1FZUA

Rnase t1 v78a mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRAVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1fzuA00
3SYUA 1RGFA 1SARA 2KF4A 3WR2A 1AQZA 1X1YA 1TRPA 1BOXA 2KF6A 1BANA 3AGNA 1JBRA 1BRIA 1T2IA 1RHLA 1RTUA 1LRAA 4HAAA 1LOVA 1B2ZA 7GSPA 1BSDA 1BNJA 1RGAA 1LOWA 3BU4A 3DH2A 1GOYA 1X1WA 3KCHA 1PY3A 1BNIA 2SARA 1AY7A 1BNEA 2RNTA 1LOYA 1MGWA 1FZUA 1G02A 3D4AA 1RN1A 2F5MA 1B2UA 2KF5A 1JBSA 1BNRA 1FW7A 2F56A 1TTOA 1UCIA 1GMQA 1I70A 1BAOA 1BU4A 1DETA 5BU4A 1B2MA 1YGWA 1RLSA 3Q3FA 1DE3A 3RNTA 1BVIA 1Q9EA 1HYFA 1B3SA 1BRJA 1RGCA 3A5EA 1RMSA 3AGOA 1FUSA 2GSPA 1I0XA 1YVSA 3GSPA 1BNGA 1RDSA 3BIRA 5BIRA 1GOVA 1HZ1A 1GMPA 1RGEA 1BSEA 1RSNA 1A2PA 1BSBA 2KAAA 1X1XA 6RNTA 1B20A 2HOHA 1GOUA 1TRQA 3AHSA 4GSPA 3WHOA 1RCLA 2F4YA 1I0VA 1RGKA 1IYYA 1JBTA 1I3IA 4RNTA 5GSPA 1YNVX 1UCKA 1PYLA 1B2XA 1ZGXA 1CH0A 1FYSA 2BU4A 2F5WA 4BIRA 1I2EA 2RBIA 2ZA4A 3AHWA 1RGHA 4J5KA 4BU4A 1I2GA 1BRHA 1BRNL 2BIRA 1BSCA 8RNTA 1LNIA 1BRKA 1RGLA 7RNTA 5HOHA 1BRGA 1I3FA 1GSPA 3URPA 1RN4A 3HOHA 4HOHA 1RNBA 1BGSA 1UCLA 1B21A 2AAEA 1BRSA 4GHOA 1R4YA 3D5IA 3D5GA 2C4BA 1B2SA 1X1UA 1BIRA 1I2FA 1RNTA 1RCKA 9RNTA 1BNSA 1C54A 1T2HA 2KF3A 4J5GA 5RNTA 1MGRA 6GSPA 1BUJA 2AADA 1RGGA 1GMRA 1B27A 1FUTA 1UCJA 1BSAA 3DGYA 1I8VA 1BNFA
chains in the Genus database with same CATH superfamily
1YIJ3 4K61A 1GD3A 3WA2X 4LEHA 1J2BA 3ER7A 4DKIA 1W2B2 3GWRA 2KF6A 3Q1CA 4X2OA 3PCSA 2LQVA 4XDWA 3X3XA 3JUNA 3AGNA 1Q7HA 1T2IA 4I4KA 1LOVA 1B2ZA 3HIGA 2BHMA 1RGAA 2I9WA 3LYGA 2HMLB 3DH2A 1IU7A 2OQEC 5D81A 3ZFZA 3LZAA 4O8SA 1A2VA 4CDLA 1JV2B 1AY7A 3B7CA 1JB2A 2CWVA 2V1LA 3EJVA 4WYKB 1RN7A 1MGWA 2GEYA 2WO0A 2WOHA 3DXOA 4K1VA 2CG1A 3RDEA 1O7PB 2F5MA 1B2UA 3PYJA 5IG4A 1W6GA 3FF0A 3T8UA 3MWZA 3N8BA 3H51A 3K63A 1YJ93 1UUVB 3VGNA 2C10A 1OF5B 3CCV3 1KSIA 1DETA 5BU4A 3J7Yd 1B2MA 4WFOA 3WOEB 1Q864 2RFRA 4HM1B 5CXOA 3M8CA 2UUGC 4L8PA 1Q9EA 4MMXB 3K0ZA 1BRJA 3V98A 1RGCA 4ORLA 5KP1A 5IW9A 2KCDA 5G1KA 3KKGA 2F98A 3MSOA 1FGQA 3NBJA 1CQSA 2CFGA 5FGOA 4STDA 3L0RA 3CCE3 3UJMA 3X3ZA 1ASKA 1RGEA 1RSNA 1OACA 4KFEA 1RRHA 1X1XA 2HOHA 3AHSA 4LZIA 3JUQA 1RGKA 1TUHA 4KZ1A 3CCU3 4RNTA 2XFSA 2CFLA 1YNVX 3LTAA 1V74A 2D42A 1UI7A 3OX9A 4I5QA 2BU4A 1E3VA 2RGQA 4AEQA 4EW5A 2OTL3 1SIHA 5IEPA 1EEJA 2RBIA 2XSOB 4H3UA 4HYZA 1N5HA 3AHWA 1EA2A 1LVNA 3I563 3CC73 2XEPA 4J5KA 1JN5A 1CYVA 1LQMB 2ML5A 3STDA 4BU4A 4EXRA 1VQP3 1BRNL 3EN8A 1BSCA 1UDII 2Q07A 3DY5A 3G8ZA 2OCTA 1BRKA 4HM8B 3GZBA 4XM4A 5DRVA 3F8XA 3OV4A 1I3FA 2R41A 1Q40A 4J9AA 2CK3H 3CCR3 3BNEA 3X3YA 4HM6B 3HOHA 4R80A 1YVBI 4RBNA 2W56B 3OWSA 2XR8B 1DVCA 4O02B 1ZS7A 3UB1A 4MMYB 2STDA 2CWTA 4WP5A 2CWUA 3D5GA 3ZG0A 1B2SA 4BTXA 1X1UA 2H0GA 5D83A 4IPBA 3K5TA 1MWSA 1RNTA 1IK3A 1RCKA 2W9QA 1NJI4 9RNTA 2KF3A 3AMOB 4FMDA 1DYUA 1ROAA 3SLUA 1LNHA 3X41A 6GSPA 1BUQA 5LC6A 1OHSA 1RGGA 1MWTA 4R9KA 4HZ9B 3T0UA 1UCJA 6STDA 3NM7A 3ZG5A 3GAXA 5A0OB 1I8VA 3BNDA 1W01A 1IV9A 2KF4A 2PZVA 2YX9A 3WR2A 2L4VA 1N8QA 3MKIA 1OGZA 4LYLB 1TRPA 2OQEA 1ULJB 3BNCA 1YIT3 3EHCA 1UGIA 1US1A 1NU3A 5BVBA 2PNCA 3DUKA 4FCZA 2OWPA 3CPW2 1JBRA 1RHLA 4N3VA 1LRAA 3A76A 4IT7A 4FMAA 3LTDA 2XSHB 2SBLA 1W00A 2CHCA 3G713 4EBGA 1GOYA 1YJN3 3FGYA 3FCSB 3FG1A 4O2HA 4LSOA 2MC8A 1CYUA 1DMNA 2QIYA 1BNEA 4R9LA 2RNTA 1LOYA 3N9HA 3LXUX 3V99A 3WODG 4XB5A 5AIIA 1FZUA 2IYJA 3D4AA 2O3OA 1BNRA 3F14A 2Y74A 4GB5A 1W6CA 2CH9A 2XGLA 1K41A 1I70A 2C11A 1KWIA 1UW1A 5BXQA 1PFPA 3KN4A 1WMNA 3SVAA 4CJNA 1PU4A 1LQGC 3B4OA 5DREA 1HU9A 3WOFB 3Q3FA 4MJDA 1D6YA 2KXGA 3HIIA 1DE3A 3I553 3G6E3 1M1XB 2XFTA 3CPOA 3F9SA 1STFI 3FLJA 1T3BA 1WMPA 3CMA3 1FUSA 2R4IA 2CFDA 1YVSA 2CFWA 1N9JA 3GSPA 1K8A4 1JKGA 4HKVB 1BNGA 3IMAB 1IVWA 3OW22 5BIRA 4IIAA 1IDPA 4MEIA 4BL3A 1GOVA 1HZ1A 4OVMA 1GS3A 2XRXB 3CME3 1S723 1Q7Y4 1A90A 1GY6A 4FMBA 5IEOA 1Z1SA 3LMLA 1BSBA 2OTJ3 2YFIB 1B20A 1JZOA 1GOUA 1TRQA 1WNHA 4GSPA 3WHOA 3CXC2 3DGLA 1I0VA 3NV0B 3F40A 3B4PA 5GSPA 1W6YA 2P09A 1UCKA 2W0QA 7STDA 1W02A 3F7SA 1O7WB 4HBRA 3CCL3 1VQL3 1EQKA 5IG5A 1Q824 3Q90A 1RGHA 4U13A 1BRHA 3NHXA 4R1KA 1T5YA 2GBWB 3N54B 3OWUA 4LMIA 1JB4A 4HVNA 3ROBA 1K28A 4NHFA 1LXEA 2GXFA 4N6UA 5AI1A 7RNTA 5HOHA 3K9MC 4JF8A 3UL6A 5CF1A 3NM2A 2QGUA 3OXAA 2P0MA 5JPPA 3LT8A 4XBXA 2Y73A 5I97A 5LC7A 2W9PA 3UL5A 1U8CB 4N6OB 1FA3A 1JNQA 1SIIA 3HZPA 2Z7AA 3CNMA 1MWUA 5STDA 4FMCA 1A67A 1O7MB 3X40A 2CG0A 5AEWB 2C4BA 1N5PA 5KP4A 1DMMA 1I2FA 2IA7A 3VSYA 1N8R4 2UGIA 1BNSA 3MHEA 1VQN3 4NPBA 3EE1A 4J5GA 1MGRA 1OH0A 1ULIB 3I0YA 2INXA 1FGTA 5EQLA 1ISKA 1BAOA 3FG3A 1RGFA 4LGQA 1AQZA 1AVLA 1QALA 3EN1B 3NX0A 2Z6BA 2BMRB 1W7CA 2BO9B 4RZMA 1QAFA 2H0HA 1BOXA 5CK6A 4J8TA 2F86B 3FSDA 5M18A 2XH9A 1BRIA 3S5CA 2QEX3 4HAAA 7GSPA 5TGNA 5IENA 1QAKA 2W04A 1LOWA 4WYKA 2WOFA 3KCHA 4WHAA 1GYBA 2F99A 3V92A 2YFJB 5D82A 3CD63 4HJLB 1WTHA 3FZWA 1D6UA 1TJDA 2E2TA 2ML6A 4FR9A 5EVHA 1G02A 3D9RA 1RN1A 1M9GA 3JUPA 1OF5A 2JDIH 3KIIA 3LT9A 1WQLB 1D6ZA 3CCQ3 2F56A 4K1UA 4HM3B 3CC43 2FXTA 1UCIA 1GMQA 3MG1A 5AIHA 4L8OA 1NDOB 4O3VA 1VQ63 3EQQB 4FCJA 1RKYA 1QVG2 1E3RA 3UNLA 3JUOA 3G0KA 1VQM3 1KD14 3S67A 1YGWA 1VQ83 1RLSA 3FKAA 4L7KA 1BVIA 1HYFA 1V58A 5EEOA 1B3SA 3GRDA 1IVVA 4HZBB 1CEWI 1ROVA 1RMSA 3DGMA 2GSPA 1I0XA 3KZTA 2HMJB 4OUQA 1M904 2J8XB 1E97A 1K9M4 2RCDA 3BIRA 2CX1A 2K54A 2ZL8A 5IERA 4N6V0 1TP6A 2E2UA 1QVF2 1GMPA 2W2CA 4JRFA 1IQ8A 1W5ZA 4K90B 3OWYA 4N6LA 6RNTA 1OPYA 1TFOA 2KAAA 1IVUA 3GZRA 2CKFB 1JBTA 3D79A 1RCLA 2F4YA 3JUMA 2BNGA 1A2KA 1JRQA 1O7HB 1QMAA 1I3IA 1VQQA 2CIUA 1S5AA 1ZGXA 1B2XA 1CH0A 1FYSA 1FGRA 2F5WA 2XGNA 4BIRA 3KE7A 4BTWA 2ZA4A 2W6JH 3MG2A 5IG0A 4AKYA 5JPUA 3G4S3 3MG3A 3FF2A 1M1K4 2BIRA 2RSXA 8RNTA 1RGLA 1MOLA 1JN5B 3SXXA 1FGOA 4EC6A 2HMKB 1VZZA 1UI8A 2GU1A 1BRGA 1DVDA 2B24B 1VQ93 2P38A 3S29A 3NUVA 2W56A 3URPA 1RN4A 3WA3A 5G1LA 1OHPA 3HI7A 1NB5I 2Z77A 4HOHA 1SJWA 1Q40B 1UCLA 4KFFA 2HMNB 2W03A 3HX8A 5AIFA 2E2VA 4OK0A 1WMOA 2AAEA 2O9UX 3E99A 1GY7A 2B1XB 3GZXB 3DM8A 3LOYA 4XBYA 5AIGA 4HM7B 3CCM3 5CF2A 3D5IA 3KSPA 3DGNA 4AKZA 1KC84 2Z76A 3AMOA 1GD4A 4PEJA 2BMOB 4N6TA 4Q53A 2H0IA 8CHOA 1QJGA 2D1WA 2YFLB 1NO3A 3B8LA 4X2HA 1T2HA 4QWTA 5IG3A 2A15A 2LYXA 1W2ZA 4CPKA 1BUJA 1TFKA 5HGRA 1SQWA 1VQ43 1STDA 3QK9A 3SX1A 2GBXB 2ZHXB 3DGYA 1UGHI 1GY5A 1IV7A 1Q42A 1BNFA 3EBYA 3LTBA 3NQZA 4HM0B 2FGTA 4MMZB 1SARA 3SYUA 1EKMA 1X1YA 1NWWA 1VQO3 3IJEB 1F8NA 3O8YA 1BANA 3EBTA 3CU3A 4ZM8A 4KVHA 3JVCA 3EF8A 2OOVC 5ELUA 3F7XA 1V57A 3BNBA 1RTUA 4EYCA 5M19A 2QA43 1BSDA 1BNJA 1AVKA 1SPUA 3BU4A 1FUWA 5JBSA 1X1WA 1ZX2A 1PY3A 5KP3A 3SEDA 1BNIA 2SARA 1UUGB 5IF6A 1C7HA 1K734 5FW5A 2WGOA 1LOXA 3GZYB 2KF5A 3NQYA 3EX9A 1FW7A 4ILFA 5G2GA 2IUJA 1AV4A 2ZDJA 1TTOA 2HMOB 3T8NA 2CX0A 4N6NB 3CC23 3WDGB 3LTCA 4N6MA 1BU4A 1ZO2A 2KRTA 2XF3A 4FCMA 1YJW3 1RRLA 1TU5A 3EC9A 3U1WA 2UX0A 3PZWA 3MYTA 3RNTA 4HM5B 1IT8A 4GL6A 3U97A 4HM2B 2BMQB 3A5EA 3AGOA 3G16A 1RJOA 3K7CA 1Y4KA 1IQYA 3ALAA 3PGBA 1JB5A 4WWUC 2FNQA 1RDSA 4HM4B 3S28A 2WGQA 3SOAA 1DMQA 4RNYA 1YGEA 5AYSC 1W4NA 2P0XA 1JKGB 2IUKA 3MPHA 1BSEA 3NV0A 3NBBA 1JZDA 1FGMA 1O7NB 3SOYA 1VQ73 2CW9A 1A2PA 1JJ22 2GEXA 3PS8A 3BB9A 1JBSA 1NB3I 1R4CA 2K0MA 1IYYA 1PYLA 3D3LA 2CC3A 4XDVA 1I2EA 1AR0A 1N9EA 1O7GB 4R4KA 4BL2A 3VF1A 3NXJA 3DGOA 2GU3A 3IPTA 3KFQC 1I2GA 2MF7A 5M1AA 3HK4A 3RGRA 3WMDA 3DZLA 1OGXA 4NREA 4EV5A 3DMCA 4KFDA 3H3HA 1LNIA 3NBRA 1IQXA 1G0TA 3PXMA 1KQS2 1VQK3 2IMJA 1IVXA 1U5OA 1IT7A 1GSPA 4KT3B 2L1SA 4BTYA 1G96A 3BLZA 4TX4A 3PCRA 2BT3A 2IY2A 3FH1A 1HKXA 1NNVA 1EG9B 4EV2A 1VQ53 3F8HA 3TDGA 3CCS3 1BGSA 1RNBA 1B21A 3QRDA 3Q2PA 1UUWB 1OUNA 4G1MB 2CFKA 3S27A 2K3DA 1BRSA 3LH4A 4GHOA 1R4YA 3X42A 3EB8A 1BIRA 1Q814 3FG4A 2P05A 5ELJA 2M7OA 5AEUB 5AYRB 3RGAA 1EUIC 3CNXA 1YHQ3 1C54A 4CCVA 2HMMB 3ECFA 5RNTA 4XBTA 3KSED 1L5GB 5CLKA 3CCJ3 2AADA 4H61A 1OCVA 1TIJA 1MWRA 1GMRA 1B27A 1FUTA 1MNLA 4RNZA 2OOVA 1BSAA 1OHOA 2JQ5A 1YI23
chains in the Genus database with same CATH topology
3SYUA 1RGFA 1SARA 2KF4A 3WR2A 1AQZA 1X1YA 1TRPA 1BOXA 2KF6A 1BANA 3AGNA 1JBRA 1BRIA 1T2IA 1RHLA 1RTUA 1LRAA 4HAAA 1LOVA 1B2ZA 7GSPA 1BSDA 1BNJA 1RGAA 1LOWA 3BU4A 3DH2A 1GOYA 1X1WA 3KCHA 1PY3A 1BNIA 2SARA 1AY7A 1BNEA 2RNTA 1LOYA 1MGWA 1FZUA 1G02A 3D4AA 1RN1A 2F5MA 1B2UA 2KF5A 1JBSA 1BNRA 1FW7A 2F56A 1TTOA 1UCIA 1GMQA 1I70A 1BAOA 1BU4A 1DETA 5BU4A 1B2MA 1YGWA 1RLSA 3Q3FA 1DE3A 3RNTA 1BVIA 1Q9EA 1HYFA 1B3SA 1BRJA 1RGCA 3A5EA 1RMSA 3AGOA 1FUSA 2GSPA 1I0XA 1YVSA 3GSPA 1BNGA 1RDSA 3BIRA 5BIRA 1GOVA 1HZ1A 1GMPA 1RGEA 1BSEA 1RSNA 1A2PA 1BSBA 2KAAA 1X1XA 6RNTA 1B20A 2HOHA 1GOUA 1TRQA 3AHSA 4GSPA 3WHOA 1RCLA 2F4YA 1I0VA 1RGKA 1IYYA 1JBTA 1I3IA 4RNTA 5GSPA 1YNVX 1UCKA 1PYLA 1B2XA 1ZGXA 1CH0A 1FYSA 2BU4A 2F5WA 4BIRA 1I2EA 2RBIA 2ZA4A 3AHWA 1RGHA 4J5KA 4BU4A 1I2GA 1BRHA 1BRNL 2BIRA 1BSCA 8RNTA 1LNIA 1BRKA 1RGLA 7RNTA 5HOHA 1BRGA 1I3FA 1GSPA 3URPA 1RN4A 3HOHA 4HOHA 1RNBA 1BGSA 1UCLA 1B21A 2AAEA 1BRSA 4GHOA 1R4YA 3D5IA 3D5GA 2C4BA 1B2SA 1X1UA 1BIRA 1I2FA 1RNTA 1RCKA 9RNTA 1BNSA 1C54A 1T2HA 2KF3A 4J5GA 5RNTA 1MGRA 6GSPA 1BUJA 2AADA 1RGGA 1GMRA 1B27A 1FUTA 1UCJA 1BSAA 3DGYA 1I8VA 1BNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYU A;  1RGF A;  1SAR A;  2KF4 A;  3WR2 A;  1AQZ A;  1X1Y A;  1TRP A;  1BOX A;  2KF6 A;  1BAN A;  3AGN A;  1JBR A;  1BRI A;  1T2I A;  1RHL A;  1RTU A;  1LRA A;  4HAA A;  1LOV A;  1B2Z A;  7GSP A;  1BSD A;  1BNJ A;  1RGA A;  1LOW A;  3BU4 A;  3DH2 A;  1GOY A;  1X1W A;  3KCH A;  1PY3 A;  1BNI A;  2SAR A;  1AY7 A;  1BNE A;  2RNT A;  1LOY A;  1MGW A;  1FZU A;  1G02 A;  3D4A A;  1RN1 A;  2F5M A;  1B2U A;  2KF5 A;  1JBS A;  1BNR A;  1FW7 A;  2F56 A;  1TTO A;  1UCI A;  1GMQ A;  1I70 A;  1BAO A;  1BU4 A;  1DET A;  5BU4 A;  1B2M A;  1YGW A;  1RLS A;  3Q3F A;  1DE3 A;  3RNT A;  1BVI A;  1Q9E A;  1HYF A;  1B3S A;  1BRJ A;  1RGC A;  3A5E A;  1RMS A;  3AGO A;  1FUS A;  2GSP A;  1I0X A;  1YVS A;  3GSP A;  1BNG A;  1RDS A;  3BIR A;  5BIR A;  1GOV A;  1HZ1 A;  1GMP A;  1RGE A;  1BSE A;  1RSN A;  1A2P A;  1BSB A;  2KAA A;  1X1X A;  6RNT A;  1B20 A;  2HOH A;  1GOU A;  1TRQ A;  3AHS A;  4GSP A;  3WHO A;  1RCL A;  2F4Y A;  1I0V A;  1RGK A;  1IYY A;  1JBT A;  1I3I A;  4RNT A;  5GSP A;  1YNV X;  1UCK A;  1PYL A;  1B2X A;  1ZGX A;  1CH0 A;  1FYS A;  2BU4 A;  2F5W A;  4BIR A;  1I2E A;  2RBI A;  2ZA4 A;  3AHW A;  1RGH A;  4J5K A;  4BU4 A;  1I2G A;  1BRH A;  1BRN L;  2BIR A;  1BSC A;  8RNT A;  1LNI A;  1BRK A;  1RGL A;  7RNT A;  5HOH A;  1BRG A;  1I3F A;  1GSP A;  3URP A;  1RN4 A;  3HOH A;  4HOH A;  1RNB A;  1BGS A;  1UCL A;  1B21 A;  2AAE A;  1BRS A;  4GHO A;  1R4Y A;  3D5I A;  3D5G A;  2C4B A;  1B2S A;  1X1U A;  1BIR A;  1I2F A;  1RNT A;  1RCK A;  9RNT A;  1BNS A;  1C54 A;  1T2H A;  2KF3 A;  4J5G A;  5RNT A;  1MGR A;  6GSP A;  1BUJ A;  2AAD A;  1RGG A;  1GMR A;  1B27 A;  1FUT A;  1UCJ A;  1BSA A;  3DGY A;  1I8V A;  1BNF A; 
#chains in the Genus database with same CATH topology
 1YIJ 3;  4K61 A;  1GD3 A;  3WA2 X;  4LEH A;  1J2B A;  3ER7 A;  4DKI A;  1W2B 2;  3GWR A;  2KF6 A;  3Q1C A;  4X2O A;  3PCS A;  2LQV A;  4XDW A;  3X3X A;  3JUN A;  3AGN A;  1Q7H A;  1T2I A;  4I4K A;  1LOV A;  1B2Z A;  3HIG A;  2BHM A;  1RGA A;  2I9W A;  3LYG A;  2HML B;  3DH2 A;  1IU7 A;  2OQE C;  5D81 A;  3ZFZ A;  3LZA A;  4O8S A;  1A2V A;  4CDL A;  1JV2 B;  1AY7 A;  3B7C A;  1JB2 A;  2CWV A;  2V1L A;  3EJV A;  4WYK B;  1RN7 A;  1MGW A;  2GEY A;  2WO0 A;  2WOH A;  3DXO A;  4K1V A;  2CG1 A;  3RDE A;  1O7P B;  2F5M A;  1B2U A;  3PYJ A;  5IG4 A;  1W6G A;  3FF0 A;  3T8U A;  3MWZ A;  3N8B A;  3H51 A;  3K63 A;  1YJ9 3;  1UUV B;  3VGN A;  2C10 A;  1OF5 B;  3CCV 3;  1KSI A;  1DET A;  5BU4 A;  3J7Y d;  1B2M A;  4WFO A;  3WOE B;  1Q86 4;  2RFR A;  4HM1 B;  5CXO A;  3M8C A;  2UUG C;  4L8P A;  1Q9E A;  4MMX B;  3K0Z A;  1BRJ A;  3V98 A;  1RGC A;  4ORL A;  5KP1 A;  5IW9 A;  2KCD A;  5G1K A;  3KKG A;  2F98 A;  3MSO A;  1FGQ A;  3NBJ A;  1CQS A;  2CFG A;  5FGO A;  4STD A;  3L0R A;  3CCE 3;  3UJM A;  3X3Z A;  1ASK A;  1RGE A;  1RSN A;  1OAC A;  4KFE A;  1RRH A;  1X1X A;  2HOH A;  3AHS A;  4LZI A;  3JUQ A;  1RGK A;  1TUH A;  4KZ1 A;  3CCU 3;  4RNT A;  2XFS A;  2CFL A;  1YNV X;  3LTA A;  1V74 A;  2D42 A;  1UI7 A;  3OX9 A;  4I5Q A;  2BU4 A;  1E3V A;  2RGQ A;  4AEQ A;  4EW5 A;  2OTL 3;  1SIH A;  5IEP A;  1EEJ A;  2RBI A;  2XSO B;  4H3U A;  4HYZ A;  1N5H A;  3AHW A;  1EA2 A;  1LVN A;  3I56 3;  3CC7 3;  2XEP A;  4J5K A;  1JN5 A;  1CYV A;  1LQM B;  2ML5 A;  3STD A;  4BU4 A;  4EXR A;  1VQP 3;  1BRN L;  3EN8 A;  1BSC A;  1UDI I;  2Q07 A;  3DY5 A;  3G8Z A;  2OCT A;  1BRK A;  4HM8 B;  3GZB A;  4XM4 A;  5DRV A;  3F8X A;  3OV4 A;  1I3F A;  2R41 A;  1Q40 A;  4J9A A;  2CK3 H;  3CCR 3;  3BNE A;  3X3Y A;  4HM6 B;  3HOH A;  4R80 A;  1YVB I;  4RBN A;  2W56 B;  3OWS A;  2XR8 B;  1DVC A;  4O02 B;  1ZS7 A;  3UB1 A;  4MMY B;  2STD A;  2CWT A;  4WP5 A;  2CWU A;  3D5G A;  3ZG0 A;  1B2S A;  4BTX A;  1X1U A;  2H0G A;  5D83 A;  4IPB A;  3K5T A;  1MWS A;  1RNT A;  1IK3 A;  1RCK A;  2W9Q A;  1NJI 4;  9RNT A;  2KF3 A;  3AMO B;  4FMD A;  1DYU A;  1ROA A;  3SLU A;  1LNH A;  3X41 A;  6GSP A;  1BUQ A;  5LC6 A;  1OHS A;  1RGG A;  1MWT A;  4R9K A;  4HZ9 B;  3T0U A;  1UCJ A;  6STD A;  3NM7 A;  3ZG5 A;  3GAX A;  5A0O B;  1I8V A;  3BND A;  1W01 A;  1IV9 A;  2KF4 A;  2PZV A;  2YX9 A;  3WR2 A;  2L4V A;  1N8Q A;  3MKI A;  1OGZ A;  4LYL B;  1TRP A;  2OQE A;  1ULJ B;  3BNC A;  1YIT 3;  3EHC A;  1UGI A;  1US1 A;  1NU3 A;  5BVB A;  2PNC A;  3DUK A;  4FCZ A;  2OWP A;  3CPW 2;  1JBR A;  1RHL A;  4N3V A;  1LRA A;  3A76 A;  4IT7 A;  4FMA A;  3LTD A;  2XSH B;  2SBL A;  1W00 A;  2CHC A;  3G71 3;  4EBG A;  1GOY A;  1YJN 3;  3FGY A;  3FCS B;  3FG1 A;  4O2H A;  4LSO A;  2MC8 A;  1CYU A;  1DMN A;  2QIY A;  1BNE A;  4R9L A;  2RNT A;  1LOY A;  3N9H A;  3LXU X;  3V99 A;  3WOD G;  4XB5 A;  5AII A;  1FZU A;  2IYJ A;  3D4A A;  2O3O A;  1BNR A;  3F14 A;  2Y74 A;  4GB5 A;  1W6C A;  2CH9 A;  2XGL A;  1K41 A;  1I70 A;  2C11 A;  1KWI A;  1UW1 A;  5BXQ A;  1PFP A;  3KN4 A;  1WMN A;  3SVA A;  4CJN A;  1PU4 A;  1LQG C;  3B4O A;  5DRE A;  1HU9 A;  3WOF B;  3Q3F A;  4MJD A;  1D6Y A;  2KXG A;  3HII A;  1DE3 A;  3I55 3;  3G6E 3;  1M1X B;  2XFT A;  3CPO A;  3F9S A;  1STF I;  3FLJ A;  1T3B A;  1WMP A;  3CMA 3;  1FUS A;  2R4I A;  2CFD A;  1YVS A;  2CFW A;  1N9J A;  3GSP A;  1K8A 4;  1JKG A;  4HKV B;  1BNG A;  3IMA B;  1IVW A;  3OW2 2;  5BIR A;  4IIA A;  1IDP A;  4MEI A;  4BL3 A;  1GOV A;  1HZ1 A;  4OVM A;  1GS3 A;  2XRX B;  3CME 3;  1S72 3;  1Q7Y 4;  1A90 A;  1GY6 A;  4FMB A;  5IEO A;  1Z1S A;  3LML A;  1BSB A;  2OTJ 3;  2YFI B;  1B20 A;  1JZO A;  1GOU A;  1TRQ A;  1WNH A;  4GSP A;  3WHO A;  3CXC 2;  3DGL A;  1I0V A;  3NV0 B;  3F40 A;  3B4P A;  5GSP A;  1W6Y A;  2P09 A;  1UCK A;  2W0Q A;  7STD A;  1W02 A;  3F7S A;  1O7W B;  4HBR A;  3CCL 3;  1VQL 3;  1EQK A;  5IG5 A;  1Q82 4;  3Q90 A;  1RGH A;  4U13 A;  1BRH A;  3NHX A;  4R1K A;  1T5Y A;  2GBW B;  3N54 B;  3OWU A;  4LMI A;  1JB4 A;  4HVN A;  3ROB A;  1K28 A;  4NHF A;  1LXE A;  2GXF A;  4N6U A;  5AI1 A;  7RNT A;  5HOH A;  3K9M C;  4JF8 A;  3UL6 A;  5CF1 A;  3NM2 A;  2QGU A;  3OXA A;  2P0M A;  5JPP A;  3LT8 A;  4XBX A;  2Y73 A;  5I97 A;  5LC7 A;  2W9P A;  3UL5 A;  1U8C B;  4N6O B;  1FA3 A;  1JNQ A;  1SII A;  3HZP A;  2Z7A A;  3CNM A;  1MWU A;  5STD A;  4FMC A;  1A67 A;  1O7M B;  3X40 A;  2CG0 A;  5AEW B;  2C4B A;  1N5P A;  5KP4 A;  1DMM A;  1I2F A;  2IA7 A;  3VSY A;  1N8R 4;  2UGI A;  1BNS A;  3MHE A;  1VQN 3;  4NPB A;  3EE1 A;  4J5G A;  1MGR A;  1OH0 A;  1ULI B;  3I0Y A;  2INX A;  1FGT A;  5EQL A;  1ISK A;  1BAO A;  3FG3 A;  1RGF A;  4LGQ A;  1AQZ A;  1AVL A;  1QAL A;  3EN1 B;  3NX0 A;  2Z6B A;  2BMR B;  1W7C A;  2BO9 B;  4RZM A;  1QAF A;  2H0H A;  1BOX A;  5CK6 A;  4J8T A;  2F86 B;  3FSD A;  5M18 A;  2XH9 A;  1BRI A;  3S5C A;  2QEX 3;  4HAA A;  7GSP A;  5TGN A;  5IEN A;  1QAK A;  2W04 A;  1LOW A;  4WYK A;  2WOF A;  3KCH A;  4WHA A;  1GYB A;  2F99 A;  3V92 A;  2YFJ B;  5D82 A;  3CD6 3;  4HJL B;  1WTH A;  3FZW A;  1D6U A;  1TJD A;  2E2T A;  2ML6 A;  4FR9 A;  5EVH A;  1G02 A;  3D9R A;  1RN1 A;  1M9G A;  3JUP A;  1OF5 A;  2JDI H;  3KII A;  3LT9 A;  1WQL B;  1D6Z A;  3CCQ 3;  2F56 A;  4K1U A;  4HM3 B;  3CC4 3;  2FXT A;  1UCI A;  1GMQ A;  3MG1 A;  5AIH A;  4L8O A;  1NDO B;  4O3V A;  1VQ6 3;  3EQQ B;  4FCJ A;  1RKY A;  1QVG 2;  1E3R A;  3UNL A;  3JUO A;  3G0K A;  1VQM 3;  1KD1 4;  3S67 A;  1YGW A;  1VQ8 3;  1RLS A;  3FKA A;  4L7K A;  1BVI A;  1HYF A;  1V58 A;  5EEO A;  1B3S A;  3GRD A;  1IVV A;  4HZB B;  1CEW I;  1ROV A;  1RMS A;  3DGM A;  2GSP A;  1I0X A;  3KZT A;  2HMJ B;  4OUQ A;  1M90 4;  2J8X B;  1E97 A;  1K9M 4;  2RCD A;  3BIR A;  2CX1 A;  2K54 A;  2ZL8 A;  5IER A;  4N6V 0;  1TP6 A;  2E2U A;  1QVF 2;  1GMP A;  2W2C A;  4JRF A;  1IQ8 A;  1W5Z A;  4K90 B;  3OWY A;  4N6L A;  6RNT A;  1OPY A;  1TFO A;  2KAA A;  1IVU A;  3GZR A;  2CKF B;  1JBT A;  3D79 A;  1RCL A;  2F4Y A;  3JUM A;  2BNG A;  1A2K A;  1JRQ A;  1O7H B;  1QMA A;  1I3I A;  1VQQ A;  2CIU A;  1S5A A;  1ZGX A;  1B2X A;  1CH0 A;  1FYS A;  1FGR A;  2F5W A;  2XGN A;  4BIR A;  3KE7 A;  4BTW A;  2ZA4 A;  2W6J H;  3MG2 A;  5IG0 A;  4AKY A;  5JPU A;  3G4S 3;  3MG3 A;  3FF2 A;  1M1K 4;  2BIR A;  2RSX A;  8RNT A;  1RGL A;  1MOL A;  1JN5 B;  3SXX A;  1FGO A;  4EC6 A;  2HMK B;  1VZZ A;  1UI8 A;  2GU1 A;  1BRG A;  1DVD A;  2B24 B;  1VQ9 3;  2P38 A;  3S29 A;  3NUV A;  2W56 A;  3URP A;  1RN4 A;  3WA3 A;  5G1L A;  1OHP A;  3HI7 A;  1NB5 I;  2Z77 A;  4HOH A;  1SJW A;  1Q40 B;  1UCL A;  4KFF A;  2HMN B;  2W03 A;  3HX8 A;  5AIF A;  2E2V A;  4OK0 A;  1WMO A;  2AAE A;  2O9U X;  3E99 A;  1GY7 A;  2B1X B;  3GZX B;  3DM8 A;  3LOY A;  4XBY A;  5AIG A;  4HM7 B;  3CCM 3;  5CF2 A;  3D5I A;  3KSP A;  3DGN A;  4AKZ A;  1KC8 4;  2Z76 A;  3AMO A;  1GD4 A;  4PEJ A;  2BMO B;  4N6T A;  4Q53 A;  2H0I A;  8CHO A;  1QJG A;  2D1W A;  2YFL B;  1NO3 A;  3B8L A;  4X2H A;  1T2H A;  4QWT A;  5IG3 A;  2A15 A;  2LYX A;  1W2Z A;  4CPK A;  1BUJ A;  1TFK A;  5HGR A;  1SQW A;  1VQ4 3;  1STD A;  3QK9 A;  3SX1 A;  2GBX B;  2ZHX B;  3DGY A;  1UGH I;  1GY5 A;  1IV7 A;  1Q42 A;  1BNF A;  3EBY A;  3LTB A;  3NQZ A;  4HM0 B;  2FGT A;  4MMZ B;  1SAR A;  3SYU A;  1EKM A;  1X1Y A;  1NWW A;  1VQO 3;  3IJE B;  1F8N A;  3O8Y A;  1BAN A;  3EBT A;  3CU3 A;  4ZM8 A;  4KVH A;  3JVC A;  3EF8 A;  2OOV C;  5ELU A;  3F7X A;  1V57 A;  3BNB A;  1RTU A;  4EYC A;  5M19 A;  2QA4 3;  1BSD A;  1BNJ A;  1AVK A;  1SPU A;  3BU4 A;  1FUW A;  5JBS A;  1X1W A;  1ZX2 A;  1PY3 A;  5KP3 A;  3SED A;  1BNI A;  2SAR A;  1UUG B;  5IF6 A;  1C7H A;  1K73 4;  5FW5 A;  2WGO A;  1LOX A;  3GZY B;  2KF5 A;  3NQY A;  3EX9 A;  1FW7 A;  4ILF A;  5G2G A;  2IUJ A;  1AV4 A;  2ZDJ A;  1TTO A;  2HMO B;  3T8N A;  2CX0 A;  4N6N B;  3CC2 3;  3WDG B;  3LTC A;  4N6M A;  1BU4 A;  1ZO2 A;  2KRT A;  2XF3 A;  4FCM A;  1YJW 3;  1RRL A;  1TU5 A;  3EC9 A;  3U1W A;  2UX0 A;  3PZW A;  3MYT A;  3RNT A;  4HM5 B;  1IT8 A;  4GL6 A;  3U97 A;  4HM2 B;  2BMQ B;  3A5E A;  3AGO A;  3G16 A;  1RJO A;  3K7C A;  1Y4K A;  1IQY A;  3ALA A;  3PGB A;  1JB5 A;  4WWU C;  2FNQ A;  1RDS A;  4HM4 B;  3S28 A;  2WGQ A;  3SOA A;  1DMQ A;  4RNY A;  1YGE A;  5AYS C;  1W4N A;  2P0X A;  1JKG B;  2IUK A;  3MPH A;  1BSE A;  3NV0 A;  3NBB A;  1JZD A;  1FGM A;  1O7N B;  3SOY A;  1VQ7 3;  2CW9 A;  1A2P A;  1JJ2 2;  2GEX A;  3PS8 A;  3BB9 A;  1JBS A;  1NB3 I;  1R4C A;  2K0M A;  1IYY A;  1PYL A;  3D3L A;  2CC3 A;  4XDV A;  1I2E A;  1AR0 A;  1N9E A;  1O7G B;  4R4K A;  4BL2 A;  3VF1 A;  3NXJ A;  3DGO A;  2GU3 A;  3IPT A;  3KFQ C;  1I2G A;  2MF7 A;  5M1A A;  3HK4 A;  3RGR A;  3WMD A;  3DZL A;  1OGX A;  4NRE A;  4EV5 A;  3DMC A;  4KFD A;  3H3H A;  1LNI A;  3NBR A;  1IQX A;  1G0T A;  3PXM A;  1KQS 2;  1VQK 3;  2IMJ A;  1IVX A;  1U5O A;  1IT7 A;  1GSP A;  4KT3 B;  2L1S A;  4BTY A;  1G96 A;  3BLZ A;  4TX4 A;  3PCR A;  2BT3 A;  2IY2 A;  3FH1 A;  1HKX A;  1NNV A;  1EG9 B;  4EV2 A;  1VQ5 3;  3F8H A;  3TDG A;  3CCS 3;  1BGS A;  1RNB A;  1B21 A;  3QRD A;  3Q2P A;  1UUW B;  1OUN A;  4G1M B;  2CFK A;  3S27 A;  2K3D A;  1BRS A;  3LH4 A;  4GHO A;  1R4Y A;  3X42 A;  3EB8 A;  1BIR A;  1Q81 4;  3FG4 A;  2P05 A;  5ELJ A;  2M7O A;  5AEU B;  5AYR B;  3RGA A;  1EUI C;  3CNX A;  1YHQ 3;  1C54 A;  4CCV A;  2HMM B;  3ECF A;  5RNT A;  4XBT A;  3KSE D;  1L5G B;  5CLK A;  3CCJ 3;  2AAD A;  4H61 A;  1OCV A;  1TIJ A;  1MWR A;  1GMR A;  1B27 A;  1FUT A;  1MNL A;  4RNZ A;  2OOV A;  1BSA A;  1OHO A;  2JQ5 A;  1YI2 3; 
#chains in the Genus database with same CATH homology
 3SYU A;  1RGF A;  1SAR A;  2KF4 A;  3WR2 A;  1AQZ A;  1X1Y A;  1TRP A;  1BOX A;  2KF6 A;  1BAN A;  3AGN A;  1JBR A;  1BRI A;  1T2I A;  1RHL A;  1RTU A;  1LRA A;  4HAA A;  1LOV A;  1B2Z A;  7GSP A;  1BSD A;  1BNJ A;  1RGA A;  1LOW A;  3BU4 A;  3DH2 A;  1GOY A;  1X1W A;  3KCH A;  1PY3 A;  1BNI A;  2SAR A;  1AY7 A;  1BNE A;  2RNT A;  1LOY A;  1MGW A;  1FZU A;  1G02 A;  3D4A A;  1RN1 A;  2F5M A;  1B2U A;  2KF5 A;  1JBS A;  1BNR A;  1FW7 A;  2F56 A;  1TTO A;  1UCI A;  1GMQ A;  1I70 A;  1BAO A;  1BU4 A;  1DET A;  5BU4 A;  1B2M A;  1YGW A;  1RLS A;  3Q3F A;  1DE3 A;  3RNT A;  1BVI A;  1Q9E A;  1HYF A;  1B3S A;  1BRJ A;  1RGC A;  3A5E A;  1RMS A;  3AGO A;  1FUS A;  2GSP A;  1I0X A;  1YVS A;  3GSP A;  1BNG A;  1RDS A;  3BIR A;  5BIR A;  1GOV A;  1HZ1 A;  1GMP A;  1RGE A;  1BSE A;  1RSN A;  1A2P A;  1BSB A;  2KAA A;  1X1X A;  6RNT A;  1B20 A;  2HOH A;  1GOU A;  1TRQ A;  3AHS A;  4GSP A;  3WHO A;  1RCL A;  2F4Y A;  1I0V A;  1RGK A;  1IYY A;  1JBT A;  1I3I A;  4RNT A;  5GSP A;  1YNV X;  1UCK A;  1PYL A;  1B2X A;  1ZGX A;  1CH0 A;  1FYS A;  2BU4 A;  2F5W A;  4BIR A;  1I2E A;  2RBI A;  2ZA4 A;  3AHW A;  1RGH A;  4J5K A;  4BU4 A;  1I2G A;  1BRH A;  1BRN L;  2BIR A;  1BSC A;  8RNT A;  1LNI A;  1BRK A;  1RGL A;  7RNT A;  5HOH A;  1BRG A;  1I3F A;  1GSP A;  3URP A;  1RN4 A;  3HOH A;  4HOH A;  1RNB A;  1BGS A;  1UCL A;  1B21 A;  2AAE A;  1BRS A;  4GHO A;  1R4Y A;  3D5I A;  3D5G A;  2C4B A;  1B2S A;  1X1U A;  1BIR A;  1I2F A;  1RNT A;  1RCK A;  9RNT A;  1BNS A;  1C54 A;  1T2H A;  2KF3 A;  4J5G A;  5RNT A;  1MGR A;  6GSP A;  1BUJ A;  2AAD A;  1RGG A;  1GMR A;  1B27 A;  1FUT A;  1UCJ A;  1BSA A;  3DGY A;  1I8V A;  1BNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...