJ A;  1BSD A;  3EX9 A;  3F9S A;  3KFQ C;  1BAO A;  5AEU B;  1AR0 A;  1IVV A;  5DRV A;  1RGL A;  1IQX A;  4WHA A;  1UGH I;  1WTH A;  1GMR A;  1QVF 2;  3D3L A;  2QA4 3;  1TRP A;  2YFI B;  1VQN 3;  1DMM A;  4J9A A;  1X1W A;  4HZ9 B;  3T8U A;  2KAA A;  2WGO A;  8RNT A;  1NB3 I;  1B2U A;  1JZO A;  2K3D A;  1STF I;  1O7M B;  4HM5 B;  4FR9 A;  1G02 A;  1VQ7 3;  3T8N A;  5FGO A;  1O7H B;  4BL3 A;  5RNT A;  2B24 B;  1LQG C;  2IYJ A;  1BSA A;  2W03 A;  1MNL A;  3WR2 A;  1BRH A;  1ZO2 A;  3EC9 A;  3LZA A;  4RNY A;  2W56 B;  3FLJ A;  3CMA 3;  1IYY A;  2CFL A;  1HZ1 A;  1UW1 A;  1JV2 B;  5G2G A;  1RTU A;  3CD6 3;  1E97 A;  1M9G A;  4G1M B;  5BIR A;  3EQQ B;  4EC6 A;  2STD A;  2D1W A;  1RNT A;  2KF6 A;  1VQ8 3;  2CX0 A;  3NV0 B;  1JBS A;  4KFF A;  1BUQ A;  5CF1 A;  4PEJ A;  1ZGX A;  1FW7 A;  1RN1 A;  1U5O A;  3WA3 A;  1G96 A;  5DRE A;  3CCU 3;  1ROA A;  4L8O A;  9RNT A;  3MWZ A;  2H0G A;  1BRG A;  5FW5 A;  1AY7 A;  2KF5 A;  5IG4 A;  2BT3 A;  2Y74 A;  1OF5 A;  1LNI A;  1RGA A;  1GMQ A;  5CK6 A;  5KP4 A;  2K54 A;  2P09 A;  3FSD A;  3N9H A;  1C7H A;  3GZY B;  4Q53 A;  1Q7H A;  1W02 A;  4L8P A;  5HGR A;  3LTC A;  2WOH A;  3NBR A;  4TX4 A;  1T2H A;  2HML B;  3JUQ A;  2W9Q A;  3WOE B;  3CPO A;  1BNE A;  3T0U A;  1M1X B;  2H0H A;  1IQ8 A;  1BGS A;  3ER7 A;  3JUM A;  1W01 A;  1NO3 A;  2O3O A;  3TDG A;  1UCJ A;  1ZS7 A;  3WHO A;  1BRK A;  3PXM A;  2XEP A;  3JUN A;  1UCK A;  3OWY A;  1TU5 A;  3D5G A;  1VQ4 3;  1VQ9 3;  1FGR A;  1RKY A;  1RJO A;  1OAC A;  1B2M A;  3CCS 3;  4XM4 A;  1OHO A;  3MKI A;  2XSH B;  4BTW A;  1I2G A;  4BTY A;  3CCR 3;  1YJW 3;  5AYS C;  2A15 A;  4MMX B;  4FCM A;  4K1V A;  3EB8 A;  3U97 A;  1JBT A;  4BIR A;  3CCE 3;  4LGQ A;  2HMJ B;  1K41 A;  3X41 A;  4X2O A;  2R41 A;  1OPY A;  3WDG B;  2W04 A;  5KP1 A;  2QEX 3;  1WMN A;  3DY5 A;  1QVG 2;  1YJ9 3;  2RNT A;  3UNL A;  3KKG A;  1EA2 A;  1S5A A;  3MG3 A;  2JQ5 A;  1VQQ A;  3DGL A;  2ML5 A;  2GSP A;  3B7C A;  3EHC A;  3M8C A;  2CG1 A;  1O7G B;  1QAK A;  1T5Y A;  3LT8 A;  3OW2 2;  3JUP A;  3V92 A;  1JZD A;  1K28 A;  3CNX A;  4EYC A;  1IQY A;  3ZG5 A;  1OGZ A;  1B2X A;  3D79 A;  5HOH A;  2OQE C;  1BRJ A;  1RMS A;  2BNG A;  2L1S A;  1ULJ B;  1TTO A;  1VZZ A;  5D82 A;  5TGN A;  3BNB A;  3PZW A;  3OWS A;  1UI7 A;  4XBY A;  2F86 B;  3D5I A;  1W7C A;  1ISK A;  2XSO B;  4HM7 B;  1IVU A;  4K61 A;  2KCD A;  5IEN A;  4IPB A;  2F4Y A;  3PS8 A;  3FF2 A;  1BRN L;  2WGQ A;  4MMZ B;  4GL6 A;  1FGQ A;  4NRE A;  4N3V A;  1OF5 B;  1T2I A;  3H51 A;  3SX1 A;  3CC4 3;  2E2V A;  3NM2 A;  4N6L A;  1N8Q A;  2CW9 A;  3FG1 A;  3LYG A;  3D4A A;  4N6U A;  1GY5 A;  3DM8 A;  1D6Z A;  5GSP A;  4KVH A;  3AMO A;  1LOV A;  3STD A;  1FUT A;  1PY3 A;  3DUK A;  1GMP A;  1SJW A;  3F8H A;  5AI1 A;  3WOF B;  1TFK A;  3FGY A;  1RNB A;  3AGO A;  2F98 A;  4LZI A;  3NQY A;  3D9R A;  3BNE A;  5EEO A;  1RSN A;  4KFE A;  1A67 A;  3N54 B;  3NM7 A;  3WMD A;  3HOH A;  2ZL8 A;  1B2S A;  2OTL 3;  1BNF A;  2CH9 A;  5M18 A;  1CEW I;  5LC6 A;  1UCI A;  1UGI A;  3JVC A;  4HM1 B;  5G1L A;  1IT7 A;  3NX0 A;  3X40 A;  3URP A;  4KZ1 A;  3DGN A;  3OXA A;  4AEQ A;  1BUJ A;  3FG4 A;  2W6J H;  1HU9 A;  1AVK A;  3JUO A;  2CG0 A;  1FA3 A;  1BOX A;  1WNH A;  1EKM A;  1LOW A;  1JB5 A;  2F5W A;  3LML A;  2OCT A;  3N8B A;  3IJE B;  1IT8 A;  1IDP A;  4R80 A;  3Q3F A;  1MOL A;  2IY2 A;  3MSO A;  1B21 A;  5EVH A;  1IK3 A;  5CF2 A;  2GEY A;  2L4V A;  1I8V A;  1OHS A;  2SAR A;  4LYL B;  1NU3 A;  3CNM A;  3K7C A;  4KT3 B;  5AIH A;  4BTX A;  1B3S A;  2KF3 A;  3LH4 A;  3WA2 X;  3K9M C;  4AKZ A;  3GRD A;  1Z1S A;  3B4O A;  1X1X A;  5STD A;  1DVC A;  5ELJ A;  2HMK B;  1N5H A;  3AGN A;  2XF3 A;  3HII A;  1K8A 4;  4GSP A;  2CFK A;  4RZM A;  2IMJ A;  3UB1 A;  3G71 3;  3EN8 A;  1VQK 3;  4N6V 0;  4FMC A; 
#chains in the Genus database with same CATH homology
 3DZL A;  4X2H A;  3HZP A;  3VGN A;  1QAF A;  3EBY A;  5AIG A;  1VQO 3;  3AMO B;  3F40 A;  3VSY A;  3X42 A;  4HM3 B;  1Q40 A;  1U8C B;  2OOV C;  3K63 A;  4HM2 B;  4FMA A;  4N6O B;  1TP6 A;  3RDE A;  3KN4 A;  4HM6 B;  2CHC A;  5IEO A;  5IG0 A;  2RGQ A;  1ZX2 A;  1STD A;  2YX9 A;  2Z77 A;  1E3V A;  1DYU A;  5AEW B;  1FGM A;  2BMQ B;  1S72 3;  3CPW 2;  1AV4 A;  1KQS 2;  3CCQ 3;  3CCL 3;  2GU3 A;  2OQE A;  5BXQ A;  1UUW B;  4OK0 A;  3VF1 A;  2BMR B;  1WMP A;  5KP3 A;  4CDL A;  5IF6 A;  4MJD A;  1D6U A;  1LXE A;  4EBG A;  2MF7 A;  1YI2 3;  1O7N B;  1ULI B;  2XH9 A;  4XB5 A;  3S5C A;  4U13 A;  3LXU X;  3IMA B;  3PCS A;  3U1W A;  3H3H A;  4EV5 A;  4FCJ A;  1JRQ A;  1JNQ A;  3EJV A;  2GBW B;  3DMC A;  4QWT A;  2ZDJ A;  1TFO A;  2CFW A;  2XR8 B;  3GWR A;  1O7P B;  4MMY B;  2XGN A;  2KRT A;  3CCM 3;  1QVG 2;  3NQZ A;  3E99 A;  4HM8 B;  3HX8 A;  1OHP A;  5A0O B;  3PCR A;  7STD A;  2CK3 H;  3KII A;  4WYK A;  1PFP A;  1K9M 4;  1Q7Y 4;  2E2U A;  1JN5 A;  5JBS A;  3UL5 A;  1L5G B;  5IG3 A;  3GZR A;  1KC8 4;  3S29 A;  4K90 B;  3BND A;  3ECF A;  3NHX A;  2R4I A;  1M90 4;  2CC3 A;  3LT9 A;  3LTD A;  4IIA A;  1N5P A;  3S27 A;  4HM4 B;  6STD A;  3SOA A;  3J7Y d;  1CQS A;  3OV4 A;  2HMM B;  4HJL B;  3LTB A;  4H61 A;  4HYZ A;  1LVN A;  2MC8 A;  1YIT 3;  1GYB A;  1OH0 A;  1CYU A;  1LNH A;  1Q42 A;  1Q40 B;  2FXT A;  2XFS A;  2CFD A;  4HZB B;  2CWT A;  3CC7 3;  4XDW A;  1JJ2 2;  1RRL A;  3EN1 B;  2PNC A;  3LOY A;  5I97 A;  1UI8 A;  4NHF A;  3KZT A;  2B1X B;  1W6Y A;  4R9K A;  3G0K A;  2W56 A;  1W2B 2;  3SED A;  3FH1 A;  1Y4K A;  3KE7 A;  4HM0 B;  1WMO A;  2WO0 A;  1DVD A;  2CWU A;  2CFG A;  2OTJ 3;  3CCV 3;  1YJN 3;  1QJG A;  1OGX A;  3B8L A;  2K0M A;  2P05 A;  4O2H A;  4L7K A;  3G6E 3;  4FMB A;  3S67 A;  3DGO A;  1FGT A;  3X3Y A;  1TUH A;  4HBR A;  3OX9 A;  1F8N A;  4CCV A;  5EQL A;  3CCJ 3;  1FUW A;  3FCS B;  1IV7 A;  3MG1 A;  2OOV A;  3HK4 A;  2P0X A;  5IW9 A;  4H3U A;  3V98 A;  2ML6 A;  1OUN A;  3K0Z A;  3EE1 A;  4HKV B;  2V1L A;  4WWU C;  4WYK B;  1GS3 A;  1JN5 B;  2IUK A;  4HVN A;  1Q81 4;  4K1U A;  2Y73 A;  1RRH A;  2YFL B;  5IER A;  3NXJ A;  1KSI A;  3K5T A;  1YIJ 3;  1EQK A;  2F99 A;  2RFR A;  2XFT A;  5IEP A;  1VQ6 3;  3Q1C A;  4FMD A;  1DMN A;  1W2Z A;  1IVW A;  2CKF B;  5LC7 A;  2CWV A;  4LEH A;  1SPU A;  1W5Z A;  2QGU A;  1W00 A;  1JKG A;  4N6M A;  1HKX A;  1VQ5 3;  1Q86 4;  3S28 A;  4JF8 A;  1W6C A;  1AVL A;  2GXF A;  5ELU A;  1DMQ A;  1W4N A;  2FNQ A;  1VQM 3;  3G16 A;  2OWP A;  2BMO B;  3RGR A;  3NBJ A;  2QIY A;  4KFD A;  3QRD A;  2IUJ A;  2YFJ B;  3LTA A;  5D81 A;  1VQL 3;  1D6Y A;  1W6G A;  3MG2 A;  5D83 A;  4R4K A;  1R4C A;  1IV9 A;  1YHQ 3;  3CXC 2;  1GY6 A;  4ZM8 A;  3NBB A;  3WOD G;  3EF8 A;  3GZB A;  2W2C A;  4WFO A;  1Q82 4;  1JB2 A;  1WQL B;  1J2B A;  2M7O A;  2Z7A A;  3GAX A;  3SLU A;  1LOX A;  5AYR B;  2I9W A;  1A90 A;  2GEX A;  4LMI A;  3BNC A;  4R1K A;  4EXR A;  1NJI 4;  2O9U X;  1N9J A;  3O8Y A;  2C10 A;  2RCD A;  2C11 A;  4MEI A;  4I4K A;  1ASK A;  3FKA A;  4R9L A;  3F7X A;  4RBN A;  2W0Q A;  3EBT A;  4O02 B;  1GD3 A;  4ORL A;  4OVM A;  3SOY A;  5IG5 A;  3CC2 3;  3FF0 A;  1ROV A;  3DXO A;  3UL6 A;  1GY7 A;  3PGB A;  3G8Z A;  2HMN B;  3FZW A;  3B4P A;  3I0Y A;  3RGA A;  2UX0 A;  3Q2P A;  2P38 A;  3X3X A;  3UJM A;  5JPU A;  1JKG B;  1GD4 A;  3NUV A;  2W9P A;  2PZV A;  4XBT A;  1CYV A;  3I56 3;  1NDO B;  3F7S A;  4RNZ A;  3MHE A;  2KXG A;  1IU7 A;  4XDV A;  1E3R A;  1O7W B;  2BO9 B;  3HI7 A;  3MYT A;  3Q90 A;  1A2V A;  3KSP A;  2D42 A;  2INX A;  3G4S 3;  8CHO A;  3F8X A;  2WOF A;  2SBL A;  2P0M A;  3IPT A;  1KD1 4;  1FGO A;  1N9E A;  1KWI A;  3ALA A;  2CIU A;  2LYX A;  3CU3 A;  3BLZ A;  3A76 A;  3X3Z A;  4AKY A;  4OUQ A;  1SII A;  5AII A;  2XRX B;  1RN7 A;  2LQV A;  1N8R 4;  3GZX B;  3CME 3;  3I55 3;  5AIF A;  1NWW A;  2GBX B;  3ROB A;  4STD A;  1K73 4;  3FG3 A;  1V74 A;  4WP5 A;  1QMA A;  3SXX A;  3NV0 A;  1OCV A;  2RSX A;  4LSO A;  1TIJ A;  2Q07 A;  1YVB I;  4N6N B;  4N6T A;  3HIG A;  3BB9 A;  2Z6B A;  3KSE D;  4IT7 A;  4JRF A;  1UUV B;  4XBX A;  1SQW A;  2BHM A;  1VQP 3;  2IA7 A;  1YGE A;  3V99 A;  2FGT A;  4GB5 A;  1NB5 I;  1SIH A;  3SVA A;  1US1 A;  1EG9 B;  4EV2 A;  3QK9 A;  2Z76 A;  4O3V A;  3MPH A;  3OWU A;  1M1K 4;  4FCZ A;  4J8T A;  1JB4 A;  2JDI H;  3F14 A;  1IVX A;  5CLK A;  5CXO A;  2GU1 A;  1A2K A;  2E2T A;  2HMO B;  4O8S A;  3DGM A;  2XGL A;  5BVB A;  5JPP A;  3L0R A;  1QAL A;  3PYJ A;  3EX9 A;  3F9S A;  3KFQ C;  5AEU B;  1AR0 A;  1IVV A;  5DRV A;  1IQX A;  4WHA A;  1WTH A;  1QVF 2;  3D3L A;  2QA4 3;  2YFI B;  1VQN 3;  1DMM A;  4J9A A;  4HZ9 B;  3T8U A;  2WGO A;  1NB3 I;  4HM5 B;  1STF I;  1O7M B;  4FR9 A;  1VQ7 3;  3T8N A;  5FGO A;  1O7H B;  2B24 B;  2W03 A;  1MNL A;  1ZO2 A;  3EC9 A;  3LZA A;  4RNY A;  2W56 B;  3FLJ A;  3CMA 3;  2CFL A;  1UW1 A;  5G2G A;  1JV2 B;  3CD6 3;  1E97 A;  1M9G A;  4G1M B;  3EQQ B;  4EC6 A;  2STD A;  2D1W A;  1VQ8 3;  3NV0 B;  1BUQ A;  4KFF A;  5CF1 A;  4PEJ A;  1U5O A;  3WA3 A;  1G96 A;  5DRE A;  3CCU 3;  1ROA A;  4L8O A;  3MWZ A;  5FW5 A;  5IG4 A;  2BT3 A;  2Y74 A;  1OF5 A;  5CK6 A;  5KP4 A;  2K54 A;  2P09 A;  3FSD A;  3N9H A;  1C7H A;  3GZY B;  4Q53 A;  1W02 A;  4L8P A;  5HGR A;  3LTC A;  2WOH A;  3NBR A;  4TX4 A;  2HML B;  3JUQ A;  2W9Q A;  3WOE B;  3CPO A;  3T0U A;  1M1X B;  1IQ8 A;  3ER7 A;  3JUM A;  1W01 A;  1NO3 A;  2O3O A;  3TDG A;  3PXM A;  2XEP A;  3JUN A;  3OWY A;  1TU5 A;  1VQ4 3;  1VQ9 3;  1FGR A;  1RKY A;  1RJO A;  1OAC A;  3CCS 3;  4XM4 A;  1OHO A;  3MKI A;  2XSH B;  4BTW A;  4BTY A;  3CCR 3;  1YJW 3;  5AYS C;  2A15 A;  4MMX B;  4FCM A;  4K1V A;  3EB8 A;  3U97 A;  3CCE 3;  4LGQ A;  2HMJ B;  1K41 A;  3X41 A;  4X2O A;  1OPY A;  3WDG B;  2W04 A;  5KP1 A;  2QEX 3;  1WMN A;  3DY5 A;  1YJ9 3;  3UNL A;  3KKG A;  1EA2 A;  1S5A A;  3MG3 A;  2JQ5 A;  3DGL A;  2ML5 A;  3B7C A;  3EHC A;  3M8C A;  2CG1 A;  1O7G B;  1QAK A;  1T5Y A;  3LT8 A;  3OW2 2;  3JUP A;  3V92 A;  1K28 A;  3CNX A;  4EYC A;  1IQY A;  1OGZ A;  2OQE C;  2BNG A;  1PU4 A;  1ULJ B;  1VZZ A;  5D82 A;  5TGN A;  3BNB A;  3PZW A;  3OWS A;  1UI7 A;  4XBY A;  2F86 B;  1ISK A;  1W7C A;  2XSO B;  4HM7 B;  1IVU A;  4K61 A;  2KCD A;  5IEN A;  4IPB A;  3PS8 A;  3FF2 A;  2WGQ A;  4MMZ B;  4GL6 A;  1FGQ A;  4NRE A;  4N3V A;  1OF5 B;  3H51 A;  3SX1 A;  3CC4 3;  2E2V A;  3NM2 A;  4N6L A;  1N8Q A;  2CW9 A;  3FG1 A;  3LYG A;  4N6U A;  1GY5 A;  3DM8 A;  1D6Z A;  4KVH A;  3AMO A;  3STD A;  3DUK A;  1SJW A;  3F8H A;  5AI1 A;  3WOF B;  1TFK A;  3FGY A;  2F98 A;  4LZI A;  3NQY A;  3D9R A;  3BNE A;  5EEO A;  1A67 A;  4KFE A;  3N54 B;  3NM7 A;  3WMD A;  2ZL8 A;  2OTL 3;  2CH9 A;  1CEW I;  5LC6 A;  3JVC A;  4HM1 B;  1IT7 A;  3NX0 A;  3X40 A;  4KZ1 A;  3DGN A;  3OXA A;  4AEQ A;  3FG4 A;  2W6J H;  1HU9 A;  1AVK A;  3JUO A;  2CG0 A;  1FA3 A;  1WNH A;  1EKM A;  1JB5 A;  3LML A;  2OCT A;  3N8B A;  3IJE B;  1IT8 A;  1IDP A;  4R80 A;  1MOL A;  3MSO A;  1IK3 A;  5EVH A;  5CF2 A;  2GEY A;  2L4V A;  1OHS A;  5AIH A;  1NU3 A;  3CNM A;  3K7C A;  4BTX A;  3WA2 X;  3LH4 A;  3K9M C;  4AKZ A;  3GRD A;  3B4O A;  1Z1S A;  5STD A;  1DVC A;  5ELJ A;  2HMK B;  1N5H A;  2XF3 A;  3HII A;  1K8A 4;  2CFK A;  4RZM A;  2IMJ A;  3UB1 A;  3G71 3;  3EN8 A;  1VQK 3;  4N6V 0;  4FMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...