1FZUA

Rnase t1 v78a mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRAVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1fzuA00
1BRHA 1A2PA 1RGAA 1AY7A 1RGGA 4GSPA 2AAEA 3SYUA 2KF4A 1UCLA 2KAAA 1GSPA 5HOHA 4J5GA 1GOYA 1BUJA 2RNTA 3Q3FA 3RNTA 1RGKA 1BNGA 1I70A 1ZGXA 4BU4A 1DE3A 1BIRA 3AHWA 3HOHA 1TRQA 1BNEA 1GMQA 1LOVA 2BIRA 6GSPA 1RCLA 1GMRA 1GOUA 3AHSA 1YGWA 4HOHA 1FZUA 5GSPA 1IYYA 3A5EA 2AADA 1B3SA 1BRKA 3AGOA 1RCKA 1B2SA 1RLSA 1FYSA 2BU4A 1TTOA 4GHOA 2F56A 1TRPA 3GSPA 1RGLA 1RNTA 1I2FA 1RGHA 2C4BA 1I2GA 3BIRA 1BRJA 1JBRA 9RNTA 1BRGA 1YVSA 1I3IA 1UCIA 1B27A 2HOHA 1B2UA 3D4AA 3D5IA 1PYLA 1Q9EA 1T2IA 1RGFA 1B2XA 1UCJA 1YNVX 1RGCA 2F5MA 6RNTA 4BIRA 1RHLA 1BRNL 1RTUA 1AQZA 1R4YA 1BSEA 1BSCA 2F5WA 1BNRA 1I2EA 1I0VA 1JBTA 1C54A 1GMPA 5BIRA 1BAOA 1BSDA 7GSPA 1I8VA 2KF5A 1BNFA 1B20A 1UCKA 2KF6A 1BSBA 2RBIA 1I0XA 3WR2A 1MGRA 1BANA 5RNTA 1X1UA 1RSNA 1RGEA 2GSPA 1PY3A 1BNSA 2KF3A 5BU4A 1X1YA 7RNTA 1CH0A 1FUTA 1BNIA 1BGSA 3D5GA 1RMSA 1X1XA 3KCHA 3URPA 1DETA 1B21A 3DH2A 3BU4A 1BRIA 1RNBA 1GOVA 1MGWA 1BSAA 1LOYA 1JBSA 1B2MA 1BVIA 1FUSA 2SARA 4J5KA 2ZA4A 8RNTA 1RN1A 1LRAA 1I3FA 1RN4A 1BOXA 2F4YA 1HZ1A 3AGNA 1BNJA 1G02A 3DGYA 1LOWA 1B2ZA 1BRSA 1BU4A 1SARA 1HYFA 4HAAA 3WHOA 1X1WA 1RDSA 4RNTA 1T2HA 1LNIA 1FW7A
chains in the Genus database with same CATH superfamily
5I97A 4H61A 1RGGA 4GSPA 1NB5I 3NV0A 1Q40A 2KF4A 2KAAA 1QMAA 3BNDA 1OF5B 3CCR3 1VQQA 2CH9A 1DMQA 4STDA 3Q3FA 4EXRA 3CCE3 3CMA3 2C11A 1JB2A 1RGKA 1BNGA 1US1A 3G8ZA 1IVUA 3EN1B 1DE3A 3AHWA 3K0ZA 1RRLA 4AKZA 4KVHA 1RKYA 2XGNA 2W9PA 1U5OA 1F8NA 1OHPA 1LOVA 3DGNA 6GSPA 1D6ZA 3CCM3 4OVMA 3UNLA 3H3HA 2FGTA 4U13A 1KQS2 1FGTA 2B1XB 2HMKB 1A2KA 3A5EA 2AADA 3CNMA 1IU7A 2IYJA 2IMJA 3CXC2 1FGMA 1Q814 1ZO2A 3N9HA 2WOFA 4WWUC 4N6LA 3BNEA 3OW22 1AVLA 2KCDA 1HKXA 1SIHA 3FH1A 2CHCA 3ER7A 4X2HA 2C4BA 2KXGA 3JUQA 5CLKA 1K8A4 3ALAA 3SEDA 1BRJA 4ILFA 1S5AA 1JBRA 2YFJB 3LTBA 1IVVA 1OHOA 1ROVA 3FG4A 2I9WA 2Z76A 1IQ8A 2OTJ3 1WQLB 3S28A 1B27A 2Y73A 5AIFA 3ZG0A 3CPOA 1IT7A 2CWTA 3DGMA 3D5IA 5AIGA 3V98A 1Q9EA 4RBNA 3ZG5A 3GRDA 1UCJA 1YNVX 2CFGA 3GWRA 3HK4A 1RGCA 4AEQA 4I4KA 5IG3A 2BMOB 3FSDA 4G1MB 1R4YA 1W6CA 3HI7A 1FGQA 3V99A 1BSEA 1K9M4 3LOYA 2K3DA 1BNRA 1NO3A 1OH0A 3T8UA 1KC84 2KF6A 1GY6A 3G16A 3ECFA 3WA2X 1L5GB 3GAXA 2OTL3 3HIIA 5G1LA 3G4S3 1RGEA 2GSPA 2P09A 1EA2A 2CFWA 4WYKB 3EX9A 2KF3A 1STDA 5BU4A 2ML5A 3RGAA 7RNTA 3CPW2 2RFRA 2CIUA 5CF2A 2HMLB 4HBRA 2UX0A 2Z7AA 1YJ93 3EN8A 2F99A 1RMSA 2HMOB 2XGLA 3KSED 4EW5A 1LQGC 1EKMA 1R4CA 3FGYA 4HM6B 3G713 2BNGA 3H51A 3WOEB 3CC43 1BRIA 1RNBA 1GOVA 4HM8B 3VSYA 1LOYA 1OUNA 3DGOA 1YHQ3 4K1UA 4O8SA 3GZXB 4FMBA 1JJ22 2K0MA 2XFTA 4HM5B 1Q7Y4 5G2GA 1MWRA 2BMRB 2P0XA 1D6UA 3NHXA 1K28A 2F4YA 1VQ93 1Q42A 2BHMA 1A2VA 1HZ1A 2XSOB 4WHAA 3DGYA 4HKVB 3X40A 2LYXA 3NBJA 1Z1SA 2IUJA 1HYFA 3EC9A 2CFDA 4HAAA 2GU1A 3JUPA 1UCKA 1RDSA 1T2HA 1TP6A 1LNIA 2OCTA 1JKGA 3D9RA 4R4KA 4RNTA 2XSHB 1FW7A 1AY7A 2AAEA 3RGRA 3UL5A 5TGNA 3NBBA 1UCLA 2GEXA 5DREA 4N6V0 4HZBB 1BUJA 2RNTA 3WMDA 1IV9A 1VQ83 1O7WB 4LGQA 4GL6A 1WMNA 1BNEA 1GMQA 3CU3A 1TFKA 4BTYA 3FG3A 3N54B 1M904 1T5YA 1RCLA 3VF1A 4BTXA 1GOUA 2CX0A 5FGOA 1VZZA 3I553 2XR8B 4FCMA 4WFOA 2BO9B 2IUKA 3F9SA 3OWYA 1YJN3 4KT3B 1BRKA 1CYVA 2INXA 1E3RA 1B2SA 2BU4A 4GHOA 1GY7A 1ZS7A 2ML6A 1MOLA 1TRPA 3FF2A 1RNTA 3K9MC 1RGHA 1YIT3 3UJMA 1I2GA 3KIIA 1MWTA 3QK9A 2WO0A 3LT9A 1IDPA 3AMOA 2MF7A 3DM8A 4XBYA 1U8CB 3FZWA 2W56A 1YVSA 3QRDA 4O2HA 4OUQA 9RNTA 1N5PA 4O3VA 2H0GA 1VQ53 4MMZB 2HOHA 1JN5A 3MG1A 4KFDA 2W03A 5AYSC 2P0MA 1PYLA 1T2IA 3X3XA 1JB5A 4HM1B 3G6E3 5EVHA 2F86B 3LTDA 1NJI4 2GU3A 3IJEB 4HM7B 4BIRA 2K54A 3CCL3 4KFEA 2WGQA 3PXMA 2YX9A 1YJW3 5IEPA 5JPUA 2E2VA 3PGBA 3D3LA 1LXEA 1JBTA 4L8OA 1DVCA 3S5CA 1Q7HA 2RGQA 5AI1A 1VQL3 3NM2A 1T3BA 3NM7A 3O8YA 3KN4A 3NV0B 1Q40B 3MPHA 1MGRA 2B24B 2RSXA 4ZM8A 5RNTA 1X1UA 1RSNA 3KE7A 4RNZA 3CCS3 4HM0B 1PY3A 3MG2A 2UGIA 4RNYA 4N6NB 7STDA 3BLZA 5AIIA 1C7HA 2FXTA 2OOVC 1IQXA 1YVBI 1UW1A 1UI7A 1ZX2A 2R4IA 2WOHA 3EJVA 1VQM3 4N6MA 3RDEA 5IENA 1W6GA 2PNCA 3LXUX 1BGSA 3PCRA 3CNXA 4K1VA 4LSOA 1QAKA 4MMXB 3D5GA 1CYUA 1X1XA 1ASKA 3FKAA 4XDVA 3KCHA 4HM3B 4CDLA 1QVG2 3NBRA 1SQWA 2CKFB 3Q1CA 2UUGC 1TU5A 5IERA 1MGWA 2CC3A 3SLUA 1V58A 3PS8A 3OXAA 1JBSA 3B4OA 4K90B 3MKIA 2RCDA 2HMJB 2W0QA 4TX4A 2L4VA 5KP4A 4J5KA 3NQZA 4HJLB 2WGOA 1VQN3 3V92A 1VQP3 4LEHA 8RNTA 5IF6A 1W2B2 1AR0A 1RN4A 1I3FA 1LRAA 1BOXA 1DMMA 1UDII 2JQ5A 2O3OA 3AGNA 2GBXB 4CJNA 1VQO3 1B2ZA 1K734 3FF0A 2E2TA 3S29A 1X1WA 3B7CA 4CCVA 2HMMB 2IY2A 5AIHA 1K41A 2CWVA 1RGAA 4N6OB 1D6YA 3SYUA 1EEJA 3LTCA 1IVWA 1PFPA 5HGRA 1SJWA 2W2CA 1SPUA 3JUOA 1N9JA 1UGIA 5EQLA 4J5GA 1GOYA 1NNVA 1VQ73 4HZ9B 4EBGA 1I70A 1ZGXA 4IT7A 3NX0A 1BIRA 3HOHA 4OK0A 4R80A 1TRQA 3WDGB 5CK6A 1DMNA 3BB9A 1IQYA 3X42A 1JNQA 1W5ZA 5IG0A 1GS3A 4PEJA 1YGWA 1YGEA 3K63A 2L1SA 1W2ZA 2ZDJA 3DUKA 1IYYA 3OX9A 3NUVA 3TDGA 3F8HA 3STDA 5JBSA 1Q864 3OWSA 5EEOA 1TTOA 4K61A 4ORLA 2F56A 3Q90A 1EUIC 2GXFA 1W02A 1I2FA 1Y4KA 4JRFA 1IV7A 2XFSA 1AV4A 3B4PA 2CG1A 3U1WA 1WMPA 3DGLA 3G0KA 1BRGA 3OWUA 1OGXA 2CW9A 1G0TA 8CHOA 5ELUA 5JPPA 3F40A 2CFLA 2E2UA 3UL6A 3MYTA 2ZHXB 3N8BA 1GD3A 1WNHA 2O9UX 1N9EA 2H0HA 4N6UA 5G1KA 3GZRA 4R9LA 1QAFA 2CG0A 4XB5A 3CCU3 1RGFA 1OGZA 1B2XA 1WTHA 3WODG 3ROBA 2YFIB 2OQEA 1LQMB 1RHLA 3NQYA 5AYRB 1BUQA 1RTUA 5DRVA 4FMAA 3CCQ3 3EB8A 1IVXA 1G96A 2F98A 3S67A 4L7KA 2Y74A 1UUVB 3PZWA 1I0VA 3KKGA 5IEOA 1GD4A 1ULIB 2P05A 1BSDA 3IPTA 1JKGB 2RBIA 1BNFA 1B20A 1TJDA 1BSBA 3MSOA 1I0XA 4Q53A 2IA7A 3EBTA 2QIYA 1BANA 3UB1A 5BVBA 4HYZA 1Q824 4H3UA 1UUGB 4BTWA 3DMCA 5M1AA 2CFKA 4MEIA 1O7MB 4LZIA 3HZPA 1QJGA 1W6YA 2XF3A 2J8XB 1FUTA 1FA3A 1M9GA 2XH9A 2C10A 2CX1A 1RRHA 4EYCA 4LMIA 1NWWA 3JUMA 4IIAA 2MC8A 3KFQC 4L8PA 3URPA 2XRXB 1O7GB 1MNLA 4LYLB 1B21A 3BNCA 1LOXA 3DH2A 3CME3 1KWIA 4EC6A 1YI23 2CK3H 5M18A 1B2MA 4X2OA 1BVIA 1SIIA 3F7SA 2QA43 3IMAB 1O7HB 1VQ43 1OHSA 5CF1A 1CQSA 1FGRA 1N8QA 1DVDA 1RN1A 3OV4A 4MJDA 1G02A 1LOWA 1JZDA 3AMOB 1ISKA 1BRSA 1LVNA 1IT8A 2W56B 1SARA 3WHOA 4BL3A 1J2BA 4WP5A 1JV2B 2LQVA 3LYGA 1JN5B 1BRHA 1RJOA 3DY5A 3KSPA 4HVNA 1A2PA 5IG4A 1YIJ3 3T8NA 1O7NB 3CC73 1GSPA 2PZVA 4KZ1A 5HOHA 3U97A 3VGNA 3CC23 3RNTA 1NDOB 4WYKA 2R41A 4BU4A 3HX8A 1PU4A 1OPYA 1TIJA 6STDA 4XDWA 4N6TA 1JRQA 2BIRA 1S723 1GMRA 4I5QA 3AHSA 2CWUA 4HOHA 1FZUA 1KSIA 5M19A 2OOVA 5GSPA 2P38A 5KP1A 1W4NA 1B3SA 3AGOA 3KZTA 3BNBA 4QWTA 1RCKA 1IK3A 3MHEA 3S27A 1RLSA 1FYSA 1UUWB 3EBYA 3SOYA 3DXOA 1V74A 2W6JH 5STDA 3GSPA 1RGLA 2STDA 3E99A 2KRTA 5CXOA 1A90A 5LC6A 3BIRA 3EE1A 4NHFA 3K5TA 1FGOA 5IG5A 1A67A 3B8LA 4FR9A 1W01A 2JDIH 1TFOA 1FUWA 2XEPA 3M8CA 4GB5A 2W04A 4IPBA 4R9KA 1HU9A 4FCJA 1I3IA 2Q07A 1DYUA 2GEYA 1N5HA 1UCIA 2Z6BA 2SBLA 4FMDA 2M7OA 1B2UA 3NXJA 5FW5A 3D4AA 3LTAA 3Q2PA 2GBWB 3DZLA 1W7CA 2HMNB 3PYJA 1LNHA 3GZBA 3JVCA 1QVF2 4XBTA 1W00A 2F5MA 5D83A 6RNTA 1N8R4 1BRNL 1AQZA 4O02B 1GYBA 3F8XA 3I563 3EHCA 4J8TA 1E3VA 3PCSA 1BSCA 2F5WA 1I2EA 1C54A 1GMPA 2QGUA 3GZYB 5BIRA 4BL2A 1VQK3 4KFFA 1BAOA 3WOFB 3X3YA 1I8VA 7GSPA 1ROAA 1UI8A 2KF5A 1E97A 3HIGA 3T0UA 5D82A 1MWUA 3WR2A 5AEUB 1RN7A 1V57A 3MG3A 1ULJB 4NPBA 5KP3A 3FCSB 3L0RA 2V1LA 3CCV3 2OWPA 4AKYA 4FMCA 3CD63 4XBXA 5BXQA 3A76A 2YFLB 5D81A 1BNSA 2H0IA 1X1YA 1KD14 3SOAA 2OQEC 3EQQB 4FCZA 1CEWI 2Z77A 2BMQB 1NB3I 2BT3A 1CH0A 3FG1A 3D79A 1BNIA 3JUNA 3EF8A 1EG9B 4CPKA 5AEWB 3CCJ3 3WA3A 1EQKA 1OF5A 4EV2A 3X41A 3F14A 3SVAA 4RZMA 1DETA 1OACA 2D1WA 3LH4A 4N3VA 2FNQA 5IW9A 5ELJA 2W9QA 1JZOA 3BU4A 4J9AA 3LZAA 1BSAA 1M1XB 5LC7A 3K7CA 3F7XA 1GY5A 4HM4B 2ZL8A 4MMYB 5A0OB 3FLJA 3SX1A 1FUSA 4DKIA 4JF8A 2SARA 2QEX3 4EV5A 1O7PB 2ZA4A 1VQ63 3I0YA 1WMOA 1MWSA 1TUHA 3LMLA 1M1K4 3J7Yd 1OCVA 1BNJA 1NU3A 3MWZA 4XM4A 3ZFZA 1BU4A 3X3ZA 1AVKA 4NREA 4HM2B 1UGHI 2D42A 3LT8A 1QALA 3SXXA 1JB4A 1STFI 4R1KA 2A15A
chains in the Genus database with same CATH topology
1BRHA 1A2PA 1RGAA 1AY7A 1RGGA 4GSPA 2AAEA 3SYUA 2KF4A 1UCLA 2KAAA 1GSPA 5HOHA 4J5GA 1GOYA 1BUJA 2RNTA 3Q3FA 3RNTA 1RGKA 1BNGA 1I70A 1ZGXA 4BU4A 1DE3A 1BIRA 3AHWA 3HOHA 1TRQA 1BNEA 1GMQA 1LOVA 2BIRA 6GSPA 1RCLA 1GMRA 1GOUA 3AHSA 1YGWA 4HOHA 1FZUA 5GSPA 1IYYA 3A5EA 2AADA 1B3SA 1BRKA 3AGOA 1RCKA 1B2SA 1RLSA 1FYSA 2BU4A 1TTOA 4GHOA 2F56A 1TRPA 3GSPA 1RGLA 1RNTA 1I2FA 1RGHA 2C4BA 1I2GA 3BIRA 1BRJA 1JBRA 9RNTA 1BRGA 1YVSA 1I3IA 1UCIA 1B27A 2HOHA 1B2UA 3D4AA 3D5IA 1PYLA 1Q9EA 1T2IA 1RGFA 1B2XA 1UCJA 1YNVX 1RGCA 2F5MA 6RNTA 4BIRA 1RHLA 1BRNL 1RTUA 1AQZA 1R4YA 1BSEA 1BSCA 2F5WA 1BNRA 1I2EA 1I0VA 1JBTA 1C54A 1GMPA 5BIRA 1BAOA 1BSDA 7GSPA 1I8VA 2KF5A 1BNFA 1B20A 1UCKA 2KF6A 1BSBA 2RBIA 1I0XA 3WR2A 1MGRA 1BANA 5RNTA 1X1UA 1RSNA 1RGEA 2GSPA 1PY3A 1BNSA 2KF3A 5BU4A 1X1YA 7RNTA 1CH0A 1FUTA 1BNIA 1BGSA 3D5GA 1RMSA 1X1XA 3KCHA 3URPA 1DETA 1B21A 3DH2A 3BU4A 1BRIA 1RNBA 1GOVA 1MGWA 1BSAA 1LOYA 1JBSA 1B2MA 1BVIA 1FUSA 2SARA 4J5KA 2ZA4A 8RNTA 1RN1A 1LRAA 1I3FA 1RN4A 1BOXA 2F4YA 1HZ1A 3AGNA 1BNJA 1G02A 3DGYA 1LOWA 1B2ZA 1BRSA 1BU4A 1SARA 1HYFA 4HAAA 3WHOA 1X1WA 1RDSA 4RNTA 1T2HA 1LNIA 1FW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRH A;  1A2P A;  1RGA A;  1AY7 A;  1RGG A;  4GSP A;  2AAE A;  3SYU A;  2KF4 A;  1UCL A;  2KAA A;  1GSP A;  5HOH A;  4J5G A;  1GOY A;  1BUJ A;  2RNT A;  3Q3F A;  3RNT A;  1RGK A;  1BNG A;  1I70 A;  1ZGX A;  4BU4 A;  1DE3 A;  1BIR A;  3AHW A;  3HOH A;  1TRQ A;  1BNE A;  1GMQ A;  1LOV A;  2BIR A;  6GSP A;  1RCL A;  1GMR A;  1GOU A;  3AHS A;  1YGW A;  4HOH A;  1FZU A;  5GSP A;  1IYY A;  3A5E A;  2AAD A;  1B3S A;  1BRK A;  3AGO A;  1RCK A;  1B2S A;  1RLS A;  1FYS A;  2BU4 A;  1TTO A;  4GHO A;  2F56 A;  1TRP A;  3GSP A;  1RGL A;  1RNT A;  1I2F A;  1RGH A;  2C4B A;  1I2G A;  3BIR A;  1BRJ A;  1JBR A;  9RNT A;  1BRG A;  1YVS A;  1I3I A;  1UCI A;  1B27 A;  2HOH A;  1B2U A;  3D4A A;  3D5I A;  1PYL A;  1Q9E A;  1T2I A;  1RGF A;  1B2X A;  1UCJ A;  1YNV X;  1RGC A;  2F5M A;  6RNT A;  4BIR A;  1RHL A;  1BRN L;  1RTU A;  1AQZ A;  1R4Y A;  1BSE A;  1BSC A;  2F5W A;  1BNR A;  1I2E A;  1I0V A;  1JBT A;  1C54 A;  1GMP A;  5BIR A;  1BAO A;  1BSD A;  7GSP A;  1I8V A;  2KF5 A;  1BNF A;  1B20 A;  1UCK A;  2KF6 A;  1BSB A;  2RBI A;  1I0X A;  3WR2 A;  1MGR A;  1BAN A;  5RNT A;  1X1U A;  1RSN A;  1RGE A;  2GSP A;  1PY3 A;  1BNS A;  2KF3 A;  5BU4 A;  1X1Y A;  7RNT A;  1CH0 A;  1FUT A;  1BNI A;  1BGS A;  3D5G A;  1RMS A;  1X1X A;  3KCH A;  3URP A;  1DET A;  1B21 A;  3DH2 A;  3BU4 A;  1BRI A;  1RNB A;  1GOV A;  1MGW A;  1BSA A;  1LOY A;  1JBS A;  1B2M A;  1BVI A;  1FUS A;  2SAR A;  4J5K A;  2ZA4 A;  8RNT A;  1RN1 A;  1LRA A;  1I3F A;  1RN4 A;  1BOX A;  2F4Y A;  1HZ1 A;  3AGN A;  1BNJ A;  1G02 A;  3DGY A;  1LOW A;  1B2Z A;  1BRS A;  1BU4 A;  1SAR A;  1HYF A;  4HAA A;  3WHO A;  1X1W A;  1RDS A;  4RNT A;  1T2H A;  1LNI A;  1FW7 A; 
#chains in the Genus database with same CATH topology
 5I97 A;  4H61 A;  1RGG A;  4GSP A;  1NB5 I;  3NV0 A;  1Q40 A;  2KF4 A;  2KAA A;  1QMA A;  3BND A;  1OF5 B;  3CCR 3;  1VQQ A;  2CH9 A;  1DMQ A;  4STD A;  3Q3F A;  4EXR A;  3CCE 3;  3CMA 3;  2C11 A;  1JB2 A;  1RGK A;  1BNG A;  1US1 A;  3G8Z A;  1IVU A;  3EN1 B;  1DE3 A;  3AHW A;  3K0Z A;  1RRL A;  4AKZ A;  4KVH A;  1RKY A;  2XGN A;  2W9P A;  1U5O A;  1F8N A;  1OHP A;  1LOV A;  3DGN A;  6GSP A;  1D6Z A;  3CCM 3;  4OVM A;  3UNL A;  3H3H A;  2FGT A;  4U13 A;  1KQS 2;  1FGT A;  2B1X B;  2HMK B;  1A2K A;  3A5E A;  2AAD A;  3CNM A;  1IU7 A;  2IYJ A;  2IMJ A;  3CXC 2;  1FGM A;  1Q81 4;  1ZO2 A;  3N9H A;  2WOF A;  4WWU C;  4N6L A;  3BNE A;  3OW2 2;  1AVL A;  2KCD A;  1HKX A;  1SIH A;  3FH1 A;  2CHC A;  3ER7 A;  4X2H A;  2C4B A;  2KXG A;  3JUQ A;  5CLK A;  1K8A 4;  3ALA A;  3SED A;  1BRJ A;  4ILF A;  1S5A A;  1JBR A;  2YFJ B;  3LTB A;  1IVV A;  1OHO A;  1ROV A;  3FG4 A;  2I9W A;  2Z76 A;  1IQ8 A;  2OTJ 3;  1WQL B;  3S28 A;  1B27 A;  2Y73 A;  5AIF A;  3ZG0 A;  3CPO A;  1IT7 A;  2CWT A;  3DGM A;  3D5I A;  5AIG A;  3V98 A;  1Q9E A;  4RBN A;  3ZG5 A;  3GRD A;  1UCJ A;  1YNV X;  2CFG A;  3GWR A;  3HK4 A;  1RGC A;  4AEQ A;  4I4K A;  5IG3 A;  2BMO B;  3FSD A;  4G1M B;  1R4Y A;  1W6C A;  3HI7 A;  1FGQ A;  3V99 A;  1BSE A;  1K9M 4;  3LOY A;  2K3D A;  1BNR A;  1NO3 A;  1OH0 A;  3T8U A;  1KC8 4;  2KF6 A;  1GY6 A;  3G16 A;  3ECF A;  3WA2 X;  1L5G B;  3GAX A;  2OTL 3;  3HII A;  5G1L A;  3G4S 3;  1RGE A;  2GSP A;  2P09 A;  1EA2 A;  2CFW A;  4WYK B;  3EX9 A;  2KF3 A;  1STD A;  5BU4 A;  2ML5 A;  3RGA A;  7RNT A;  3CPW 2;  2RFR A;  2CIU A;  5CF2 A;  2HML B;  4HBR A;  2UX0 A;  2Z7A A;  1YJ9 3;  3EN8 A;  2F99 A;  1RMS A;  2HMO B;  2XGL A;  3KSE D;  4EW5 A;  1LQG C;  1EKM A;  1R4C A;  3FGY A;  4HM6 B;  3G71 3;  2BNG A;  3H51 A;  3WOE B;  3CC4 3;  1BRI A;  1RNB A;  1GOV A;  4HM8 B;  3VSY A;  1LOY A;  1OUN A;  3DGO A;  1YHQ 3;  4K1U A;  4O8S A;  3GZX B;  4FMB A;  1JJ2 2;  2K0M A;  2XFT A;  4HM5 B;  1Q7Y 4;  5G2G A;  1MWR A;  2BMR B;  2P0X A;  1D6U A;  3NHX A;  1K28 A;  2F4Y A;  1VQ9 3;  1Q42 A;  2BHM A;  1A2V A;  1HZ1 A;  2XSO B;  4WHA A;  3DGY A;  4HKV B;  3X40 A;  2LYX A;  3NBJ A;  1Z1S A;  2IUJ A;  1HYF A;  3EC9 A;  2CFD A;  4HAA A;  2GU1 A;  3JUP A;  1UCK A;  1RDS A;  1T2H A;  1TP6 A;  1LNI A;  2OCT A;  1JKG A;  3D9R A;  4R4K A;  4RNT A;  2XSH B;  1FW7 A;  1AY7 A;  2AAE A;  3RGR A;  3UL5 A;  5TGN A;  3NBB A;  1UCL A;  2GEX A;  5DRE A;  4N6V 0;  4HZB B;  1BUJ A;  2RNT A;  3WMD A;  1IV9 A;  1VQ8 3;  1O7W B;  4LGQ A;  4GL6 A;  1WMN A;  1BNE A;  1GMQ A;  3CU3 A;  1TFK A;  4BTY A;  3FG3 A;  3N54 B;  1M90 4;  1T5Y A;  1RCL A;  3VF1 A;  4BTX A;  1GOU A;  2CX0 A;  5FGO A;  1VZZ A;  3I55 3;  2XR8 B;  4FCM A;  4WFO A;  2BO9 B;  2IUK A;  3F9S A;  3OWY A;  1YJN 3;  4KT3 B;  1BRK A;  1CYV A;  2INX A;  1E3R A;  1B2S A;  2BU4 A;  4GHO A;  1GY7 A;  1ZS7 A;  2ML6 A;  1MOL A;  1TRP A;  3FF2 A;  1RNT A;  3K9M C;  1RGH A;  1YIT 3;  3UJM A;  1I2G A;  3KII A;  1MWT A;  3QK9 A;  2WO0 A;  3LT9 A;  1IDP A;  3AMO A;  2MF7 A;  3DM8 A;  4XBY A;  1U8C B;  3FZW A;  2W56 A;  1YVS A;  3QRD A;  4O2H A;  4OUQ A;  9RNT A;  1N5P A;  4O3V A;  2H0G A;  1VQ5 3;  4MMZ B;  2HOH A;  1JN5 A;  3MG1 A;  4KFD A;  2W03 A;  5AYS C;  2P0M A;  1PYL A;  1T2I A;  3X3X A;  1JB5 A;  4HM1 B;  3G6E 3;  5EVH A;  2F86 B;  3LTD A;  1NJI 4;  2GU3 A;  3IJE B;  4HM7 B;  4BIR A;  2K54 A;  3CCL 3;  4KFE A;  2WGQ A;  3PXM A;  2YX9 A;  1YJW 3;  5IEP A;  5JPU A;  2E2V A;  3PGB A;  3D3L A;  1LXE A;  1JBT A;  4L8O A;  1DVC A;  3S5C A;  1Q7H A;  2RGQ A;  5AI1 A;  1VQL 3;  3NM2 A;  1T3B A;  3NM7 A;  3O8Y A;  3KN4 A;  3NV0 B;  1Q40 B;  3MPH A;  1MGR A;  2B24 B;  2RSX A;  4ZM8 A;  5RNT A;  1X1U A;  1RSN A;  3KE7 A;  4RNZ A;  3CCS 3;  4HM0 B;  1PY3 A;  3MG2 A;  2UGI A;  4RNY A;  4N6N B;  7STD A;  3BLZ A;  5AII A;  1C7H A;  2FXT A;  2OOV C;  1IQX A;  1YVB I;  1UW1 A;  1UI7 A;  1ZX2 A;  2R4I A;  2WOH A;  3EJV A;  1VQM 3;  4N6M A;  3RDE A;  5IEN A;  1W6G A;  2PNC A;  3LXU X;  1BGS A;  3PCR A;  3CNX A;  4K1V A;  4LSO A;  1QAK A;  4MMX B;  3D5G A;  1CYU A;  1X1X A;  1ASK A;  3FKA A;  4XDV A;  3KCH A;  4HM3 B;  4CDL A;  1QVG 2;  3NBR A;  1SQW A;  2CKF B;  3Q1C A;  2UUG C;  1TU5 A;  5IER A;  1MGW A;  2CC3 A;  3SLU A;  1V58 A;  3PS8 A;  3OXA A;  1JBS A;  3B4O A;  4K90 B;  3MKI A;  2RCD A;  2HMJ B;  2W0Q A;  4TX4 A;  2L4V A;  5KP4 A;  4J5K A;  3NQZ A;  4HJL B;  2WGO A;  1VQN 3;  3V92 A;  1VQP 3;  4LEH A;  8RNT A;  5IF6 A;  1W2B 2;  1AR0 A;  1RN4 A;  1I3F A;  1LRA A;  1BOX A;  1DMM A;  1UDI I;  2JQ5 A;  2O3O A;  3AGN A;  2GBX B;  4CJN A;  1VQO 3;  1B2Z A;  1K73 4;  3FF0 A;  2E2T A;  3S29 A;  1X1W A;  3B7C A;  4CCV A;  2HMM B;  2IY2 A;  5AIH A;  1K41 A;  2CWV A;  1RGA A;  4N6O B;  1D6Y A;  3SYU A;  1EEJ A;  3LTC A;  1IVW A;  1PFP A;  5HGR A;  1SJW A;  2W2C A;  1SPU A;  3JUO A;  1N9J A;  1UGI A;  5EQL A;  4J5G A;  1GOY A;  1NNV A;  1VQ7 3;  4HZ9 B;  4EBG A;  1I70 A;  1ZGX A;  4IT7 A;  3NX0 A;  1BIR A;  3HOH A;  4OK0 A;  4R80 A;  1TRQ A;  3WDG B;  5CK6 A;  1DMN A;  3BB9 A;  1IQY A;  3X42 A;  1JNQ A;  1W5Z A;  5IG0 A;  1GS3 A;  4PEJ A;  1YGW A;  1YGE A;  3K63 A;  2L1S A;  1W2Z A;  2ZDJ A;  3DUK A;  1IYY A;  3OX9 A;  3NUV A;  3TDG A;  3F8H A;  3STD A;  5JBS A;  1Q86 4;  3OWS A;  5EEO A;  1TTO A;  4K61 A;  4ORL A;  2F56 A;  3Q90 A;  1EUI C;  2GXF A;  1W02 A;  1I2F A;  1Y4K A;  4JRF A;  1IV7 A;  2XFS A;  1AV4 A;  3B4P A;  2CG1 A;  3U1W A;  1WMP A;  3DGL A;  3G0K A;  1BRG A;  3OWU A;  1OGX A;  2CW9 A;  1G0T A;  8CHO A;  5ELU A;  5JPP A;  3F40 A;  2CFL A;  2E2U A;  3UL6 A;  3MYT A;  2ZHX B;  3N8B A;  1GD3 A;  1WNH A;  2O9U X;  1N9E A;  2H0H A;  4N6U A;  5G1K A;  3GZR A;  4R9L A;  1QAF A;  2CG0 A;  4XB5 A;  3CCU 3;  1RGF A;  1OGZ A;  1B2X A;  1WTH A;  3WOD G;  3ROB A;  2YFI B;  2OQE A;  1LQM B;  1RHL A;  3NQY A;  5AYR B;  1BUQ A;  1RTU A;  5DRV A;  4FMA A;  3CCQ 3;  3EB8 A;  1IVX A;  1G96 A;  2F98 A;  3S67 A;  4L7K A;  2Y74 A;  1UUV B;  3PZW A;  1I0V A;  3KKG A;  5IEO A;  1GD4 A;  1ULI B;  2P05 A;  1BSD A;  3IPT A;  1JKG B;  2RBI A;  1BNF A;  1B20 A;  1TJD A;  1BSB A;  3MSO A;  1I0X A;  4Q53 A;  2IA7 A;  3EBT A;  2QIY A;  1BAN A;  3UB1 A;  5BVB A;  4HYZ A;  1Q82 4;  4H3U A;  1UUG B;  4BTW A;  3DMC A;  5M1A A;  2CFK A;  4MEI A;  1O7M B;  4LZI A;  3HZP A;  1QJG A;  1W6Y A;  2XF3 A;  2J8X B;  1FUT A;  1FA3 A;  1M9G A;  2XH9 A;  2C10 A;  2CX1 A;  1RRH A;  4EYC A;  4LMI A;  1NWW A;  3JUM A;  4IIA A;  2MC8 A;  3KFQ C;  4L8P A;  3URP A;  2XRX B;  1O7G B;  1MNL A;  4LYL B;  1B21 A;  3BNC A;  1LOX A;  3DH2 A;  3CME 3;  1KWI A;  4EC6 A;  1YI2 3;  2CK3 H;  5M18 A;  1B2M A;  4X2O A;  1BVI A;  1SII A;  3F7S A;  2QA4 3;  3IMA B;  1O7H B;  1VQ4 3;  1OHS A;  5CF1 A;  1CQS A;  1FGR A;  1N8Q A;  1DVD A;  1RN1 A;  3OV4 A;  4MJD A;  1G02 A;  1LOW A;  1JZD A;  3AMO B;  1ISK A;  1BRS A;  1LVN A;  1IT8 A;  2W56 B;  1SAR A;  3WHO A;  4BL3 A;  1J2B A;  4WP5 A;  1JV2 B;  2LQV A;  3LYG A;  1JN5 B;  1BRH A;  1RJO A;  3DY5 A;  3KSP A;  4HVN A;  1A2P A;  5IG4 A;  1YIJ 3;  3T8N A;  1O7N B;  3CC7 3;  1GSP A;  2PZV A;  4KZ1 A;  5HOH A;  3U97 A;  3VGN A;  3CC2 3;  3RNT A;  1NDO B;  4WYK A;  2R41 A;  4BU4 A;  3HX8 A;  1PU4 A;  1OPY A;  1TIJ A;  6STD A;  4XDW A;  4N6T A;  1JRQ A;  2BIR A;  1S72 3;  1GMR A;  4I5Q A;  3AHS A;  2CWU A;  4HOH A;  1FZU A;  1KSI A;  5M19 A;  2OOV A;  5GSP A;  2P38 A;  5KP1 A;  1W4N A;  1B3S A;  3AGO A;  3KZT A;  3BNB A;  4QWT A;  1RCK A;  1IK3 A;  3MHE A;  3S27 A;  1RLS A;  1FYS A;  1UUW B;  3EBY A;  3SOY A;  3DXO A;  1V74 A;  2W6J H;  5STD A;  3GSP A;  1RGL A;  2STD A;  3E99 A;  2KRT A;  5CXO A;  1A90 A;  5LC6 A;  3BIR A;  3EE1 A;  4NHF A;  3K5T A;  1FGO A;  5IG5 A;  1A67 A;  3B8L A;  4FR9 A;  1W01 A;  2JDI H;  1TFO A;  1FUW A;  2XEP A;  3M8C A;  4GB5 A;  2W04 A;  4IPB A;  4R9K A;  1HU9 A;  4FCJ A;  1I3I A;  2Q07 A;  1DYU A;  2GEY A;  1N5H A;  1UCI A;  2Z6B A;  2SBL A;  4FMD A;  2M7O A;  1B2U A;  3NXJ A;  5FW5 A;  3D4A A;  3LTA A;  3Q2P A;  2GBW B;  3DZL A;  1W7C A;  2HMN B;  3PYJ A;  1LNH A;  3GZB A;  3JVC A;  1QVF 2;  4XBT A;  1W00 A;  2F5M A;  5D83 A;  6RNT A;  1N8R 4;  1BRN L;  1AQZ A;  4O02 B;  1GYB A;  3F8X A;  3I56 3;  3EHC A;  4J8T A;  1E3V A;  3PCS A;  1BSC A;  2F5W A;  1I2E A;  1C54 A;  1GMP A;  2QGU A;  3GZY B;  5BIR A;  4BL2 A;  1VQK 3;  4KFF A;  1BAO A;  3WOF B;  3X3Y A;  1I8V A;  7GSP A;  1ROA A;  1UI8 A;  2KF5 A;  1E97 A;  3HIG A;  3T0U A;  5D82 A;  1MWU A;  3WR2 A;  5AEU B;  1RN7 A;  1V57 A;  3MG3 A;  1ULJ B;  4NPB A;  5KP3 A;  3FCS B;  3L0R A;  2V1L A;  3CCV 3;  2OWP A;  4AKY A;  4FMC A;  3CD6 3;  4XBX A;  5BXQ A;  3A76 A;  2YFL B;  5D81 A;  1BNS A;  2H0I A;  1X1Y A;  1KD1 4;  3SOA A;  2OQE C;  3EQQ B;  4FCZ A;  1CEW I;  2Z77 A;  2BMQ B;  1NB3 I;  2BT3 A;  1CH0 A;  3FG1 A;  3D79 A;  1BNI A;  3JUN A;  3EF8 A;  1EG9 B;  4CPK A;  5AEW B;  3CCJ 3;  3WA3 A;  1EQK A;  1OF5 A;  4EV2 A;  3X41 A;  3F14 A;  3SVA A;  4RZM A;  1DET A;  1OAC A;  2D1W A;  3LH4 A;  4N3V A;  2FNQ A;  5IW9 A;  5ELJ A;  2W9Q A;  1JZO A;  3BU4 A;  4J9A A;  3LZA A;  1BSA A;  1M1X B;  5LC7 A;  3K7C A;  3F7X A;  1GY5 A;  4HM4 B;  2ZL8 A;  4MMY B;  5A0O B;  3FLJ A;  3SX1 A;  1FUS A;  4DKI A;  4JF8 A;  2SAR A;  2QEX 3;  4EV5 A;  1O7P B;  2ZA4 A;  1VQ6 3;  3I0Y A;  1WMO A;  1MWS A;  1TUH A;  3LML A;  1M1K 4;  3J7Y d;  1OCV A;  1BNJ A;  1NU3 A;  3MWZ A;  4XM4 A;  3ZFZ A;  1BU4 A;  3X3Z A;  1AVK A;  4NRE A;  4HM2 B;  1UGH I;  2D42 A;  3LT8 A;  1QAL A;  3SXX A;  1JB4 A;  1STF I;  4R1K A;  2A15 A; 
#chains in the Genus database with same CATH homology
 1BRH A;  1A2P A;  1RGA A;  1AY7 A;  1RGG A;  4GSP A;  2AAE A;  3SYU A;  2KF4 A;  1UCL A;  2KAA A;  1GSP A;  5HOH A;  4J5G A;  1GOY A;  1BUJ A;  2RNT A;  3Q3F A;  3RNT A;  1RGK A;  1BNG A;  1I70 A;  1ZGX A;  4BU4 A;  1DE3 A;  1BIR A;  3AHW A;  3HOH A;  1TRQ A;  1BNE A;  1GMQ A;  1LOV A;  2BIR A;  6GSP A;  1RCL A;  1GMR A;  1GOU A;  3AHS A;  1YGW A;  4HOH A;  1FZU A;  5GSP A;  1IYY A;  3A5E A;  2AAD A;  1B3S A;  1BRK A;  3AGO A;  1RCK A;  1B2S A;  1RLS A;  1FYS A;  2BU4 A;  1TTO A;  4GHO A;  2F56 A;  1TRP A;  3GSP A;  1RGL A;  1RNT A;  1I2F A;  1RGH A;  2C4B A;  1I2G A;  3BIR A;  1BRJ A;  1JBR A;  9RNT A;  1BRG A;  1YVS A;  1I3I A;  1UCI A;  1B27 A;  2HOH A;  1B2U A;  3D4A A;  3D5I A;  1PYL A;  1Q9E A;  1T2I A;  1RGF A;  1B2X A;  1UCJ A;  1YNV X;  1RGC A;  2F5M A;  6RNT A;  4BIR A;  1RHL A;  1BRN L;  1RTU A;  1AQZ A;  1R4Y A;  1BSE A;  1BSC A;  2F5W A;  1BNR A;  1I2E A;  1I0V A;  1JBT A;  1C54 A;  1GMP A;  5BIR A;  1BAO A;  1BSD A;  7GSP A;  1I8V A;  2KF5 A;  1BNF A;  1B20 A;  1UCK A;  2KF6 A;  1BSB A;  2RBI A;  1I0X A;  3WR2 A;  1MGR A;  1BAN A;  5RNT A;  1X1U A;  1RSN A;  1RGE A;  2GSP A;  1PY3 A;  1BNS A;  2KF3 A;  5BU4 A;  1X1Y A;  7RNT A;  1CH0 A;  1FUT A;  1BNI A;  1BGS A;  3D5G A;  1RMS A;  1X1X A;  3KCH A;  3URP A;  1DET A;  1B21 A;  3DH2 A;  3BU4 A;  1BRI A;  1RNB A;  1GOV A;  1MGW A;  1BSA A;  1LOY A;  1JBS A;  1B2M A;  1BVI A;  1FUS A;  2SAR A;  4J5K A;  2ZA4 A;  8RNT A;  1RN1 A;  1LRA A;  1I3F A;  1RN4 A;  1BOX A;  2F4Y A;  1HZ1 A;  3AGN A;  1BNJ A;  1G02 A;  3DGY A;  1LOW A;  1B2Z A;  1BRS A;  1BU4 A;  1SAR A;  1HYF A;  4HAA A;  3WHO A;  1X1W A;  1RDS A;  4RNT A;  1T2H A;  1LNI A;  1FW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...