1FZUA

Rnase t1 v78a mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRAVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1fzuA00
1TTOA 1G02A 1I2EA 2SARA 1RGGA 1LOVA 1BU4A 1UCKA 2RBIA 1FUTA 1DE3A 1GMRA 1RDSA 3BIRA 1LRAA 3AHSA 1X1YA 4GHOA 8RNTA 1BNRA 1RGAA 1IYYA 1RTUA 1SARA 1I0XA 1JBSA 1B2UA 2KF4A 1UCIA 3AGNA 3D4AA 9RNTA 1BRGA 1BRIA 1HYFA 1I8VA 1T2IA 3SYUA 1BRNL 1RCKA 3AGOA 3DGYA 1RNBA 1RGKA 1RGFA 3A5EA 1I3IA 1BSBA 1LOYA 1PY3A 1B20A 1FZUA 4HOHA 1BAOA 2KF5A 3Q3FA 1BRKA 1JBRA 1I3FA 1RGCA 5BIRA 1A2PA 1BSEA 3URPA 4HAAA 5GSPA 4BIRA 1BGSA 1DETA 1AQZA 1B27A 1BSCA 2F4YA 2F5WA 3HOHA 3WR2A 1RCLA 1BOXA 2C4BA 5RNTA 3WHOA 1B2MA 1I2FA 6GSPA 1B2XA 1BNFA 1RSNA 1FYSA 1C54A 1GOVA 3D5GA 1GOUA 1RN1A 2F5MA 1GMQA 2BU4A 4J5GA 1TRPA 1T2HA 3RNTA 1YGWA 1BNSA 2GSPA 1BRJA 7GSPA 1BNEA 1YNVX 3BU4A 1AY7A 1FW7A 5BU4A 1MGRA 1RHLA 2BIRA 4J5KA 1B21A 1RMSA 3KCHA 1BUJA 3AHWA 3GSPA 4BU4A 1RN4A 1GOYA 1BVIA 1HZ1A 1BNGA 1UCLA 1MGWA 1X1XA 2KAAA 2F56A 4GSPA 2AADA 1R4YA 1I0VA 1BSAA 1FUSA 1I2GA 1Q9EA 1BANA 1RLSA 7RNTA 1CH0A 1UCJA 1BRSA 3DH2A 1BNJA 1X1UA 4RNTA 1BRHA 1PYLA 1GSPA 1B3SA 1RGHA 3D5IA 2AAEA 2HOHA 1RNTA 1B2SA 1YVSA 6RNTA 1GMPA 1RGLA 2KF3A 2KF6A 1ZGXA 1LOWA 1BNIA 1X1WA 2RNTA 5HOHA 2ZA4A 1I70A 1BSDA 1B2ZA 1LNIA 1RGEA 1TRQA 1BIRA 1JBTA
chains in the Genus database with same CATH superfamily
1HU9A 2UGIA 4BTYA 1RGGA 3UB1A 1NB3I 3G4S3 2P09A 3BNBA 2XRXB 1UCKA 4N6UA 3OWUA 5KP4A 1DE3A 2OTJ3 4H3UA 4NPBA 1FUWA 1IQ8A 2HMKB 5IF6A 1BNRA 3CCR3 1EA2A 4HM1B 1B2UA 3NV0A 3U97A 1NJI4 1Q7HA 1NDOB 1G0TA 1N5PA 1BRIA 2YFJB 3FZWA 4EV5A 5I97A 2J8XB 3FH1A 1STDA 3AGOA 1RNBA 2BT3A 3SX1A 3CCU3 1RGFA 2FXTA 4IIAA 3S5CA 2M7OA 1K41A 1W01A 4GB5A 2W0QA 4EW5A 4XBTA 2MF7A 4HOHA 3EBYA 4R1KA 3EN1B 4L8PA 5G2GA 2FGTA 3FG3A 1I3FA 5IENA 4MEIA 4RZMA 4FR9A 2XGLA 3LTDA 2RFRA 4HAAA 3EBTA 3ECFA 5ELJA 1O7GB 1VQ83 3EJVA 3CPOA 3SLUA 3HOHA 2H0GA 3WR2A 2IMJA 1RCLA 4WHAA 1Q814 3CNXA 3WHOA 1B2MA 3NM7A 1I2FA 4OK0A 6GSPA 3UNLA 3FG1A 2UUGC 3WA2X 1PFPA 1A67A 1BNFA 4RBNA 3T0UA 1MWUA 1RJOA 4HM0B 4JF8A 1JJ22 1C54A 5FW5A 2XFTA 1G96A 1GS3A 2F5MA 1GMQA 1CQSA 2ML6A 2O9UX 1CEWI 1OF5A 1IU7A 1UUVB 1IT7A 5AIIA 3WDGB 2YFLB 2KCDA 3PS8A 5JPPA 1YI23 3HK4A 3EQQB 1W4NA 1M1XB 1YGWA 1OGXA 2IY2A 5D81A 7GSPA 1EUIC 3CNMA 1FW7A 3NUVA 2GBXB 3PZWA 1IV9A 5BU4A 2D42A 4FCJA 1WMNA 2K3DA 3OWYA 2BIRA 4K1VA 1B21A 3OWSA 1QAFA 1OUNA 3N8BA 3LMLA 2HMMB 1JKGB 3JUMA 4QWTA 1GOYA 1JZDA 3K9MC 1VZZA 1BVIA 2KAAA 4MMYB 1NB5I 1X1XA 2F56A 1D6ZA 2L1SA 1Y4KA 3VF1A 1OACA 1A2VA 3WOFB 4LSOA 3LH4A 5AEUB 4LZIA 5DREA 1IQYA 2OOVC 2CX1A 1EEJA 3H3HA 1UGIA 3BNDA 2F98A 3VSYA 2E2TA 1AVLA 4R9KA 1W2ZA 4OVMA 2ML5A 5IEOA 1E97A 1GSPA 3DGMA 5JPUA 3MG1A 1K9M4 1JRQA 3F9SA 4X2HA 3Q2PA 1AV4A 3MG3A 3MYTA 1IVWA 4HYZA 2QIYA 2FNQA 2F99A 3SXXA 1UUGB 1E3RA 2Z76A 5HOHA 1V57A 3I563 1Q7Y4 1TRQA 4IT7A 2F4YA 5AYSC 1N8QA 1TTOA 2SARA 3PXMA 4DKIA 1FA3A 4XBXA 1IVXA 1VQ53 1OGZA 2CKFB 1M1K4 1TP6A 4HJLB 1DVCA 1DMQA 3AHSA 4O8SA 1Q824 4LEHA 2W2CA 2CX0A 1RGAA 1IYYA 1Q40B 1W5ZA 1SARA 3LT8A 1I0XA 2KF4A 3DMCA 1BUQA 2W9PA 7STDA 1VQP3 1BRGA 1DYUA 1GY6A 4HM6B 4K61A 4N6V0 1I8VA 1T2IA 4K1UA 3SYUA 1K734 3UL5A 1QAKA 1MWRA 3OXAA 3X42A 4XDVA 5DRVA 3S29A 1UUWB 3FG4A 4HM2B 1QMAA 3A5EA 4XM4A 3G16A 3I553 1CYVA 1LOYA 1ULIB 1KD14 1ZS7A 2KF5A 2XH9A 2P38A 2E2VA 3Q3FA 5AIHA 5KP3A 5BXQA 1DMMA 4X2OA 5IG3A 1JBRA 5BIRA 1DMNA 1A2PA 2YFIB 3GRDA 4R9LA 3URPA 4LYLB 5D82A 5GSPA 1FGMA 3CCM3 2B24B 1R4CA 4HVNA 1B27A 2R41A 3IJEB 1OCVA 1JZOA 4N6TA 4NREA 1N8R4 1BOXA 5RNTA 3K5TA 3J7Yd 3CCQ3 8CHOA 3K0ZA 2QGUA 3T8NA 2CFWA 2CW9A 3GZRA 3PYJA 3CC73 1Q42A 1JNQA 1TFOA 1ZX2A 2RCDA 3DUKA 4O2HA 5CXOA 4RNZA 5JBSA 1GOUA 3DGNA 1RN1A 2IYJA 5IG4A 1O7PB 2BU4A 5CLKA 4LMIA 2Z77A 4J5GA 3L0RA 4BL3A 1GYBA 1TU5A 3CCS3 2OTL3 1T2HA 3H51A 1ULJB 3F7SA 3V99A 4HZBB 3X3XA 2W6JH 4BTXA 3IPTA 1BNSA 5CF2A 2XEPA 3F8XA 3B4PA 1YNVX 2KRTA 1N9JA 1WQLB 1W2B2 1VQ43 1GY7A 3N9HA 4CCVA 1QVG2 1M904 2B1XB 4KFFA 2HMLB 3K63A 3KSED 5FGOA 4ZM8A 4XBYA 3VGNA 5IG5A 2GXFA 3GSPA 4I4KA 3CCJ3 2OCTA 1RN4A 3JUPA 5CK6A 3TDGA 1WMOA 1UCLA 2BO9B 3G713 2H0IA 3EB8A 2W04A 3X3YA 3F8HA 1KQS2 1R4YA 4O02B 3V92A 1BSAA 4KFDA 3ALAA 1BANA 3NXJA 7RNTA 1CH0A 3B4OA 4STDA 1JKGA 1O7MB 1W6CA 3MPHA 3NQYA 1JB2A 3G6E3 1EQKA 3CC43 1FGOA 4RNTA 3EHCA 5LC7A 2IUKA 1IV7A 3CU3A 1OPYA 1WTHA 2LYXA 4WWUC 3ER7A 1V74A 2A15A 4HM3B 3JUOA 1YVSA 4KZ1A 6RNTA 3AMOA 1TFKA 1UGHI 4HKVB 1LOWA 3S28A 2RNTA 2C11A 2ZA4A 1I70A 3MSOA 4FMCA 1U8CB 3NM2A 1BSDA 2WGOA 2XF3A 3D9RA 3D3LA 3ROBA 3SEDA 1I2EA 1N5HA 1VQN3 3STDA 3KN4A 6STDA 5AI1A 1IVUA 2RBIA 4MMZB 1PU4A 5EEOA 1GMRA 1RDSA 1SPUA 1WNHA 2CH9A 2F86B 2PNCA 1LRAA 2P0XA 3AMOB 3BIRA 4HM7B 1MWTA 4PEJA 5AEWB 3ZFZA 3WA3A 2JQ5A 8RNTA 2L4VA 1MNLA 3DY5A 1EG9B 2H0HA 3OX9A 2Q07A 3HZPA 1ROAA 1UCIA 2IA7A 4MJDA 3AGNA 3LTCA 3Q90A 9RNTA 1RRHA 2ZDJA 3G0KA 4EXRA 1OHOA 2PZVA 1DVDA 1HYFA 1UDII 1Z1SA 4ILFA 3DGYA 1E3VA 1RGKA 2HMNB 3LTBA 1Q40A 3CXC2 4N6MA 4WFOA 3CCE3 1KSIA 5ELUA 1I3IA 1IK3A 1W7CA 1K8A4 1PY3A 1B20A 3B7CA 1OH0A 1BAOA 3BNCA 4O3VA 5AYRB 2CG1A 2W56B 2D1WA 1V58A 4WYKB 2HMOB 1QJGA 1UW1A 2CHCA 3FCSB 1M9GA 1RRLA 3RDEA 3CC23 2CFKA 1MOLA 4GL6A 2E2UA 4IPBA 1BGSA 1YGEA 1T3BA 3E99A 4HZ9B 1YIJ3 2CC3A 2Y74A 1BSCA 2F5WA 5G1LA 4ORLA 2OQEC 3D79A 3RGRA 1EKMA 1GD4A 3BNEA 1O7HB 3FF2A 1RSNA 5AIGA 3LZAA 5HGRA 1HKXA 3OW22 2BMQB 2HMJB 2Z6BA 1K28A 1TUHA 1GOVA 3HI7A 3FGYA 1IQXA 4N3VA 2CWVA 4LGQA 1TRPA 3F40A 1T5YA 3GWRA 1SJWA 5CF1A 2QEX3 1SIHA 3FLJA 1BRJA 3DZLA 1VQO3 4FMDA 1JN5B 2P0MA 1AY7A 3BU4A 2CK3H 3CME3 3EN8A 3CCV3 1MGRA 2K0MA 1QALA 2O3OA 1RHLA 4J5KA 5M1AA 1RMSA 3AHWA 1KC84 3UJMA 1NNVA 4BU4A 3CD63 3F14A 5IEPA 1HZ1A 1BNGA 1MGWA 4GSPA 5AIFA 4AKYA 2OWPA 4N6NB 1RKYA 3CMA3 2AADA 1L5GB 2XSHB 4K90B 3DM8A 5D83A 1I2GA 4G1MB 1MWSA 1AVKA 1RLSA 4H61A 1VQ63 2WOHA 4EV2A 3I0YA 1O7WB 1NO3A 1BRSA 1WMPA 4WP5A 2YX9A 1VQK3 1X1UA 1IDPA 2OOVA 4KT3B 5A0OB 1C7HA 1YJN3 1PYLA 1W6GA 3ZG0A 3QRDA 3S67A 3HX8A 1GD3A 1LNHA 2BMOB 2HOHA 3KIIA 1OHPA 5EVHA 2P05A 3X3ZA 1RNTA 2CWTA 3SOAA 3BLZA 2I9WA 1YVBI 1GMPA 2UX0A 3LT9A 2KF6A 2IUJA 3LYGA 1QVF2 2STDA 3SVAA 2BMRB 2XR8B 4TX4A 1RN7A 2XGNA 4XB5A 2Z7AA 1VQ73 3RGAA 1LNIA 1RGEA 3EF8A 3WODG 1JBTA 2MC8A 1G02A 3NV0B 1D6YA 1LOVA 1BU4A 3N54B 1FUTA 3HIIA 3MKIA 1JB4A 1US1A 2KXGA 5EQLA 4EYCA 2W03A 3M8CA 1X1YA 2GEXA 2CWUA 4GHOA 3UL6A 2Y73A 1LXEA 1SQWA 1JB5A 3MG2A 1RTUA 1NWWA 3NX0A 3V98A 1JBSA 1LOXA 1LQGC 2K54A 3U1WA 5KP1A 2RGQA 3D4AA 5IW9A 2SBLA 1TJDA 2OQEA 3BB9A 4RNYA 1YJW3 1OHSA 1D6UA 2JDIH 1RCKA 1BRNL 4EC6A 1TIJA 1F8NA 2ZHXB 1YIT3 1STFI 1N9EA 5G1KA 3S27A 1BSBA 1FGQA 4EBGA 3CPW2 1FZUA 3EE1A 3IMAB 1BRKA 3T8UA 1GY5A 2WGQA 3FSDA 1RGCA 3PCSA 4FMBA 3X41A 1BSEA 3GAXA 4AEQA 2CIUA 4FCZA 4R80A 2XSOB 4KVHA 4BIRA 1ROVA 1DETA 1O7NB 1AR0A 3LOYA 1AQZA 4L7KA 3X40A 1CYUA 2C4BA 2W56A 2XFSA 3FKAA 3JUNA 3KZTA 1OF5B 1JV2B 3JUQA 3O8YA 4FMAA 4WYKA 3SOYA 1ISKA 1B2XA 2GEYA 3EC9A 3GZXB 5BVBA 4L8OA 1S723 2GBWB 5M19A 3G8ZA 3F7XA 2GU1A 3WMDA 1FYSA 1LVNA 2CFDA 3Q1CA 2WO0A 5M18A 3D5GA 3KE7A 5LC6A 3NBRA 4U13A 3DXOA 5TGNA 4BL2A 1VQQA 3KKGA 1W6YA 1W02A 4XDWA 2LQVA 1FGTA 3RNTA 4NHFA 4I5QA 2CFGA 1UI8A 1NU3A 2GSPA 3B8LA 4HM8B 2QA43 1BNEA 1VQM3 3LXUX 3FF0A 4N6LA 4JRFA 2ZL8A 4J9AA 4OUQA 4Q53A 3WOEB 2BNGA 1A2KA 4N6OB 1W00A 3KCHA 2CG0A 4HM4B 3LTAA 3CCL3 1BUJA 4J8TA 2GU3A 3K7CA 2W9QA 2CFLA 1J2BA 5STDA 3NHXA 3NQZA 1JN5A 4CJNA 1IVVA 2V1LA 1SIIA 3DGLA 4FCMA 1ZO2A 1I0VA 1FUSA 3ZG5A 2R4IA 1Q9EA 1VQL3 3HIGA 1UCJA 3OV4A 3DGOA 4MMXB 1A90A 1U5OA 3DH2A 4CPKA 1BNJA 1YJ93 1FGRA 3KSPA 1ASKA 3PGBA 1Q864 3PCRA 4HM5B 1BRHA 5IG0A 5IERA 1YHQ3 1B3SA 1RGHA 2INXA 2AAEA 3D5IA 3MHEA 2BHMA 1KWIA 3EX9A 2C10A 4AKZA 3QK9A 3JVCA 3GZBA 3MWZA 3NBBA 4BTWA 1B2SA 1RGLA 2KF3A 3A76A 1VQ93 1ZGXA 3KFQC 4R4KA 1LQMB 1BNIA 1S5AA 1X1WA 4KFEA 2RSXA 1IT8A 1UI7A 1B2ZA 4HBRA 4CDLA 3NBJA 3GZYB 1BIRA 2WOFA
chains in the Genus database with same CATH topology
1TTOA 1G02A 1I2EA 2SARA 1RGGA 1LOVA 1BU4A 1UCKA 2RBIA 1FUTA 1DE3A 1GMRA 1RDSA 3BIRA 1LRAA 3AHSA 1X1YA 4GHOA 8RNTA 1BNRA 1RGAA 1IYYA 1RTUA 1SARA 1I0XA 1JBSA 1B2UA 2KF4A 1UCIA 3AGNA 3D4AA 9RNTA 1BRGA 1BRIA 1HYFA 1I8VA 1T2IA 3SYUA 1BRNL 1RCKA 3AGOA 3DGYA 1RNBA 1RGKA 1RGFA 3A5EA 1I3IA 1BSBA 1LOYA 1PY3A 1B20A 1FZUA 4HOHA 1BAOA 2KF5A 3Q3FA 1BRKA 1JBRA 1I3FA 1RGCA 5BIRA 1A2PA 1BSEA 3URPA 4HAAA 5GSPA 4BIRA 1BGSA 1DETA 1AQZA 1B27A 1BSCA 2F4YA 2F5WA 3HOHA 3WR2A 1RCLA 1BOXA 2C4BA 5RNTA 3WHOA 1B2MA 1I2FA 6GSPA 1B2XA 1BNFA 1RSNA 1FYSA 1C54A 1GOVA 3D5GA 1GOUA 1RN1A 2F5MA 1GMQA 2BU4A 4J5GA 1TRPA 1T2HA 3RNTA 1YGWA 1BNSA 2GSPA 1BRJA 7GSPA 1BNEA 1YNVX 3BU4A 1AY7A 1FW7A 5BU4A 1MGRA 1RHLA 2BIRA 4J5KA 1B21A 1RMSA 3KCHA 1BUJA 3AHWA 3GSPA 4BU4A 1RN4A 1GOYA 1BVIA 1HZ1A 1BNGA 1UCLA 1MGWA 1X1XA 2KAAA 2F56A 4GSPA 2AADA 1R4YA 1I0VA 1BSAA 1FUSA 1I2GA 1Q9EA 1BANA 1RLSA 7RNTA 1CH0A 1UCJA 1BRSA 3DH2A 1BNJA 1X1UA 4RNTA 1BRHA 1PYLA 1GSPA 1B3SA 1RGHA 3D5IA 2AAEA 2HOHA 1RNTA 1B2SA 1YVSA 6RNTA 1GMPA 1RGLA 2KF3A 2KF6A 1ZGXA 1LOWA 1BNIA 1X1WA 2RNTA 5HOHA 2ZA4A 1I70A 1BSDA 1B2ZA 1LNIA 1RGEA 1TRQA 1BIRA 1JBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTO A;  1G02 A;  1I2E A;  2SAR A;  1RGG A;  1LOV A;  1BU4 A;  1UCK A;  2RBI A;  1FUT A;  1DE3 A;  1GMR A;  1RDS A;  3BIR A;  1LRA A;  3AHS A;  1X1Y A;  4GHO A;  8RNT A;  1BNR A;  1RGA A;  1IYY A;  1RTU A;  1SAR A;  1I0X A;  1JBS A;  1B2U A;  2KF4 A;  1UCI A;  3AGN A;  3D4A A;  9RNT A;  1BRG A;  1BRI A;  1HYF A;  1I8V A;  1T2I A;  3SYU A;  1BRN L;  1RCK A;  3AGO A;  3DGY A;  1RNB A;  1RGK A;  1RGF A;  3A5E A;  1I3I A;  1BSB A;  1LOY A;  1PY3 A;  1B20 A;  1FZU A;  4HOH A;  1BAO A;  2KF5 A;  3Q3F A;  1BRK A;  1JBR A;  1I3F A;  1RGC A;  5BIR A;  1A2P A;  1BSE A;  3URP A;  4HAA A;  5GSP A;  4BIR A;  1BGS A;  1DET A;  1AQZ A;  1B27 A;  1BSC A;  2F4Y A;  2F5W A;  3HOH A;  3WR2 A;  1RCL A;  1BOX A;  2C4B A;  5RNT A;  3WHO A;  1B2M A;  1I2F A;  6GSP A;  1B2X A;  1BNF A;  1RSN A;  1FYS A;  1C54 A;  1GOV A;  3D5G A;  1GOU A;  1RN1 A;  2F5M A;  1GMQ A;  2BU4 A;  4J5G A;  1TRP A;  1T2H A;  3RNT A;  1YGW A;  1BNS A;  2GSP A;  1BRJ A;  7GSP A;  1BNE A;  1YNV X;  3BU4 A;  1AY7 A;  1FW7 A;  5BU4 A;  1MGR A;  1RHL A;  2BIR A;  4J5K A;  1B21 A;  1RMS A;  3KCH A;  1BUJ A;  3AHW A;  3GSP A;  4BU4 A;  1RN4 A;  1GOY A;  1BVI A;  1HZ1 A;  1BNG A;  1UCL A;  1MGW A;  1X1X A;  2KAA A;  2F56 A;  4GSP A;  2AAD A;  1R4Y A;  1I0V A;  1BSA A;  1FUS A;  1I2G A;  1Q9E A;  1BAN A;  1RLS A;  7RNT A;  1CH0 A;  1UCJ A;  1BRS A;  3DH2 A;  1BNJ A;  1X1U A;  4RNT A;  1BRH A;  1PYL A;  1GSP A;  1B3S A;  1RGH A;  3D5I A;  2AAE A;  2HOH A;  1RNT A;  1B2S A;  1YVS A;  6RNT A;  1GMP A;  1RGL A;  2KF3 A;  2KF6 A;  1ZGX A;  1LOW A;  1BNI A;  1X1W A;  2RNT A;  5HOH A;  2ZA4 A;  1I70 A;  1BSD A;  1B2Z A;  1LNI A;  1RGE A;  1TRQ A;  1BIR A;  1JBT A; 
#chains in the Genus database with same CATH topology
 1HU9 A;  2UGI A;  4BTY A;  1RGG A;  3UB1 A;  1NB3 I;  3G4S 3;  2P09 A;  3BNB A;  2XRX B;  1UCK A;  4N6U A;  3OWU A;  5KP4 A;  1DE3 A;  2OTJ 3;  4H3U A;  4NPB A;  1FUW A;  1IQ8 A;  2HMK B;  5IF6 A;  1BNR A;  3CCR 3;  1EA2 A;  4HM1 B;  1B2U A;  3NV0 A;  3U97 A;  1NJI 4;  1Q7H A;  1NDO B;  1G0T A;  1N5P A;  1BRI A;  2YFJ B;  3FZW A;  4EV5 A;  5I97 A;  2J8X B;  3FH1 A;  1STD A;  3AGO A;  1RNB A;  2BT3 A;  3SX1 A;  3CCU 3;  1RGF A;  2FXT A;  4IIA A;  3S5C A;  2M7O A;  1K41 A;  1W01 A;  4GB5 A;  2W0Q A;  4EW5 A;  4XBT A;  2MF7 A;  4HOH A;  3EBY A;  4R1K A;  3EN1 B;  4L8P A;  5G2G A;  2FGT A;  3FG3 A;  1I3F A;  5IEN A;  4MEI A;  4RZM A;  4FR9 A;  2XGL A;  3LTD A;  2RFR A;  4HAA A;  3EBT A;  3ECF A;  5ELJ A;  1O7G B;  1VQ8 3;  3EJV A;  3CPO A;  3SLU A;  3HOH A;  2H0G A;  3WR2 A;  2IMJ A;  1RCL A;  4WHA A;  1Q81 4;  3CNX A;  3WHO A;  1B2M A;  3NM7 A;  1I2F A;  4OK0 A;  6GSP A;  3UNL A;  3FG1 A;  2UUG C;  3WA2 X;  1PFP A;  1A67 A;  1BNF A;  4RBN A;  3T0U A;  1MWU A;  1RJO A;  4HM0 B;  4JF8 A;  1JJ2 2;  1C54 A;  5FW5 A;  2XFT A;  1G96 A;  1GS3 A;  2F5M A;  1GMQ A;  1CQS A;  2ML6 A;  2O9U X;  1CEW I;  1OF5 A;  1IU7 A;  1UUV B;  1IT7 A;  5AII A;  3WDG B;  2YFL B;  2KCD A;  3PS8 A;  5JPP A;  1YI2 3;  3HK4 A;  3EQQ B;  1W4N A;  1M1X B;  1YGW A;  1OGX A;  2IY2 A;  5D81 A;  7GSP A;  1EUI C;  3CNM A;  1FW7 A;  3NUV A;  2GBX B;  3PZW A;  1IV9 A;  5BU4 A;  2D42 A;  4FCJ A;  1WMN A;  2K3D A;  3OWY A;  2BIR A;  4K1V A;  1B21 A;  3OWS A;  1QAF A;  1OUN A;  3N8B A;  3LML A;  2HMM B;  1JKG B;  3JUM A;  4QWT A;  1GOY A;  1JZD A;  3K9M C;  1VZZ A;  1BVI A;  2KAA A;  4MMY B;  1NB5 I;  1X1X A;  2F56 A;  1D6Z A;  2L1S A;  1Y4K A;  3VF1 A;  1OAC A;  1A2V A;  3WOF B;  4LSO A;  3LH4 A;  5AEU B;  4LZI A;  5DRE A;  1IQY A;  2OOV C;  2CX1 A;  1EEJ A;  3H3H A;  1UGI A;  3BND A;  2F98 A;  3VSY A;  2E2T A;  1AVL A;  4R9K A;  1W2Z A;  4OVM A;  2ML5 A;  5IEO A;  1E97 A;  1GSP A;  3DGM A;  5JPU A;  3MG1 A;  1K9M 4;  1JRQ A;  3F9S A;  4X2H A;  3Q2P A;  1AV4 A;  3MG3 A;  3MYT A;  1IVW A;  4HYZ A;  2QIY A;  2FNQ A;  2F99 A;  3SXX A;  1UUG B;  1E3R A;  2Z76 A;  5HOH A;  1V57 A;  3I56 3;  1Q7Y 4;  1TRQ A;  4IT7 A;  2F4Y A;  5AYS C;  1N8Q A;  1TTO A;  2SAR A;  3PXM A;  4DKI A;  1FA3 A;  4XBX A;  1IVX A;  1VQ5 3;  1OGZ A;  2CKF B;  1M1K 4;  1TP6 A;  4HJL B;  1DVC A;  1DMQ A;  3AHS A;  4O8S A;  1Q82 4;  4LEH A;  2W2C A;  2CX0 A;  1RGA A;  1IYY A;  1Q40 B;  1W5Z A;  1SAR A;  3LT8 A;  1I0X A;  2KF4 A;  3DMC A;  1BUQ A;  2W9P A;  7STD A;  1VQP 3;  1BRG A;  1DYU A;  1GY6 A;  4HM6 B;  4K61 A;  4N6V 0;  1I8V A;  1T2I A;  4K1U A;  3SYU A;  1K73 4;  3UL5 A;  1QAK A;  1MWR A;  3OXA A;  3X42 A;  4XDV A;  5DRV A;  3S29 A;  1UUW B;  3FG4 A;  4HM2 B;  1QMA A;  3A5E A;  4XM4 A;  3G16 A;  3I55 3;  1CYV A;  1LOY A;  1ULI B;  1KD1 4;  1ZS7 A;  2KF5 A;  2XH9 A;  2P38 A;  2E2V A;  3Q3F A;  5AIH A;  5KP3 A;  5BXQ A;  1DMM A;  4X2O A;  5IG3 A;  1JBR A;  5BIR A;  1DMN A;  1A2P A;  2YFI B;  3GRD A;  4R9L A;  3URP A;  4LYL B;  5D82 A;  5GSP A;  1FGM A;  3CCM 3;  2B24 B;  1R4C A;  4HVN A;  1B27 A;  2R41 A;  3IJE B;  1OCV A;  1JZO A;  4N6T A;  4NRE A;  1N8R 4;  1BOX A;  5RNT A;  3K5T A;  3J7Y d;  3CCQ 3;  8CHO A;  3K0Z A;  2QGU A;  3T8N A;  2CFW A;  2CW9 A;  3GZR A;  3PYJ A;  3CC7 3;  1Q42 A;  1JNQ A;  1TFO A;  1ZX2 A;  2RCD A;  3DUK A;  4O2H A;  5CXO A;  4RNZ A;  5JBS A;  1GOU A;  3DGN A;  1RN1 A;  2IYJ A;  5IG4 A;  1O7P B;  2BU4 A;  5CLK A;  4LMI A;  2Z77 A;  4J5G A;  3L0R A;  4BL3 A;  1GYB A;  1TU5 A;  3CCS 3;  2OTL 3;  1T2H A;  3H51 A;  1ULJ B;  3F7S A;  3V99 A;  4HZB B;  3X3X A;  2W6J H;  4BTX A;  3IPT A;  1BNS A;  5CF2 A;  2XEP A;  3F8X A;  3B4P A;  1YNV X;  2KRT A;  1N9J A;  1WQL B;  1W2B 2;  1VQ4 3;  1GY7 A;  3N9H A;  4CCV A;  1QVG 2;  1M90 4;  2B1X B;  4KFF A;  2HML B;  3K63 A;  3KSE D;  5FGO A;  4ZM8 A;  4XBY A;  3VGN A;  5IG5 A;  2GXF A;  3GSP A;  4I4K A;  3CCJ 3;  2OCT A;  1RN4 A;  3JUP A;  5CK6 A;  3TDG A;  1WMO A;  1UCL A;  2BO9 B;  3G71 3;  2H0I A;  3EB8 A;  2W04 A;  3X3Y A;  3F8H A;  1KQS 2;  1R4Y A;  4O02 B;  3V92 A;  1BSA A;  4KFD A;  3ALA A;  1BAN A;  3NXJ A;  7RNT A;  1CH0 A;  3B4O A;  4STD A;  1JKG A;  1O7M B;  1W6C A;  3MPH A;  3NQY A;  1JB2 A;  3G6E 3;  1EQK A;  3CC4 3;  1FGO A;  4RNT A;  3EHC A;  5LC7 A;  2IUK A;  1IV7 A;  3CU3 A;  1OPY A;  1WTH A;  2LYX A;  4WWU C;  3ER7 A;  1V74 A;  2A15 A;  4HM3 B;  3JUO A;  1YVS A;  4KZ1 A;  6RNT A;  3AMO A;  1TFK A;  1UGH I;  4HKV B;  1LOW A;  3S28 A;  2RNT A;  2C11 A;  2ZA4 A;  1I70 A;  3MSO A;  4FMC A;  1U8C B;  3NM2 A;  1BSD A;  2WGO A;  2XF3 A;  3D9R A;  3D3L A;  3ROB A;  3SED A;  1I2E A;  1N5H A;  1VQN 3;  3STD A;  3KN4 A;  6STD A;  5AI1 A;  1IVU A;  2RBI A;  4MMZ B;  1PU4 A;  5EEO A;  1GMR A;  1RDS A;  1SPU A;  1WNH A;  2CH9 A;  2F86 B;  2PNC A;  1LRA A;  2P0X A;  3AMO B;  3BIR A;  4HM7 B;  1MWT A;  4PEJ A;  5AEW B;  3ZFZ A;  3WA3 A;  2JQ5 A;  8RNT A;  2L4V A;  1MNL A;  3DY5 A;  1EG9 B;  2H0H A;  3OX9 A;  2Q07 A;  3HZP A;  1ROA A;  1UCI A;  2IA7 A;  4MJD A;  3AGN A;  3LTC A;  3Q90 A;  9RNT A;  1RRH A;  2ZDJ A;  3G0K A;  4EXR A;  1OHO A;  2PZV A;  1DVD A;  1HYF A;  1UDI I;  1Z1S A;  4ILF A;  3DGY A;  1E3V A;  1RGK A;  2HMN B;  3LTB A;  1Q40 A;  3CXC 2;  4N6M A;  4WFO A;  3CCE 3;  1KSI A;  5ELU A;  1I3I A;  1IK3 A;  1W7C A;  1K8A 4;  1PY3 A;  1B20 A;  3B7C A;  1OH0 A;  1BAO A;  3BNC A;  4O3V A;  5AYR B;  2CG1 A;  2W56 B;  2D1W A;  1V58 A;  4WYK B;  2HMO B;  1QJG A;  1UW1 A;  2CHC A;  3FCS B;  1M9G A;  1RRL A;  3RDE A;  3CC2 3;  2CFK A;  1MOL A;  4GL6 A;  2E2U A;  4IPB A;  1BGS A;  1YGE A;  1T3B A;  3E99 A;  4HZ9 B;  1YIJ 3;  2CC3 A;  2Y74 A;  1BSC A;  2F5W A;  5G1L A;  4ORL A;  2OQE C;  3D79 A;  3RGR A;  1EKM A;  1GD4 A;  3BNE A;  1O7H B;  3FF2 A;  1RSN A;  5AIG A;  3LZA A;  5HGR A;  1HKX A;  3OW2 2;  2BMQ B;  2HMJ B;  2Z6B A;  1K28 A;  1TUH A;  1GOV A;  3HI7 A;  3FGY A;  1IQX A;  4N3V A;  2CWV A;  4LGQ A;  1TRP A;  3F40 A;  1T5Y A;  3GWR A;  1SJW A;  5CF1 A;  2QEX 3;  1SIH A;  3FLJ A;  1BRJ A;  3DZL A;  1VQO 3;  4FMD A;  1JN5 B;  2P0M A;  1AY7 A;  3BU4 A;  2CK3 H;  3CME 3;  3EN8 A;  3CCV 3;  1MGR A;  2K0M A;  1QAL A;  2O3O A;  1RHL A;  4J5K A;  5M1A A;  1RMS A;  3AHW A;  1KC8 4;  3UJM A;  1NNV A;  4BU4 A;  3CD6 3;  3F14 A;  5IEP A;  1HZ1 A;  1BNG A;  1MGW A;  4GSP A;  5AIF A;  4AKY A;  2OWP A;  4N6N B;  1RKY A;  3CMA 3;  2AAD A;  1L5G B;  2XSH B;  4K90 B;  3DM8 A;  5D83 A;  1I2G A;  4G1M B;  1MWS A;  1AVK A;  1RLS A;  4H61 A;  1VQ6 3;  2WOH A;  4EV2 A;  3I0Y A;  1O7W B;  1NO3 A;  1BRS A;  1WMP A;  4WP5 A;  2YX9 A;  1VQK 3;  1X1U A;  1IDP A;  2OOV A;  4KT3 B;  5A0O B;  1C7H A;  1YJN 3;  1PYL A;  1W6G A;  3ZG0 A;  3QRD A;  3S67 A;  3HX8 A;  1GD3 A;  1LNH A;  2BMO B;  2HOH A;  3KII A;  1OHP A;  5EVH A;  2P05 A;  3X3Z A;  1RNT A;  2CWT A;  3SOA A;  3BLZ A;  2I9W A;  1YVB I;  1GMP A;  2UX0 A;  3LT9 A;  2KF6 A;  2IUJ A;  3LYG A;  1QVF 2;  2STD A;  3SVA A;  2BMR B;  2XR8 B;  4TX4 A;  1RN7 A;  2XGN A;  4XB5 A;  2Z7A A;  1VQ7 3;  3RGA A;  1LNI A;  1RGE A;  3EF8 A;  3WOD G;  1JBT A;  2MC8 A;  1G02 A;  3NV0 B;  1D6Y A;  1LOV A;  1BU4 A;  3N54 B;  1FUT A;  3HII A;  3MKI A;  1JB4 A;  1US1 A;  2KXG A;  5EQL A;  4EYC A;  2W03 A;  3M8C A;  1X1Y A;  2GEX A;  2CWU A;  4GHO A;  3UL6 A;  2Y73 A;  1LXE A;  1SQW A;  1JB5 A;  3MG2 A;  1RTU A;  1NWW A;  3NX0 A;  3V98 A;  1JBS A;  1LOX A;  1LQG C;  2K54 A;  3U1W A;  5KP1 A;  2RGQ A;  3D4A A;  5IW9 A;  2SBL A;  1TJD A;  2OQE A;  3BB9 A;  4RNY A;  1YJW 3;  1OHS A;  1D6U A;  2JDI H;  1RCK A;  1BRN L;  4EC6 A;  1TIJ A;  1F8N A;  2ZHX B;  1YIT 3;  1STF I;  1N9E A;  5G1K A;  3S27 A;  1BSB A;  1FGQ A;  4EBG A;  3CPW 2;  1FZU A;  3EE1 A;  3IMA B;  1BRK A;  3T8U A;  1GY5 A;  2WGQ A;  3FSD A;  1RGC A;  3PCS A;  4FMB A;  3X41 A;  1BSE A;  3GAX A;  4AEQ A;  2CIU A;  4FCZ A;  4R80 A;  2XSO B;  4KVH A;  4BIR A;  1ROV A;  1DET A;  1O7N B;  1AR0 A;  3LOY A;  1AQZ A;  4L7K A;  3X40 A;  1CYU A;  2C4B A;  2W56 A;  2XFS A;  3FKA A;  3JUN A;  3KZT A;  1OF5 B;  1JV2 B;  3JUQ A;  3O8Y A;  4FMA A;  4WYK A;  3SOY A;  1ISK A;  1B2X A;  2GEY A;  3EC9 A;  3GZX B;  5BVB A;  4L8O A;  1S72 3;  2GBW B;  5M19 A;  3G8Z A;  3F7X A;  2GU1 A;  3WMD A;  1FYS A;  1LVN A;  2CFD A;  3Q1C A;  2WO0 A;  5M18 A;  3D5G A;  3KE7 A;  5LC6 A;  3NBR A;  4U13 A;  3DXO A;  5TGN A;  4BL2 A;  1VQQ A;  3KKG A;  1W6Y A;  1W02 A;  4XDW A;  2LQV A;  1FGT A;  3RNT A;  4NHF A;  4I5Q A;  2CFG A;  1UI8 A;  1NU3 A;  2GSP A;  3B8L A;  4HM8 B;  2QA4 3;  1BNE A;  1VQM 3;  3LXU X;  3FF0 A;  4N6L A;  4JRF A;  2ZL8 A;  4J9A A;  4OUQ A;  4Q53 A;  3WOE B;  2BNG A;  1A2K A;  4N6O B;  1W00 A;  3KCH A;  2CG0 A;  4HM4 B;  3LTA A;  3CCL 3;  1BUJ A;  4J8T A;  2GU3 A;  3K7C A;  2W9Q A;  2CFL A;  1J2B A;  5STD A;  3NHX A;  3NQZ A;  1JN5 A;  4CJN A;  1IVV A;  2V1L A;  1SII A;  3DGL A;  4FCM A;  1ZO2 A;  1I0V A;  1FUS A;  3ZG5 A;  2R4I A;  1Q9E A;  1VQL 3;  3HIG A;  1UCJ A;  3OV4 A;  3DGO A;  4MMX B;  1A90 A;  1U5O A;  3DH2 A;  4CPK A;  1BNJ A;  1YJ9 3;  1FGR A;  3KSP A;  1ASK A;  3PGB A;  1Q86 4;  3PCR A;  4HM5 B;  1BRH A;  5IG0 A;  5IER A;  1YHQ 3;  1B3S A;  1RGH A;  2INX A;  2AAE A;  3D5I A;  3MHE A;  2BHM A;  1KWI A;  3EX9 A;  2C10 A;  4AKZ A;  3QK9 A;  3JVC A;  3GZB A;  3MWZ A;  3NBB A;  4BTW A;  1B2S A;  1RGL A;  2KF3 A;  3A76 A;  1VQ9 3;  1ZGX A;  3KFQ C;  4R4K A;  1LQM B;  1BNI A;  1S5A A;  1X1W A;  4KFE A;  2RSX A;  1IT8 A;  1UI7 A;  1B2Z A;  4HBR A;  4CDL A;  3NBJ A;  3GZY B;  1BIR A;  2WOF A; 
#chains in the Genus database with same CATH homology
 1TTO A;  1G02 A;  1I2E A;  2SAR A;  1RGG A;  1LOV A;  1BU4 A;  1UCK A;  2RBI A;  1FUT A;  1DE3 A;  1GMR A;  1RDS A;  3BIR A;  1LRA A;  3AHS A;  1X1Y A;  4GHO A;  8RNT A;  1BNR A;  1RGA A;  1IYY A;  1RTU A;  1SAR A;  1I0X A;  1JBS A;  1B2U A;  2KF4 A;  1UCI A;  3AGN A;  3D4A A;  9RNT A;  1BRG A;  1BRI A;  1HYF A;  1I8V A;  1T2I A;  3SYU A;  1BRN L;  1RCK A;  3AGO A;  3DGY A;  1RNB A;  1RGK A;  1RGF A;  3A5E A;  1I3I A;  1BSB A;  1LOY A;  1PY3 A;  1B20 A;  1FZU A;  4HOH A;  1BAO A;  2KF5 A;  3Q3F A;  1BRK A;  1JBR A;  1I3F A;  1RGC A;  5BIR A;  1A2P A;  1BSE A;  3URP A;  4HAA A;  5GSP A;  4BIR A;  1BGS A;  1DET A;  1AQZ A;  1B27 A;  1BSC A;  2F4Y A;  2F5W A;  3HOH A;  3WR2 A;  1RCL A;  1BOX A;  2C4B A;  5RNT A;  3WHO A;  1B2M A;  1I2F A;  6GSP A;  1B2X A;  1BNF A;  1RSN A;  1FYS A;  1C54 A;  1GOV A;  3D5G A;  1GOU A;  1RN1 A;  2F5M A;  1GMQ A;  2BU4 A;  4J5G A;  1TRP A;  1T2H A;  3RNT A;  1YGW A;  1BNS A;  2GSP A;  1BRJ A;  7GSP A;  1BNE A;  1YNV X;  3BU4 A;  1AY7 A;  1FW7 A;  5BU4 A;  1MGR A;  1RHL A;  2BIR A;  4J5K A;  1B21 A;  1RMS A;  3KCH A;  1BUJ A;  3AHW A;  3GSP A;  4BU4 A;  1RN4 A;  1GOY A;  1BVI A;  1HZ1 A;  1BNG A;  1UCL A;  1MGW A;  1X1X A;  2KAA A;  2F56 A;  4GSP A;  2AAD A;  1R4Y A;  1I0V A;  1BSA A;  1FUS A;  1I2G A;  1Q9E A;  1BAN A;  1RLS A;  7RNT A;  1CH0 A;  1UCJ A;  1BRS A;  3DH2 A;  1BNJ A;  1X1U A;  4RNT A;  1BRH A;  1PYL A;  1GSP A;  1B3S A;  1RGH A;  3D5I A;  2AAE A;  2HOH A;  1RNT A;  1B2S A;  1YVS A;  6RNT A;  1GMP A;  1RGL A;  2KF3 A;  2KF6 A;  1ZGX A;  1LOW A;  1BNI A;  1X1W A;  2RNT A;  5HOH A;  2ZA4 A;  1I70 A;  1BSD A;  1B2Z A;  1LNI A;  1RGE A;  1TRQ A;  1BIR A;  1JBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...