1FZUA

Rnase t1 v78a mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRAVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1fzuA00
1BRNL 1LNIA 1LOVA 1PYLA 3WR2A 1BRGA 1TRQA 3D5IA 1MGRA 1Q9EA 1UCIA 5BIRA 1BGSA 1BVIA 1FUTA 5BU4A 1RDSA 1AY7A 1X1YA 1RHLA 2F56A 1YGWA 1BSCA 4J5GA 6RNTA 1I2GA 1RGHA 1BRHA 2SARA 1RNBA 3AHWA 1IYYA 1RGFA 1I2FA 2BIRA 2KF3A 1LRAA 1GMQA 1RMSA 4BIRA 1BNIA 1HYFA 1I70A 1GOUA 1MGWA 1TTOA 3D5GA 1B3SA 1RCLA 7RNTA 1C54A 1UCKA 3HOHA 1PY3A 1X1WA 1BIRA 2KAAA 1LOYA 1I0VA 1GOVA 1BANA 3GSPA 1X1UA 1GMRA 1RCKA 4BU4A 1FW7A 1BRJA 1B2ZA 1BRKA 1BRIA 1RGEA 1GMPA 1RGLA 1B2XA 9RNTA 1JBSA 1RSNA 1LOWA 1YNVX 3D4AA 1BNSA 2F5WA 1RTUA 1RN4A 1BSDA 1TRPA 2KF4A 1GOYA 4GHOA 2GSPA 1FYSA 2HOHA 5GSPA 1G02A 3RNTA 1RGAA 3KCHA 1B2SA 1DETA 3BU4A 2RNTA 1B2MA 1BAOA 1R4YA 1T2HA 1ZGXA 1BNEA 2F4YA 3A5EA 1RGCA 1A2PA 1T2IA 1I3FA 1I3IA 1UCJA 3WHOA 1BU4A 2KF5A 1BNGA 1FZUA 1RGKA 1B20A 1FUSA 3Q3FA 4J5KA 1JBRA 1I0XA 1DE3A 1BRSA 1RGGA 1RNTA 1BNFA 1BSEA 3DGYA 6GSPA 1HZ1A 1GSPA 2ZA4A 1BSAA 1BUJA 5RNTA 1RLSA 1JBTA 1I2EA 1I8VA 3SYUA 3URPA 1X1XA 1BNJA 4HOHA 1BSBA 3DH2A 2BU4A 1CH0A 1YVSA 1UCLA 2C4BA 1BNRA 3AGNA 4RNTA 1AQZA 1RN1A 1BOXA 2AADA 5HOHA 3AHSA 8RNTA 1B21A 4HAAA 2KF6A 2AAEA 1B2UA 3BIRA 2RBIA 2F5MA 3AGOA 1B27A 7GSPA 4GSPA 1SARA
chains in the Genus database with same CATH superfamily
4WP5A 3K7CA 1A2VA 1BRGA 2P38A 4HM5B 3PYJA 1SPUA 1SJWA 1AVLA 1KSIA 2GU3A 5BIRA 1BGSA 2F98A 1FUTA 3H3HA 1DMNA 3CCJ3 1JNQA 2BT3A 2OCTA 4LMIA 1QJGA 1A67A 3NUVA 1RRHA 1IVXA 1MWSA 3E99A 4R9LA 1YGWA 3JUMA 3NBJA 4STDA 4FMAA 4XBTA 1E3RA 3H51A 2LQVA 1GS3A 3AHWA 3K5TA 1GY5A 4KFDA 4N6V0 2CG1A 1UDII 3V92A 2WGQA 4NPBA 5BXQA 1I2FA 2IUJA 2UX0A 2JQ5A 5DRVA 2P0XA 4IIAA 7STDA 1LRAA 2W2CA 3JUOA 4BL3A 1KC84 1OHSA 4AKYA 3V99A 4N6NB 2FGTA 1TTOA 3D5GA 1GOUA 1IDPA 1VQ73 4GL6A 3NV0B 2E2VA 2L4VA 3HIIA 1VQO3 3VSYA 1IV7A 1Q824 2O3OA 1TFOA 1IVWA 1MOLA 2Z7AA 3DZLA 4KFEA 4N6TA 4XB5A 1GOVA 5IERA 1DMMA 3X41A 4CDLA 1V58A 3HK4A 1JJ22 1W2ZA 3I563 4WFOA 1GMPA 4EXRA 3F8HA 3U1WA 2K0MA 3BNBA 3GWRA 3T8NA 2CWTA 3CPOA 2BMQB 5AIGA 1JKGB 1W01A 3B4PA 3PXMA 1Q40A 1RN4A 4MMZB 1EG9B 2KRTA 2LYXA 1NJI4 1FYSA 3JVCA 4O2HA 4L8OA 4HZ9B 1DETA 1B2MA 4MMXB 4ORLA 1W6CA 2CIUA 5IEPA 5JPPA 3BB9A 5ELJA 1FGTA 2CW9A 1N9EA 2CFGA 4XBXA 1IK3A 4J8TA 1W00A 3ER7A 1JZDA 5AEUB 1EUIC 1FZUA 3G0KA 1NB3I 5ELUA 1B20A 1JB2A 1ZX2A 1LQGC 3OWUA 5EQLA 2MC8A 2KCDA 3T0UA 3Q1CA 1K8A4 5IENA 1M904 3K9MC 5KP1A 3WA3A 1IT8A 3LOYA 3LZAA 2F99A 1W2B2 1JB5A 3SYUA 1S5AA 2ZDJA 2JDIH 2XFSA 3PZWA 3G713 3OW22 2W0QA 3MHEA 1LXEA 1CH0A 3LTBA 4MMYB 3DGLA 3OV4A 1UCLA 2OOVC 3EE1A 5G2GA 5JPUA 2C11A 4DKIA 1AQZA 4OVMA 3EC9A 2CFDA 1T5YA 1Q40B 3WDGB 3STDA 1RN1A 1BOXA 1K28A 1W6GA 5HOHA 1KQS2 2RCDA 2CWVA 1IQ8A 2UGIA 2KF6A 3AMOB 2AAEA 3CMA3 2RBIA 1NO3A 1B27A 2BHMA 2E2TA 1UUWB 3EX9A 3GZRA 1NB5I 1ROAA 2OQEC 1RJOA 4LEHA 3K63A 1WQLB 1BRNL 3NM2A 3KIIA 1PYLA 1OHPA 1ASKA 1TRQA 2QGUA 2ML5A 3DGOA 4HZBB 5M1AA 2IA7A 3CCS3 1UUVB 1UCIA 2R4IA 5M18A 3CCE3 1RKYA 3LT8A 4CCVA 1VQL3 3DGNA 2IY2A 1IV9A 2CX0A 3KKGA 1X1YA 5STDA 3FSDA 3MG1A 2GEYA 4Q53A 3MWZA 8CHOA 3BNDA 2F56A 4O8SA 5LC6A 1BSCA 1RGHA 2XSOB 1UGHI 2H0IA 5I97A 2W04A 3WOEB 1KWIA 1SIIA 2QA43 1DVCA 4KT3B 1FGRA 2INXA 1HKXA 1G0TA 3FH1A 1JN5B 1NNVA 1O7NB 2BIRA 4BTYA 4HM4B 5IG3A 1GMQA 1LNHA 1RMSA 1N5HA 2M7OA 3UL6A 3JUPA 4WYKB 1BUQA 1MGWA 1OHOA 2W03A 1TU5A 1TJDA 1B3SA 2O9UX 1UUGB 1GY7A 4ILFA 2H0GA 1JKGA 1V74A 1D6UA 1GY6A 1YJ93 3OXAA 3EQQB 4JRFA 5CF1A 2CC3A 3T8UA 2KAAA 3S28A 2CH9A 3CU3A 3FF0A 3WMDA 1U5OA 1W5ZA 1X1UA 1W6YA 1GMRA 1FW7A 2GBXB 1B2ZA 4FMDA 4FCZA 1RGEA 1YGEA 1JBSA 1G96A 5EVHA 1LOWA 1OCVA 1W4NA 1W7CA 3F9SA 3LMLA 3PCSA 1QVF2 2HMLB 1JRQA 1RTUA 2HMMB 1GD3A 3UL5A 3G4S3 2CX1A 1OUNA 2Z6BA 5DREA 3N9HA 4EV2A 2WGOA 1A90A 2Y73A 4GHOA 1SQWA 2GSPA 2HOHA 4KZ1A 4HYZA 3J7Yd 3FF2A 3OWSA 1K9M4 1CYVA 1TP6A 2CK3H 3KCHA 3CCU3 2RNTA 5CLKA 5AYSC 4K1VA 1NDOB 3A5EA 3RGAA 3A76A 3MG3A 3PCRA 3ALAA 1Y4KA 2E2UA 3EN1B 4N3VA 2P0MA 3CCQ3 2D1WA 1T2IA 1I3IA 2PNCA 3F14A 3NQZA 2CKFB 2HMOB 4IPBA 3MG2A 2W9QA 1RGKA 5G1KA 4FMCA 3X3ZA 1RN7A 1WMOA 1FUSA 1YIT3 3MPHA 4J5KA 2H0HA 5AEWB 3FG3A 2XFTA 3CC73 3GRDA 1Q7Y4 3DGYA 4KFFA 4HM0B 4RNYA 5IG0A 3WODG 2ZA4A 1O7PB 2BMOB 2RSXA 3S5CA 3SLUA 5RNTA 1JBTA 3NBBA 1AR0A 3AMOA 3EF8A 3D3LA 4MJDA 1UW1A 2UUGC 3URPA 1X1XA 3PS8A 3M8CA 5FW5A 3DY5A 1KD14 3DH2A 3FKAA 3ROBA 1YVSA 2BO9B 1ROVA 3WOFB 4N6LA 1JZOA 3DXOA 2MF7A 4WWUC 3QK9A 4X2HA 3Q2PA 1L5GB 4RZMA 8RNTA 2IUKA 3X3YA 4K1UA 3KSED 3O8YA 1OGXA 2F5WA 2GU1A 1SARA 2GEXA 2W6JH 1JV2B 1VQK3 2F86B 1LOVA 5IG4A 1OF5B 2HMNB 4LGQA 3NBRA 3WR2A 3D5IA 4R4KA 1GD4A 1JN5A 1MGRA 1Q9EA 5G1LA 2R41A 3SXXA 3CCV3 2XRXB 2IYJA 5LC7A 2XR8B 2SBLA 1BVIA 2WOHA 3F7XA 5AIIA 4O02B 5BU4A 3ZG0A 1K41A 4BTWA 3CCM3 4QWTA 4RBNA 4WYKA 3UNLA 1W02A 3DM8A 3CC23 6RNTA 1I2GA 1UI8A 4U13A 1BRHA 1V57A 2SARA 2CFKA 3EN8A 1RNBA 2KXGA 3KSPA 5TGNA 3ZFZA 5D82A 4JF8A 3EBYA 3KFQC 1JB4A 1FUWA 5HGRA 4K61A 4ZM8A 3G16A 1WTHA 2C10A 4PEJA 4H61A 3CD63 4FCJA 1EKMA 4N6MA 1BNIA 1YI23 1HYFA 3I553 2W56B 4MEIA 2I9WA 3MSOA 3S67A 1UCKA 4EC6A 1LVNA 1PY3A 3EJVA 3HZPA 3D9RA 3VF1A 2W9PA 3JUQA 1CQSA 4CJNA 1BIRA 1LOYA 4HM6B 1I0VA 1N8QA 2D42A 4RNZA 2PZVA 1BANA 3GSPA 2GXFA 3SVAA 3SOYA 1NU3A 1E97A 4GB5A 2OQEA 1C7HA 1BRJA 4LYLB 1BRIA 3IMAB 1ZS7A 1VQQA 1B2XA 3DMCA 3NHXA 5KP3A 9RNTA 2XF3A 1RSNA 1IQYA 3BNCA 4I4KA 2XH9A 1VQ53 5AI1A 5D81A 1MWRA 1BSDA 1RRLA 2BMRB 4AEQA 3JUNA 3MKIA 2CG0A 2XSHB 2STDA 1NWWA 2YFLB 4O3VA 1G02A 3RNTA 1B2SA 2P09A 5IEOA 1A2KA 1R4YA 1US1A 4XBYA 4FMBA 4L8PA 1ULIB 2XGLA 1BNEA 1N9JA 5AIFA 1CYUA 1OH0A 1WNHA 2OTJ3 1A2PA 3BNEA 4R80A 3F8XA 1I3FA 2GBWB 3EB8A 1UCJA 1OPYA 1N5PA 1BU4A 1ULJB 3FZWA 3FG1A 5CK6A 5D83A 3LTAA 3QRDA 1BNGA 3SX1A 1E3VA 1PFPA 1OGZA 3OX9A 2V1LA 3Q3FA 1CEWI 2Z76A 2CHCA 1JBRA 1IU7A 1DE3A 1BRSA 1RNTA 1FGOA 1HZ1A 3SOAA 1BSAA 3I0YA 3CC43 1IVVA 1S723 1RLSA 3X42A 1I2EA 2YFIB 5A0OB 4HM2B 1LQMB 2QIYA 1MNLA 1O7HB 1QMAA 2XEPA 3B7CA 3GZBA 3X40A 2ML6A 3F40A 4HBRA 3KE7A 1OF5A 3AGNA 4RNTA 3D79A 4KVHA 3CME3 1MWUA 4L7KA 3V98A 3FCSB 4HKVB 4H3UA 5AYRB 3U97A 4FR9A 1UGIA 4WHAA 1VQM3 2AADA 3AHSA 3DGMA 1B21A 3CCR3 3EBTA 3Q90A 1Q7HA 2YFJB 1O7GB 2F5MA 3NM7A 3AGOA 5EEOA 3X3XA 1WMPA 7GSPA 4LSOA 2K3DA 3CNXA 1EA2A 3BU4A 3GAXA 1FA3A 2HMJB 1YJW3 4HM7B 1D6ZA 1LNIA 1R4CA 2OWPA 3ECFA 4N6OB 2B1XB 1J2BA 1VQ63 1F8NA 3FG4A 3EHCA 1VZZA 4XM4A 1U8CB 3IJEB 4HM3B 1DMQA 1RDSA 1AY7A 3G6E3 3UB1A 3G8ZA 4R9KA 1RHLA 2CWUA 2W56A 1EQKA 1SIHA 4J5GA 1QAKA 1IVUA 1IYYA 3LYGA 1RGFA 1IT7A 2CFLA 3RGRA 3DUKA 3CXC2 1YIJ3 1TFKA 2KF3A 4EV5A 2P05A 2Z77A 4J9AA 3GZXB 1Q42A 4EBGA 4BIRA 1VQ43 4OUQA 1I70A 1VQ83 4CPKA 1Q814 4R1KA 1RCLA 5IG5A 1C54A 2ZHXB 3HOHA 4XDWA 4AKZA 2XGNA 2WOFA 5AIHA 1X1WA 1PU4A 4N6UA 1MWTA 3VGNA 4HM1B 1YVBI 4G1MB 4EYCA 1FGMA 4HJLB 1RCKA 4BU4A 3N54B 1BRKA 2Q07A 1RGLA 1UI7A 3LT9A 3CPW2 1YNVX 2BNGA 3D4AA 1ZO2A 2L1SA 2RGQA 3KZTA 1BNSA 1Q864 1QVG2 2J8XB 2K54A 3WA2X 2YX9A 3CCL3 1M1K4 1TRPA 2KF4A 1GOYA 1VQ93 3OWYA 1GYBA 2Y74A 3TDGA 1VQP3 2OTL3 1TUHA 5GSPA 2OOVA 6STDA 1RGAA 1STFI 2RFRA 3CNMA 2WO0A 5IW9A 1BAOA 4HM8B 1HU9A 1Z1SA 1T2HA 1K734 1DVDA 1ZGXA 3L0RA 2F4YA 3LH4A 1RGCA 4FCMA 4XDVA 3LXUX 1QAFA 1O7WB 3WHOA 2KF5A 5BVBA 1LOXA 3ZG5A 2FXTA 1DYUA 2IMJA 4LZIA 3LTDA 1I0XA 3S29A 2CFWA 1RGGA 3B8LA 3IPTA 1QALA 1BNFA 4IT7A 1N8R4 1BSEA 3K0ZA 5KP4A 3PGBA 6GSPA 1GSPA 3NXJA 1BUJA 1I8VA 1OACA 3N8BA 3UJMA 5M19A 3HIGA 2HMKB 1O7MB 1EEJA 1WMNA 3HI7A 5IF6A 1ISKA 2B24B 1IQXA 1AV4A 1BNJA 1BSBA 1M1XB 3GZYB 4HOHA 4TX4A 1T3BA 2FNQA 3BLZA 3FGYA 2BU4A 4OK0A 3RDEA 3LTCA 1AVKA 2C4BA 1BNRA 3NV0A 3HX8A 4NREA 5CXOA 2A15A 4I5QA 3KN4A 1YHQ3 4BL2A 2QEX3 3NQYA 2ZL8A 5FGOA 1TIJA 5JBSA 1VQN3 3SEDA 4EW5A 5CF2A 4NHFA 4HVNA 3B4OA 4HAAA 3F7SA 4X2OA 4BTXA 1YJN3 1D6YA 3NX0A 4K90B 1B2UA 1STDA 3BIRA 3FLJA 3MYTA 1FGQA 1M9GA 7RNTA 4GSPA 3S27A
chains in the Genus database with same CATH topology
1BRNL 1LNIA 1LOVA 1PYLA 3WR2A 1BRGA 1TRQA 3D5IA 1MGRA 1Q9EA 1UCIA 5BIRA 1BGSA 1BVIA 1FUTA 5BU4A 1RDSA 1AY7A 1X1YA 1RHLA 2F56A 1YGWA 1BSCA 4J5GA 6RNTA 1I2GA 1RGHA 1BRHA 2SARA 1RNBA 3AHWA 1IYYA 1RGFA 1I2FA 2BIRA 2KF3A 1LRAA 1GMQA 1RMSA 4BIRA 1BNIA 1HYFA 1I70A 1GOUA 1MGWA 1TTOA 3D5GA 1B3SA 1RCLA 7RNTA 1C54A 1UCKA 3HOHA 1PY3A 1X1WA 1BIRA 2KAAA 1LOYA 1I0VA 1GOVA 1BANA 3GSPA 1X1UA 1GMRA 1RCKA 4BU4A 1FW7A 1BRJA 1B2ZA 1BRKA 1BRIA 1RGEA 1GMPA 1RGLA 1B2XA 9RNTA 1JBSA 1RSNA 1LOWA 1YNVX 3D4AA 1BNSA 2F5WA 1RTUA 1RN4A 1BSDA 1TRPA 2KF4A 1GOYA 4GHOA 2GSPA 1FYSA 2HOHA 5GSPA 1G02A 3RNTA 1RGAA 3KCHA 1B2SA 1DETA 3BU4A 2RNTA 1B2MA 1BAOA 1R4YA 1T2HA 1ZGXA 1BNEA 2F4YA 3A5EA 1RGCA 1A2PA 1T2IA 1I3FA 1I3IA 1UCJA 3WHOA 1BU4A 2KF5A 1BNGA 1FZUA 1RGKA 1B20A 1FUSA 3Q3FA 4J5KA 1JBRA 1I0XA 1DE3A 1BRSA 1RGGA 1RNTA 1BNFA 1BSEA 3DGYA 6GSPA 1HZ1A 1GSPA 2ZA4A 1BSAA 1BUJA 5RNTA 1RLSA 1JBTA 1I2EA 1I8VA 3SYUA 3URPA 1X1XA 1BNJA 4HOHA 1BSBA 3DH2A 2BU4A 1CH0A 1YVSA 1UCLA 2C4BA 1BNRA 3AGNA 4RNTA 1AQZA 1RN1A 1BOXA 2AADA 5HOHA 3AHSA 8RNTA 1B21A 4HAAA 2KF6A 2AAEA 1B2UA 3BIRA 2RBIA 2F5MA 3AGOA 1B27A 7GSPA 4GSPA 1SARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRN L;  1LNI A;  1LOV A;  1PYL A;  3WR2 A;  1BRG A;  1TRQ A;  3D5I A;  1MGR A;  1Q9E A;  1UCI A;  5BIR A;  1BGS A;  1BVI A;  1FUT A;  5BU4 A;  1RDS A;  1AY7 A;  1X1Y A;  1RHL A;  2F56 A;  1YGW A;  1BSC A;  4J5G A;  6RNT A;  1I2G A;  1RGH A;  1BRH A;  2SAR A;  1RNB A;  3AHW A;  1IYY A;  1RGF A;  1I2F A;  2BIR A;  2KF3 A;  1LRA A;  1GMQ A;  1RMS A;  4BIR A;  1BNI A;  1HYF A;  1I70 A;  1GOU A;  1MGW A;  1TTO A;  3D5G A;  1B3S A;  1RCL A;  7RNT A;  1C54 A;  1UCK A;  3HOH A;  1PY3 A;  1X1W A;  1BIR A;  2KAA A;  1LOY A;  1I0V A;  1GOV A;  1BAN A;  3GSP A;  1X1U A;  1GMR A;  1RCK A;  4BU4 A;  1FW7 A;  1BRJ A;  1B2Z A;  1BRK A;  1BRI A;  1RGE A;  1GMP A;  1RGL A;  1B2X A;  9RNT A;  1JBS A;  1RSN A;  1LOW A;  1YNV X;  3D4A A;  1BNS A;  2F5W A;  1RTU A;  1RN4 A;  1BSD A;  1TRP A;  2KF4 A;  1GOY A;  4GHO A;  2GSP A;  1FYS A;  2HOH A;  5GSP A;  1G02 A;  3RNT A;  1RGA A;  3KCH A;  1B2S A;  1DET A;  3BU4 A;  2RNT A;  1B2M A;  1BAO A;  1R4Y A;  1T2H A;  1ZGX A;  1BNE A;  2F4Y A;  3A5E A;  1RGC A;  1A2P A;  1T2I A;  1I3F A;  1I3I A;  1UCJ A;  3WHO A;  1BU4 A;  2KF5 A;  1BNG A;  1FZU A;  1RGK A;  1B20 A;  1FUS A;  3Q3F A;  4J5K A;  1JBR A;  1I0X A;  1DE3 A;  1BRS A;  1RGG A;  1RNT A;  1BNF A;  1BSE A;  3DGY A;  6GSP A;  1HZ1 A;  1GSP A;  2ZA4 A;  1BSA A;  1BUJ A;  5RNT A;  1RLS A;  1JBT A;  1I2E A;  1I8V A;  3SYU A;  3URP A;  1X1X A;  1BNJ A;  4HOH A;  1BSB A;  3DH2 A;  2BU4 A;  1CH0 A;  1YVS A;  1UCL A;  2C4B A;  1BNR A;  3AGN A;  4RNT A;  1AQZ A;  1RN1 A;  1BOX A;  2AAD A;  5HOH A;  3AHS A;  8RNT A;  1B21 A;  4HAA A;  2KF6 A;  2AAE A;  1B2U A;  3BIR A;  2RBI A;  2F5M A;  3AGO A;  1B27 A;  7GSP A;  4GSP A;  1SAR A; 
#chains in the Genus database with same CATH topology
 4WP5 A;  3K7C A;  1A2V A;  1BRG A;  2P38 A;  4HM5 B;  3PYJ A;  1SPU A;  1SJW A;  1AVL A;  1KSI A;  2GU3 A;  5BIR A;  1BGS A;  2F98 A;  1FUT A;  3H3H A;  1DMN A;  3CCJ 3;  1JNQ A;  2BT3 A;  2OCT A;  4LMI A;  1QJG A;  1A67 A;  3NUV A;  1RRH A;  1IVX A;  1MWS A;  3E99 A;  4R9L A;  1YGW A;  3JUM A;  3NBJ A;  4STD A;  4FMA A;  4XBT A;  1E3R A;  3H51 A;  2LQV A;  1GS3 A;  3AHW A;  3K5T A;  1GY5 A;  4KFD A;  4N6V 0;  2CG1 A;  1UDI I;  3V92 A;  2WGQ A;  4NPB A;  5BXQ A;  1I2F A;  2IUJ A;  2UX0 A;  2JQ5 A;  5DRV A;  2P0X A;  4IIA A;  7STD A;  1LRA A;  2W2C A;  3JUO A;  4BL3 A;  1KC8 4;  1OHS A;  4AKY A;  3V99 A;  4N6N B;  2FGT A;  1TTO A;  3D5G A;  1GOU A;  1IDP A;  1VQ7 3;  4GL6 A;  3NV0 B;  2E2V A;  2L4V A;  3HII A;  1VQO 3;  3VSY A;  1IV7 A;  1Q82 4;  2O3O A;  1TFO A;  1IVW A;  1MOL A;  2Z7A A;  3DZL A;  4KFE A;  4N6T A;  4XB5 A;  1GOV A;  5IER A;  1DMM A;  3X41 A;  4CDL A;  1V58 A;  3HK4 A;  1JJ2 2;  1W2Z A;  3I56 3;  4WFO A;  1GMP A;  4EXR A;  3F8H A;  3U1W A;  2K0M A;  3BNB A;  3GWR A;  3T8N A;  2CWT A;  3CPO A;  2BMQ B;  5AIG A;  1JKG B;  1W01 A;  3B4P A;  3PXM A;  1Q40 A;  1RN4 A;  4MMZ B;  1EG9 B;  2KRT A;  2LYX A;  1NJI 4;  1FYS A;  3JVC A;  4O2H A;  4L8O A;  4HZ9 B;  1DET A;  1B2M A;  4MMX B;  4ORL A;  1W6C A;  2CIU A;  5IEP A;  5JPP A;  3BB9 A;  5ELJ A;  1FGT A;  2CW9 A;  1N9E A;  2CFG A;  4XBX A;  1IK3 A;  4J8T A;  1W00 A;  3ER7 A;  1JZD A;  5AEU B;  1EUI C;  1FZU A;  3G0K A;  1NB3 I;  5ELU A;  1B20 A;  1JB2 A;  1ZX2 A;  1LQG C;  3OWU A;  5EQL A;  2MC8 A;  2KCD A;  3T0U A;  3Q1C A;  1K8A 4;  5IEN A;  1M90 4;  3K9M C;  5KP1 A;  3WA3 A;  1IT8 A;  3LOY A;  3LZA A;  2F99 A;  1W2B 2;  1JB5 A;  3SYU A;  1S5A A;  2ZDJ A;  2JDI H;  2XFS A;  3PZW A;  3G71 3;  3OW2 2;  2W0Q A;  3MHE A;  1LXE A;  1CH0 A;  3LTB A;  4MMY B;  3DGL A;  3OV4 A;  1UCL A;  2OOV C;  3EE1 A;  5G2G A;  5JPU A;  2C11 A;  4DKI A;  1AQZ A;  4OVM A;  3EC9 A;  2CFD A;  1T5Y A;  1Q40 B;  3WDG B;  3STD A;  1RN1 A;  1BOX A;  1K28 A;  1W6G A;  5HOH A;  1KQS 2;  2RCD A;  2CWV A;  1IQ8 A;  2UGI A;  2KF6 A;  3AMO B;  2AAE A;  3CMA 3;  2RBI A;  1NO3 A;  1B27 A;  2BHM A;  2E2T A;  1UUW B;  3EX9 A;  3GZR A;  1NB5 I;  1ROA A;  2OQE C;  1RJO A;  4LEH A;  3K63 A;  1WQL B;  1BRN L;  3NM2 A;  3KII A;  1PYL A;  1OHP A;  1ASK A;  1TRQ A;  2QGU A;  2ML5 A;  3DGO A;  4HZB B;  5M1A A;  2IA7 A;  3CCS 3;  1UUV B;  1UCI A;  2R4I A;  5M18 A;  3CCE 3;  1RKY A;  3LT8 A;  4CCV A;  1VQL 3;  3DGN A;  2IY2 A;  1IV9 A;  2CX0 A;  3KKG A;  1X1Y A;  5STD A;  3FSD A;  3MG1 A;  2GEY A;  4Q53 A;  3MWZ A;  8CHO A;  3BND A;  2F56 A;  4O8S A;  5LC6 A;  1BSC A;  1RGH A;  2XSO B;  1UGH I;  2H0I A;  5I97 A;  2W04 A;  3WOE B;  1KWI A;  1SII A;  2QA4 3;  1DVC A;  4KT3 B;  1FGR A;  2INX A;  1HKX A;  1G0T A;  3FH1 A;  1JN5 B;  1NNV A;  1O7N B;  2BIR A;  4BTY A;  4HM4 B;  5IG3 A;  1GMQ A;  1LNH A;  1RMS A;  1N5H A;  2M7O A;  3UL6 A;  3JUP A;  4WYK B;  1BUQ A;  1MGW A;  1OHO A;  2W03 A;  1TU5 A;  1TJD A;  1B3S A;  2O9U X;  1UUG B;  1GY7 A;  4ILF A;  2H0G A;  1JKG A;  1V74 A;  1D6U A;  1GY6 A;  1YJ9 3;  3OXA A;  3EQQ B;  4JRF A;  5CF1 A;  2CC3 A;  3T8U A;  2KAA A;  3S28 A;  2CH9 A;  3CU3 A;  3FF0 A;  3WMD A;  1U5O A;  1W5Z A;  1X1U A;  1W6Y A;  1GMR A;  1FW7 A;  2GBX B;  1B2Z A;  4FMD A;  4FCZ A;  1RGE A;  1YGE A;  1JBS A;  1G96 A;  5EVH A;  1LOW A;  1OCV A;  1W4N A;  1W7C A;  3F9S A;  3LML A;  3PCS A;  1QVF 2;  2HML B;  1JRQ A;  1RTU A;  2HMM B;  1GD3 A;  3UL5 A;  3G4S 3;  2CX1 A;  1OUN A;  2Z6B A;  5DRE A;  3N9H A;  4EV2 A;  2WGO A;  1A90 A;  2Y73 A;  4GHO A;  1SQW A;  2GSP A;  2HOH A;  4KZ1 A;  4HYZ A;  3J7Y d;  3FF2 A;  3OWS A;  1K9M 4;  1CYV A;  1TP6 A;  2CK3 H;  3KCH A;  3CCU 3;  2RNT A;  5CLK A;  5AYS C;  4K1V A;  1NDO B;  3A5E A;  3RGA A;  3A76 A;  3MG3 A;  3PCR A;  3ALA A;  1Y4K A;  2E2U A;  3EN1 B;  4N3V A;  2P0M A;  3CCQ 3;  2D1W A;  1T2I A;  1I3I A;  2PNC A;  3F14 A;  3NQZ A;  2CKF B;  2HMO B;  4IPB A;  3MG2 A;  2W9Q A;  1RGK A;  5G1K A;  4FMC A;  3X3Z A;  1RN7 A;  1WMO A;  1FUS A;  1YIT 3;  3MPH A;  4J5K A;  2H0H A;  5AEW B;  3FG3 A;  2XFT A;  3CC7 3;  3GRD A;  1Q7Y 4;  3DGY A;  4KFF A;  4HM0 B;  4RNY A;  5IG0 A;  3WOD G;  2ZA4 A;  1O7P B;  2BMO B;  2RSX A;  3S5C A;  3SLU A;  5RNT A;  1JBT A;  3NBB A;  1AR0 A;  3AMO A;  3EF8 A;  3D3L A;  4MJD A;  1UW1 A;  2UUG C;  3URP A;  1X1X A;  3PS8 A;  3M8C A;  5FW5 A;  3DY5 A;  1KD1 4;  3DH2 A;  3FKA A;  3ROB A;  1YVS A;  2BO9 B;  1ROV A;  3WOF B;  4N6L A;  1JZO A;  3DXO A;  2MF7 A;  4WWU C;  3QK9 A;  4X2H A;  3Q2P A;  1L5G B;  4RZM A;  8RNT A;  2IUK A;  3X3Y A;  4K1U A;  3KSE D;  3O8Y A;  1OGX A;  2F5W A;  2GU1 A;  1SAR A;  2GEX A;  2W6J H;  1JV2 B;  1VQK 3;  2F86 B;  1LOV A;  5IG4 A;  1OF5 B;  2HMN B;  4LGQ A;  3NBR A;  3WR2 A;  3D5I A;  4R4K A;  1GD4 A;  1JN5 A;  1MGR A;  1Q9E A;  5G1L A;  2R41 A;  3SXX A;  3CCV 3;  2XRX B;  2IYJ A;  5LC7 A;  2XR8 B;  2SBL A;  1BVI A;  2WOH A;  3F7X A;  5AII A;  4O02 B;  5BU4 A;  3ZG0 A;  1K41 A;  4BTW A;  3CCM 3;  4QWT A;  4RBN A;  4WYK A;  3UNL A;  1W02 A;  3DM8 A;  3CC2 3;  6RNT A;  1I2G A;  1UI8 A;  4U13 A;  1BRH A;  1V57 A;  2SAR A;  2CFK A;  3EN8 A;  1RNB A;  2KXG A;  3KSP A;  5TGN A;  3ZFZ A;  5D82 A;  4JF8 A;  3EBY A;  3KFQ C;  1JB4 A;  1FUW A;  5HGR A;  4K61 A;  4ZM8 A;  3G16 A;  1WTH A;  2C10 A;  4PEJ A;  4H61 A;  3CD6 3;  4FCJ A;  1EKM A;  4N6M A;  1BNI A;  1YI2 3;  1HYF A;  3I55 3;  2W56 B;  4MEI A;  2I9W A;  3MSO A;  3S67 A;  1UCK A;  4EC6 A;  1LVN A;  1PY3 A;  3EJV A;  3HZP A;  3D9R A;  3VF1 A;  2W9P A;  3JUQ A;  1CQS A;  4CJN A;  1BIR A;  1LOY A;  4HM6 B;  1I0V A;  1N8Q A;  2D42 A;  4RNZ A;  2PZV A;  1BAN A;  3GSP A;  2GXF A;  3SVA A;  3SOY A;  1NU3 A;  1E97 A;  4GB5 A;  2OQE A;  1C7H A;  1BRJ A;  4LYL B;  1BRI A;  3IMA B;  1ZS7 A;  1VQQ A;  1B2X A;  3DMC A;  3NHX A;  5KP3 A;  9RNT A;  2XF3 A;  1RSN A;  1IQY A;  3BNC A;  4I4K A;  2XH9 A;  1VQ5 3;  5AI1 A;  5D81 A;  1MWR A;  1BSD A;  1RRL A;  2BMR B;  4AEQ A;  3JUN A;  3MKI A;  2CG0 A;  2XSH B;  2STD A;  1NWW A;  2YFL B;  4O3V A;  1G02 A;  3RNT A;  1B2S A;  2P09 A;  5IEO A;  1A2K A;  1R4Y A;  1US1 A;  4XBY A;  4FMB A;  4L8P A;  1ULI B;  2XGL A;  1BNE A;  1N9J A;  5AIF A;  1CYU A;  1OH0 A;  1WNH A;  2OTJ 3;  1A2P A;  3BNE A;  4R80 A;  3F8X A;  1I3F A;  2GBW B;  3EB8 A;  1UCJ A;  1OPY A;  1N5P A;  1BU4 A;  1ULJ B;  3FZW A;  3FG1 A;  5CK6 A;  5D83 A;  3LTA A;  3QRD A;  1BNG A;  3SX1 A;  1E3V A;  1PFP A;  1OGZ A;  3OX9 A;  2V1L A;  3Q3F A;  1CEW I;  2Z76 A;  2CHC A;  1JBR A;  1IU7 A;  1DE3 A;  1BRS A;  1RNT A;  1FGO A;  1HZ1 A;  3SOA A;  1BSA A;  3I0Y A;  3CC4 3;  1IVV A;  1S72 3;  1RLS A;  3X42 A;  1I2E A;  2YFI B;  5A0O B;  4HM2 B;  1LQM B;  2QIY A;  1MNL A;  1O7H B;  1QMA A;  2XEP A;  3B7C A;  3GZB A;  3X40 A;  2ML6 A;  3F40 A;  4HBR A;  3KE7 A;  1OF5 A;  3AGN A;  4RNT A;  3D79 A;  4KVH A;  3CME 3;  1MWU A;  4L7K A;  3V98 A;  3FCS B;  4HKV B;  4H3U A;  5AYR B;  3U97 A;  4FR9 A;  1UGI A;  4WHA A;  1VQM 3;  2AAD A;  3AHS A;  3DGM A;  1B21 A;  3CCR 3;  3EBT A;  3Q90 A;  1Q7H A;  2YFJ B;  1O7G B;  2F5M A;  3NM7 A;  3AGO A;  5EEO A;  3X3X A;  1WMP A;  7GSP A;  4LSO A;  2K3D A;  3CNX A;  1EA2 A;  3BU4 A;  3GAX A;  1FA3 A;  2HMJ B;  1YJW 3;  4HM7 B;  1D6Z A;  1LNI A;  1R4C A;  2OWP A;  3ECF A;  4N6O B;  2B1X B;  1J2B A;  1VQ6 3;  1F8N A;  3FG4 A;  3EHC A;  1VZZ A;  4XM4 A;  1U8C B;  3IJE B;  4HM3 B;  1DMQ A;  1RDS A;  1AY7 A;  3G6E 3;  3UB1 A;  3G8Z A;  4R9K A;  1RHL A;  2CWU A;  2W56 A;  1EQK A;  1SIH A;  4J5G A;  1QAK A;  1IVU A;  1IYY A;  3LYG A;  1RGF A;  1IT7 A;  2CFL A;  3RGR A;  3DUK A;  3CXC 2;  1YIJ 3;  1TFK A;  2KF3 A;  4EV5 A;  2P05 A;  2Z77 A;  4J9A A;  3GZX B;  1Q42 A;  4EBG A;  4BIR A;  1VQ4 3;  4OUQ A;  1I70 A;  1VQ8 3;  4CPK A;  1Q81 4;  4R1K A;  1RCL A;  5IG5 A;  1C54 A;  2ZHX B;  3HOH A;  4XDW A;  4AKZ A;  2XGN A;  2WOF A;  5AIH A;  1X1W A;  1PU4 A;  4N6U A;  1MWT A;  3VGN A;  4HM1 B;  1YVB I;  4G1M B;  4EYC A;  1FGM A;  4HJL B;  1RCK A;  4BU4 A;  3N54 B;  1BRK A;  2Q07 A;  1RGL A;  1UI7 A;  3LT9 A;  3CPW 2;  1YNV X;  2BNG A;  3D4A A;  1ZO2 A;  2L1S A;  2RGQ A;  3KZT A;  1BNS A;  1Q86 4;  1QVG 2;  2J8X B;  2K54 A;  3WA2 X;  2YX9 A;  3CCL 3;  1M1K 4;  1TRP A;  2KF4 A;  1GOY A;  1VQ9 3;  3OWY A;  1GYB A;  2Y74 A;  3TDG A;  1VQP 3;  2OTL 3;  1TUH A;  5GSP A;  2OOV A;  6STD A;  1RGA A;  1STF I;  2RFR A;  3CNM A;  2WO0 A;  5IW9 A;  1BAO A;  4HM8 B;  1HU9 A;  1Z1S A;  1T2H A;  1K73 4;  1DVD A;  1ZGX A;  3L0R A;  2F4Y A;  3LH4 A;  1RGC A;  4FCM A;  4XDV A;  3LXU X;  1QAF A;  1O7W B;  3WHO A;  2KF5 A;  5BVB A;  1LOX A;  3ZG5 A;  2FXT A;  1DYU A;  2IMJ A;  4LZI A;  3LTD A;  1I0X A;  3S29 A;  2CFW A;  1RGG A;  3B8L A;  3IPT A;  1QAL A;  1BNF A;  4IT7 A;  1N8R 4;  1BSE A;  3K0Z A;  5KP4 A;  3PGB A;  6GSP A;  1GSP A;  3NXJ A;  1BUJ A;  1I8V A;  1OAC A;  3N8B A;  3UJM A;  5M19 A;  3HIG A;  2HMK B;  1O7M B;  1EEJ A;  1WMN A;  3HI7 A;  5IF6 A;  1ISK A;  2B24 B;  1IQX A;  1AV4 A;  1BNJ A;  1BSB A;  1M1X B;  3GZY B;  4HOH A;  4TX4 A;  1T3B A;  2FNQ A;  3BLZ A;  3FGY A;  2BU4 A;  4OK0 A;  3RDE A;  3LTC A;  1AVK A;  2C4B A;  1BNR A;  3NV0 A;  3HX8 A;  4NRE A;  5CXO A;  2A15 A;  4I5Q A;  3KN4 A;  1YHQ 3;  4BL2 A;  2QEX 3;  3NQY A;  2ZL8 A;  5FGO A;  1TIJ A;  5JBS A;  1VQN 3;  3SED A;  4EW5 A;  5CF2 A;  4NHF A;  4HVN A;  3B4O A;  4HAA A;  3F7S A;  4X2O A;  4BTX A;  1YJN 3;  1D6Y A;  3NX0 A;  4K90 B;  1B2U A;  1STD A;  3BIR A;  3FLJ A;  3MYT A;  1FGQ A;  1M9G A;  7RNT A;  4GSP A;  3S27 A; 
#chains in the Genus database with same CATH homology
 1BRN L;  1LNI A;  1LOV A;  1PYL A;  3WR2 A;  1BRG A;  1TRQ A;  3D5I A;  1MGR A;  1Q9E A;  1UCI A;  5BIR A;  1BGS A;  1BVI A;  1FUT A;  5BU4 A;  1RDS A;  1AY7 A;  1X1Y A;  1RHL A;  2F56 A;  1YGW A;  1BSC A;  4J5G A;  6RNT A;  1I2G A;  1RGH A;  1BRH A;  2SAR A;  1RNB A;  3AHW A;  1IYY A;  1RGF A;  1I2F A;  2BIR A;  2KF3 A;  1LRA A;  1GMQ A;  1RMS A;  4BIR A;  1BNI A;  1HYF A;  1I70 A;  1GOU A;  1MGW A;  1TTO A;  3D5G A;  1B3S A;  1RCL A;  7RNT A;  1C54 A;  1UCK A;  3HOH A;  1PY3 A;  1X1W A;  1BIR A;  2KAA A;  1LOY A;  1I0V A;  1GOV A;  1BAN A;  3GSP A;  1X1U A;  1GMR A;  1RCK A;  4BU4 A;  1FW7 A;  1BRJ A;  1B2Z A;  1BRK A;  1BRI A;  1RGE A;  1GMP A;  1RGL A;  1B2X A;  9RNT A;  1JBS A;  1RSN A;  1LOW A;  1YNV X;  3D4A A;  1BNS A;  2F5W A;  1RTU A;  1RN4 A;  1BSD A;  1TRP A;  2KF4 A;  1GOY A;  4GHO A;  2GSP A;  1FYS A;  2HOH A;  5GSP A;  1G02 A;  3RNT A;  1RGA A;  3KCH A;  1B2S A;  1DET A;  3BU4 A;  2RNT A;  1B2M A;  1BAO A;  1R4Y A;  1T2H A;  1ZGX A;  1BNE A;  2F4Y A;  3A5E A;  1RGC A;  1A2P A;  1T2I A;  1I3F A;  1I3I A;  1UCJ A;  3WHO A;  1BU4 A;  2KF5 A;  1BNG A;  1FZU A;  1RGK A;  1B20 A;  1FUS A;  3Q3F A;  4J5K A;  1JBR A;  1I0X A;  1DE3 A;  1BRS A;  1RGG A;  1RNT A;  1BNF A;  1BSE A;  3DGY A;  6GSP A;  1HZ1 A;  1GSP A;  2ZA4 A;  1BSA A;  1BUJ A;  5RNT A;  1RLS A;  1JBT A;  1I2E A;  1I8V A;  3SYU A;  3URP A;  1X1X A;  1BNJ A;  4HOH A;  1BSB A;  3DH2 A;  2BU4 A;  1CH0 A;  1YVS A;  1UCL A;  2C4B A;  1BNR A;  3AGN A;  4RNT A;  1AQZ A;  1RN1 A;  1BOX A;  2AAD A;  5HOH A;  3AHS A;  8RNT A;  1B21 A;  4HAA A;  2KF6 A;  2AAE A;  1B2U A;  3BIR A;  2RBI A;  2F5M A;  3AGO A;  1B27 A;  7GSP A;  4GSP A;  1SAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...