1BSCA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRVLYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bscA00
1IYYA 1RTUA 1RSNA 1FUTA 1RGLA 1PYLA 5BIRA 1GSPA 1YNVX 3DH2A 5RNTA 1G02A 2AADA 1JBSA 1RHLA 2KF6A 1BRNL 1BRGA 3SYUA 1LOVA 1BNRA 1Q9EA 1RGAA 1YGWA 1I8VA 2HOHA 1RN4A 2BU4A 9RNTA 2ZA4A 1DE3A 1I2EA 5BU4A 1I0XA 6GSPA 1TRPA 1UCLA 1RGEA 4BU4A 7RNTA 1I2GA 1BUJA 1BRHA 1I2FA 4J5GA 4BIRA 1DETA 4HAAA 1C54A 1BNFA 3BU4A 1B2XA 1RGKA 3KCHA 1GMQA 1B2UA 1I3FA 1FW7A 2AAEA 1BSAA 1BU4A 1GOYA 3D5IA 1BRSA 1FYSA 1RGGA 4GSPA 1BSCA 1RGHA 2KAAA 1RMSA 1RCLA 1RGCA 4GHOA 1HZ1A 1GOVA 1T2HA 3A5EA 1TTOA 1LOWA 1B20A 1RDSA 1JBTA 1BNGA 3BIRA 2C4BA 3GSPA 3URPA 1BANA 1LRAA 1R4YA 1I0VA 1BNIA 1BVIA 1ZGXA 4RNTA 1BSDA 1FZUA 1UCKA 1BNJA 1I3IA 1RLSA 1MGWA 2RNTA 1BGSA 1UCIA 3WHOA 1GMRA 3HOHA 3RNTA 1BOXA 1B27A 4J5KA 2GSPA 1BRJA 1T2IA 5GSPA 3AGOA 1X1XA 1B21A 1HYFA 2KF3A 2RBIA 1B2ZA 1AY7A 4HOHA 3Q3FA 1JBRA 1BRIA 2F4YA 1MGRA 1FUSA 2F56A 1B2MA 1BNEA 6RNTA 1BIRA 1RN1A 1I70A 1YVSA 1CH0A 1GOUA 1RGFA 3WR2A 1RNBA 1X1YA 2SARA 2BIRA 1BNSA 1GMPA 3D5GA 1BSEA 3AHSA 2KF5A 1AQZA 5HOHA 3D4AA 1PY3A 8RNTA 3AHWA 1TRQA 2F5WA 1RNTA 1X1WA 1B3SA 2KF4A 1B2SA 1BRKA 1BSBA 1LOYA 1SARA 1RCKA 1UCJA 1LNIA 1BAOA 1X1UA 3AGNA 2F5MA 3DGYA 7GSPA 1A2PA
chains in the Genus database with same CATH superfamily
1ZS7A 1RTUA 1IYYA 4XBXA 5BIRA 1O7GB 1TIJA 2Y73A 1LXEA 3Q90A 1JNQA 5ELJA 3K63A 5JBSA 1VQ93 2RSXA 1GY7A 5RNTA 3NV0A 1RHLA 1WNHA 2YFIB 4STDA 1TU5A 1LOVA 4LGQA 1BNRA 1Q9EA 4N6NB 1FUWA 9RNTA 2UX0A 1NU3A 2BU4A 3U97A 2INXA 3F8XA 1A90A 1YJN3 4HM0B 2CFKA 1DVCA 2PZVA 3JUMA 4FMCA 1QAFA 1W7CA 1W2ZA 2CFDA 3KSED 1NB3I 1WMPA 1OHPA 3X3YA 5D82A 1VQN3 4HZBB 2JDIH 2IY2A 1DETA 3LYGA 2WOFA 4N3VA 3FGYA 4R1KA 1STDA 1JB4A 1DMMA 2OQEC 3FF0A 4HAAA 3X42A 1C54A 1Q7Y4 2P09A 1US1A 1O7PB 4R4KA 3KCHA 3UNLA 3NX0A 1I3FA 1M1XB 2K3DA 2ZL8A 1RRLA 1Y4KA 1BSAA 1FW7A 3MG2A 2OOVA 4O02B 1IQ8A 1JB5A 2H0GA 1W00A 3GZXB 4GSPA 1Z1SA 2KAAA 1RMSA 1MWUA 2XH9A 3ER7A 3HIGA 1HZ1A 1D6UA 4EC6A 3A5EA 3JUOA 5IENA 3EBTA 1TTOA 1AVLA 1LOWA 2OWPA 4X2HA 3CD63 3PZWA 1JN5B 3PGBA 3OXAA 1IV7A 1BNGA 3HZPA 3BIRA 1WQLB 3AMOA 4HM3B 3GSPA 3RGRA 2CX1A 1F8NA 2XRXB 1EQKA 3IPTA 1OPYA 1T5YA 1N8R4 1ZGXA 3MHEA 1FZUA 1BNJA 1GD3A 2D1WA 2RNTA 2STDA 4O3VA 3CCJ3 2IYJA 1UCIA 3WHOA 1VQ63 1IT7A 1GMRA 3RNTA 3B4PA 1K41A 2CC3A 4ZM8A 3G713 5GSPA 1B21A 2KF3A 2CFWA 1SQWA 3S67A 1TUHA 3F9SA 1BRIA 2FNQA 3NBBA 4HM1B 4Q53A 4R80A 1LNHA 2ML6A 2GBWB 1VQ53 2CG0A 3E99A 5D81A 4FCJA 8CHOA 3KE7A 3D3LA 4PEJA 3FG3A 3CNMA 1I70A 2KRTA 1CH0A 1O7MB 3LZAA 1RNBA 3PXMA 2R4IA 2KF5A 1AQZA 4BTWA 4MMXB 1W2B2 2B1XB 1OGZA 1YGEA 3GWRA 1ISKA 1O7WB 2KXGA 2MF7A 3SOAA 2JQ5A 5IEOA 1EEJA 4R9LA 1B3SA 2KF4A 2W6JH 1LOYA 1SARA 4I4KA 5AIHA 3LT8A 1UCJA 3WMDA 3X40A 1LNIA 3AGNA 1Q864 2Z77A 1Q40A 4MMZB 1VQL3 3DGYA 2HMMB 4K1VA 3T0UA 1KC84 3BNBA 1N9EA 1Q814 1AR0A 2J8XB 1VQM3 1SJWA 3DGMA 1PYLA 5JPUA 1FGQA 1NO3A 4GL6A 2CK3H 3GAXA 4L8OA 2CFLA 1WMOA 4KFDA 1IVVA 2W03A 1E3RA 1QVG2 2XFTA 1JBSA 1IDPA 1OGXA 1IQXA 3L0RA 3LT9A 3CME3 5LC7A 4BTYA 1UI8A 1G96A 3KFQC 3CCU3 1RN4A 1QMAA 3HK4A 2ZA4A 3I0YA 4RZMA 1D6YA 3Q1CA 3B4OA 3WA2X 4LSOA 1VQ73 3WOFB 1UCLA 4FMAA 3G8ZA 7RNTA 1AVKA 1NWWA 1ZX2A 3FKAA 4L7KA 1ULJB 3PYJA 3WA3A 1OF5B 4BIRA 3PCSA 2C10A 3EJVA 1ZO2A 3BNDA 3EN8A 1J2BA 1BNFA 4WYKB 4LZIA 5HGRA 3OX9A 3BU4A 2F86B 3LTDA 3CPW2 3CCM3 3OW22 1OACA 3MSOA 1GMQA 3SX1A 4XM4A 1B2UA 3VSYA 1A67A 3Q2PA 3SVAA 3V92A 2Y74A 4O8SA 1BU4A 3D5IA 1BRSA 2WO0A 2GEYA 1N5HA 3F14A 2W56A 3KIIA 1FGRA 1W6YA 1W4NA 3CU3A 5G2GA 1RGCA 3JVCA 1JB2A 3CNXA 4HM2B 2L4VA 4BTXA 1PFPA 2QEX3 5AIFA 2CIUA 1RDSA 4XB5A 1O7NB 4N6V0 1JBTA 1RJOA 2K54A 3FLJA 3GZYB 2P0MA 3LH4A 5IG0A 3QK9A 3G0KA 3CCR3 3CCL3 4MJDA 4IT7A 1GY6A 3NHXA 3QRDA 3MWZA 1R4YA 5BXQA 3NXJA 1Q824 3WOEB 1ASKA 1I0VA 1GY5A 5D83A 4K1UA 4EW5A 3DM8A 3NQZA 1CYUA 1BSDA 2FXTA 2HMNB 1MGWA 1KQS2 1JV2B 3ALAA 3G16A 3RDEA 3G4S3 2B24B 2O3OA 2M7OA 1NJI4 1M904 1B27A 1EKMA 2FGTA 2GSPA 4IPBA 1V58A 1T2IA 3OV4A 4FCMA 1VZZA 3SLUA 1YVBI 2OQEA 1HYFA 5M1AA 3GRDA 4OVMA 1MGRA 4HJLB 7STDA 2ML5A 1A2VA 1FUSA 2KCDA 2XF3A 3CC43 1IK3A 2R41A 1BNEA 6RNTA 4N6UA 1N8QA 3EHCA 1RN1A 1T3BA 1GS3A 1LVNA 1IVWA 1GOUA 1YVSA 3H3HA 3ROBA 3UJMA 3FZWA 1DMNA 3U1WA 1HU9A 1X1YA 2BIRA 1CYVA 2GU1A 5CXOA 2P0XA 2LQVA 4HM4B 5HOHA 1N5PA 1LOXA 3MPHA 3OWUA 3TDGA 1OHOA 1GD4A 3NUVA 2RGQA 4HVNA 1RNTA 2CFGA 5IF6A 1FGOA 1B2SA 3BLZA 2F98A 3S5CA 5CF2A 5KP4A 1R4CA 5LC6A 3F8HA 1JKGA 2BHMA 1BUQA 3ZG5A 1SIIA 2CH9A 2YX9A 3T8UA 2BNGA 4NREA 3CCE3 4AKZA 3EE1A 1KSIA 1VQK3 3F40A 4BL2A 4CPKA 3G6E3 2CW9A 3I553 1IV9A 3UL5A 1RSNA 3FH1A 3DY5A 1FUTA 1RGLA 1O7HB 5EEOA 3RGAA 3F7SA 2I9WA 4RBNA 5DREA 1JRQA 3B8LA 3DH2A 3NBJA 4BL3A 1K9M4 1YI23 3SXXA 5EQLA 3AMOB 2OCTA 3FG4A 3X3ZA 4EV5A 3LTCA 2KF6A 3GZRA 3SYUA 1STFI 1TFKA 1OHSA 3X3XA 1YGWA 1UUVB 1W01A 1YJW3 3HX8A 5AI1A 3KN4A 4WHAA 2K0MA 4IIAA 4EXRA 1I0XA 6GSPA 1EA2A 1RGEA 3O8YA 1I2GA 1UW1A 3V98A 4KT3B 1MWSA 5AYRB 4J5GA 4K90B 2F99A 4XDWA 1ROAA 6STDA 1UGIA 2GBXB 2CWVA 1B2XA 1RGKA 1NNVA 1WMNA 3MYTA 1V57A 2RFRA 5IEPA 4HM8B 3S27A 2AAEA 1KWIA 3KZTA 2O9UX 3LTBA 2BMQB 4ILFA 1OF5A 1MWTA 1V74A 1MWRA 4NHFA 4AKYA 1RGHA 4NPBA 4KVHA 1SPUA 2A15A 3T8NA 2E2VA 2WGQA 1UI7A 1Q42A 3MKIA 4XBYA 5M19A 1YHQ3 1RCLA 1U8CB 2XSOB 3EF8A 3FF2A 3K0ZA 1T2HA 2MC8A 1EG9B 3MG1A 1B20A 5AIGA 3JUPA 2YFLB 3UL6A 1TFOA 3N9HA 3K5TA 3URPA 1BANA 3LXUX 3SOYA 1M1K4 2XR8B 4H61A 1BNIA 1IU7A 3NBRA 4RNTA 4WFOA 3NM2A 3CCQ3 1I3IA 3WDGB 1RLSA 2XEPA 1BGSA 2Z7AA 3HOHA 2Z76A 2GXFA 2IMJA 1S5AA 2RCDA 3EN1B 3HIIA 5JPPA 2XGLA 1E97A 5IG5A 3X41A 3D79A 2CWUA 1G0TA 5IW9A 3AGOA 4G1MB 1U5OA 3B7CA 4MMYB 1AY7A 1N9JA 1W5ZA 2BO9B 2HMLB 3Q3FA 4HOHA 1TP6A 2H0IA 4QWTA 3VF1A 1JZOA 3UB1A 3EBYA 3NM7A 2HMOB 5G1LA 2L1SA 3KKGA 4O2HA 1K8A4 1UDII 4FCZA 5I97A 1OUNA 4XDVA 3OWSA 3PCRA 4HKVB 5KP3A 1RGFA 4N6LA 3WR2A 1DMQA 2W04A 4WP5A 1BNSA 1GMPA 1UGHI 2W9PA 4AEQA 2QA43 5DRVA 2OTJ3 3AHSA 2PNCA 1VQ83 4K61A 1K28A 3BNCA 2CWTA 1JN5A 8RNTA 3CCS3 3CPOA 2D42A 3S28A 4CDLA 1X1WA 2QGUA 3EB8A 5CK6A 3BNEA 5EVHA 5AEUB 1OCVA 1UUGB 5AIIA 3JUQA 4HYZA 1S723 1CEWI 5ELUA 1BSBA 3DUKA 2XSHB 1RCKA 4CCVA 2QIYA 4LMIA 2P05A 1YIJ3 1NDOB 5G1KA 4J9AA 1X1UA 5CLKA 2OOVC 3EC9A 1VQ43 3LMLA 4L8PA 3NV0B 3HI7A 4HM6B 2GU3A 4EYCA 1YJ93 2W56B 3K9MC 3ECFA 1IVXA 3H51A 3MG3A 5STDA 5KP1A 1DVDA 4OUQA 2IA7A 3M8CA 4H3UA 1Q7HA 1GSPA 1FA3A 1YNVX 4OK0A 4JRFA 2UGIA 2W9QA 1TJDA 3CC23 1G02A 3A76A 2AADA 3LTAA 2Z6BA 3DXOA 1BRGA 1JJ22 1BRNL 1RGAA 3N8BA 1I8VA 2H0HA 2HOHA 2CX0A 1VQO3 1DE3A 1I2EA 3FG1A 4KFFA 3LOYA 2BT3A 4CJNA 5AYSC 5BU4A 3IMAB 1TRPA 1W02A 4BU4A 4HZ9B 1QVF2 1BUJA 1BRHA 1DYUA 1I2FA 2LYXA 3DGOA 4GB5A 4EBGA 1FGTA 3F7XA 4TX4A 2OTL3 2ZDJA 5TGNA 5M18A 4FR9A 3PS8A 1M9GA 1LQGC 1QAKA 3S29A 3FSDA 1NB5I 4HBRA 1L5GB 2W2CA 1OH0A 2XFSA 5FGOA 1YIT3 2W0QA 3CCV3 2IUKA 1IVUA 1W6CA 3KSPA 1GOYA 5A0OB 2CHCA 1FYSA 4MEIA 3IJEB 1RGGA 1BSCA 1WTHA 4N6MA 1FGMA 2V1LA 3N54B 2WGOA 3OWYA 4GHOA 3EX9A 4KZ1A 5AEWB 2WOHA 1GOVA 5BVBA 1PU4A 3CMA3 4XBTA 4N6OB 2C11A 2CG1A 1RRHA 4LYLB 5IERA 3ZG0A 2C4BA 2E2TA 4LEHA 3DMCA 1LRAA 3D9RA 2XGNA 4R9KA 1IT8A 4RNZA 1JKGB 1AV4A 1RN7A 3VGNA 1BVIA 3CC73 4FMBA 2P38A 1UCKA 1QJGA 1A2KA 1MNLA 3BB9A 2BMRB 4I5QA 3I563 1BOXA 5IG3A 2BMOB 3EQQB 4J5KA 4U13A 1BRJA 4WWUC 3J7Yd 1X1XA 2Q07A 2RBIA 2SBLA 3DGLA 1B2ZA 3DGNA 3GZBA 4WYKA 1JBRA 2F4YA 4J8TA 1GYBA 4JF8A 2F56A 1ROVA 1B2MA 1MOLA 1LQMB 4DKIA 1BIRA 1EUIC 3ZFZA 2SARA 1ULIB 3D5GA 1W6GA 1BSEA 1CQSA 1HKXA 3V99A 4HM5B 1Q40B 3K7CA 1QALA 3DZLA 4X2OA 5FW5A 4EV2A 1IQYA 1E3VA 1PY3A 3D4AA 3AHWA 1TRQA 2F5WA 3SEDA 1UUWB 5CF1A 1RKYA 2E2UA 4N6TA 2ZHXB 2IUJA 2CKFB 1BRKA 3NQYA 1SIHA 1K734 1VQQA 4RNYA 4ORLA 2HMKB 1D6ZA 1BAOA 4HM7B 2F5MA 5IG4A 2HMJB 2YFJB 3JUNA 3CXC2 2GEXA 1KD14 3STDA 4FMDA 3WODG 1C7HA 7GSPA 1VQP3 1A2PA 4KFEA 2UUGC 1JZDA 3FCSB
chains in the Genus database with same CATH topology
1IYYA 1RTUA 1RSNA 1FUTA 1RGLA 1PYLA 5BIRA 1GSPA 1YNVX 3DH2A 5RNTA 1G02A 2AADA 1JBSA 1RHLA 2KF6A 1BRNL 1BRGA 3SYUA 1LOVA 1BNRA 1Q9EA 1RGAA 1YGWA 1I8VA 2HOHA 1RN4A 2BU4A 9RNTA 2ZA4A 1DE3A 1I2EA 5BU4A 1I0XA 6GSPA 1TRPA 1UCLA 1RGEA 4BU4A 7RNTA 1I2GA 1BUJA 1BRHA 1I2FA 4J5GA 4BIRA 1DETA 4HAAA 1C54A 1BNFA 3BU4A 1B2XA 1RGKA 3KCHA 1GMQA 1B2UA 1I3FA 1FW7A 2AAEA 1BSAA 1BU4A 1GOYA 3D5IA 1BRSA 1FYSA 1RGGA 4GSPA 1BSCA 1RGHA 2KAAA 1RMSA 1RCLA 1RGCA 4GHOA 1HZ1A 1GOVA 1T2HA 3A5EA 1TTOA 1LOWA 1B20A 1RDSA 1JBTA 1BNGA 3BIRA 2C4BA 3GSPA 3URPA 1BANA 1LRAA 1R4YA 1I0VA 1BNIA 1BVIA 1ZGXA 4RNTA 1BSDA 1FZUA 1UCKA 1BNJA 1I3IA 1RLSA 1MGWA 2RNTA 1BGSA 1UCIA 3WHOA 1GMRA 3HOHA 3RNTA 1BOXA 1B27A 4J5KA 2GSPA 1BRJA 1T2IA 5GSPA 3AGOA 1X1XA 1B21A 1HYFA 2KF3A 2RBIA 1B2ZA 1AY7A 4HOHA 3Q3FA 1JBRA 1BRIA 2F4YA 1MGRA 1FUSA 2F56A 1B2MA 1BNEA 6RNTA 1BIRA 1RN1A 1I70A 1YVSA 1CH0A 1GOUA 1RGFA 3WR2A 1RNBA 1X1YA 2SARA 2BIRA 1BNSA 1GMPA 3D5GA 1BSEA 3AHSA 2KF5A 1AQZA 5HOHA 3D4AA 1PY3A 8RNTA 3AHWA 1TRQA 2F5WA 1RNTA 1X1WA 1B3SA 2KF4A 1B2SA 1BRKA 1BSBA 1LOYA 1SARA 1RCKA 1UCJA 1LNIA 1BAOA 1X1UA 3AGNA 2F5MA 3DGYA 7GSPA 1A2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYY A;  1RTU A;  1RSN A;  1FUT A;  1RGL A;  1PYL A;  5BIR A;  1GSP A;  1YNV X;  3DH2 A;  5RNT A;  1G02 A;  2AAD A;  1JBS A;  1RHL A;  2KF6 A;  1BRN L;  1BRG A;  3SYU A;  1LOV A;  1BNR A;  1Q9E A;  1RGA A;  1YGW A;  1I8V A;  2HOH A;  1RN4 A;  2BU4 A;  9RNT A;  2ZA4 A;  1DE3 A;  1I2E A;  5BU4 A;  1I0X A;  6GSP A;  1TRP A;  1UCL A;  1RGE A;  4BU4 A;  7RNT A;  1I2G A;  1BUJ A;  1BRH A;  1I2F A;  4J5G A;  4BIR A;  1DET A;  4HAA A;  1C54 A;  1BNF A;  3BU4 A;  1B2X A;  1RGK A;  3KCH A;  1GMQ A;  1B2U A;  1I3F A;  1FW7 A;  2AAE A;  1BSA A;  1BU4 A;  1GOY A;  3D5I A;  1BRS A;  1FYS A;  1RGG A;  4GSP A;  1BSC A;  1RGH A;  2KAA A;  1RMS A;  1RCL A;  1RGC A;  4GHO A;  1HZ1 A;  1GOV A;  1T2H A;  3A5E A;  1TTO A;  1LOW A;  1B20 A;  1RDS A;  1JBT A;  1BNG A;  3BIR A;  2C4B A;  3GSP A;  3URP A;  1BAN A;  1LRA A;  1R4Y A;  1I0V A;  1BNI A;  1BVI A;  1ZGX A;  4RNT A;  1BSD A;  1FZU A;  1UCK A;  1BNJ A;  1I3I A;  1RLS A;  1MGW A;  2RNT A;  1BGS A;  1UCI A;  3WHO A;  1GMR A;  3HOH A;  3RNT A;  1BOX A;  1B27 A;  4J5K A;  2GSP A;  1BRJ A;  1T2I A;  5GSP A;  3AGO A;  1X1X A;  1B21 A;  1HYF A;  2KF3 A;  2RBI A;  1B2Z A;  1AY7 A;  4HOH A;  3Q3F A;  1JBR A;  1BRI A;  2F4Y A;  1MGR A;  1FUS A;  2F56 A;  1B2M A;  1BNE A;  6RNT A;  1BIR A;  1RN1 A;  1I70 A;  1YVS A;  1CH0 A;  1GOU A;  1RGF A;  3WR2 A;  1RNB A;  1X1Y A;  2SAR A;  2BIR A;  1BNS A;  1GMP A;  3D5G A;  1BSE A;  3AHS A;  2KF5 A;  1AQZ A;  5HOH A;  3D4A A;  1PY3 A;  8RNT A;  3AHW A;  1TRQ A;  2F5W A;  1RNT A;  1X1W A;  1B3S A;  2KF4 A;  1B2S A;  1BRK A;  1BSB A;  1LOY A;  1SAR A;  1RCK A;  1UCJ A;  1LNI A;  1BAO A;  1X1U A;  3AGN A;  2F5M A;  3DGY A;  7GSP A;  1A2P A; 
#chains in the Genus database with same CATH topology
 1ZS7 A;  1RTU A;  1IYY A;  4XBX A;  5BIR A;  1O7G B;  1TIJ A;  2Y73 A;  1LXE A;  3Q90 A;  1JNQ A;  5ELJ A;  3K63 A;  5JBS A;  1VQ9 3;  2RSX A;  1GY7 A;  5RNT A;  3NV0 A;  1RHL A;  1WNH A;  2YFI B;  4STD A;  1TU5 A;  1LOV A;  4LGQ A;  1BNR A;  1Q9E A;  4N6N B;  1FUW A;  9RNT A;  2UX0 A;  1NU3 A;  2BU4 A;  3U97 A;  2INX A;  3F8X A;  1A90 A;  1YJN 3;  4HM0 B;  2CFK A;  1DVC A;  2PZV A;  3JUM A;  4FMC A;  1QAF A;  1W7C A;  1W2Z A;  2CFD A;  3KSE D;  1NB3 I;  1WMP A;  1OHP A;  3X3Y A;  5D82 A;  1VQN 3;  4HZB B;  2JDI H;  2IY2 A;  1DET A;  3LYG A;  2WOF A;  4N3V A;  3FGY A;  4R1K A;  1STD A;  1JB4 A;  1DMM A;  2OQE C;  3FF0 A;  4HAA A;  3X42 A;  1C54 A;  1Q7Y 4;  2P09 A;  1US1 A;  1O7P B;  4R4K A;  3KCH A;  3UNL A;  3NX0 A;  1I3F A;  1M1X B;  2K3D A;  2ZL8 A;  1RRL A;  1Y4K A;  1BSA A;  1FW7 A;  3MG2 A;  2OOV A;  4O02 B;  1IQ8 A;  1JB5 A;  2H0G A;  1W00 A;  3GZX B;  4GSP A;  1Z1S A;  2KAA A;  1RMS A;  1MWU A;  2XH9 A;  3ER7 A;  3HIG A;  1HZ1 A;  1D6U A;  4EC6 A;  3A5E A;  3JUO A;  5IEN A;  3EBT A;  1TTO A;  1AVL A;  1LOW A;  2OWP A;  4X2H A;  3CD6 3;  3PZW A;  1JN5 B;  3PGB A;  3OXA A;  1IV7 A;  1BNG A;  3HZP A;  3BIR A;  1WQL B;  3AMO A;  4HM3 B;  3GSP A;  3RGR A;  2CX1 A;  1F8N A;  2XRX B;  1EQK A;  3IPT A;  1OPY A;  1T5Y A;  1N8R 4;  1ZGX A;  3MHE A;  1FZU A;  1BNJ A;  1GD3 A;  2D1W A;  2RNT A;  2STD A;  4O3V A;  3CCJ 3;  2IYJ A;  1UCI A;  3WHO A;  1VQ6 3;  1IT7 A;  1GMR A;  3RNT A;  3B4P A;  1K41 A;  2CC3 A;  4ZM8 A;  3G71 3;  5GSP A;  1B21 A;  2KF3 A;  2CFW A;  1SQW A;  3S67 A;  1TUH A;  3F9S A;  1BRI A;  2FNQ A;  3NBB A;  4HM1 B;  4Q53 A;  4R80 A;  1LNH A;  2ML6 A;  2GBW B;  1VQ5 3;  2CG0 A;  3E99 A;  5D81 A;  4FCJ A;  8CHO A;  3KE7 A;  3D3L A;  4PEJ A;  3FG3 A;  3CNM A;  1I70 A;  2KRT A;  1CH0 A;  1O7M B;  3LZA A;  1RNB A;  3PXM A;  2R4I A;  2KF5 A;  1AQZ A;  4BTW A;  4MMX B;  1W2B 2;  2B1X B;  1OGZ A;  1YGE A;  3GWR A;  1ISK A;  1O7W B;  2KXG A;  2MF7 A;  3SOA A;  2JQ5 A;  5IEO A;  1EEJ A;  4R9L A;  1B3S A;  2KF4 A;  2W6J H;  1LOY A;  1SAR A;  4I4K A;  5AIH A;  3LT8 A;  1UCJ A;  3WMD A;  3X40 A;  1LNI A;  3AGN A;  1Q86 4;  2Z77 A;  1Q40 A;  4MMZ B;  1VQL 3;  3DGY A;  2HMM B;  4K1V A;  3T0U A;  1KC8 4;  3BNB A;  1N9E A;  1Q81 4;  1AR0 A;  2J8X B;  1VQM 3;  1SJW A;  3DGM A;  1PYL A;  5JPU A;  1FGQ A;  1NO3 A;  4GL6 A;  2CK3 H;  3GAX A;  4L8O A;  2CFL A;  1WMO A;  4KFD A;  1IVV A;  2W03 A;  1E3R A;  1QVG 2;  2XFT A;  1JBS A;  1IDP A;  1OGX A;  1IQX A;  3L0R A;  3LT9 A;  3CME 3;  5LC7 A;  4BTY A;  1UI8 A;  1G96 A;  3KFQ C;  3CCU 3;  1RN4 A;  1QMA A;  3HK4 A;  2ZA4 A;  3I0Y A;  4RZM A;  1D6Y A;  3Q1C A;  3B4O A;  3WA2 X;  4LSO A;  1VQ7 3;  3WOF B;  1UCL A;  4FMA A;  3G8Z A;  7RNT A;  1AVK A;  1NWW A;  1ZX2 A;  3FKA A;  4L7K A;  1ULJ B;  3PYJ A;  3WA3 A;  1OF5 B;  4BIR A;  3PCS A;  2C10 A;  3EJV A;  1ZO2 A;  3BND A;  3EN8 A;  1J2B A;  1BNF A;  4WYK B;  4LZI A;  5HGR A;  3OX9 A;  3BU4 A;  2F86 B;  3LTD A;  3CPW 2;  3CCM 3;  3OW2 2;  1OAC A;  3MSO A;  1GMQ A;  3SX1 A;  4XM4 A;  1B2U A;  3VSY A;  1A67 A;  3Q2P A;  3SVA A;  3V92 A;  2Y74 A;  4O8S A;  1BU4 A;  3D5I A;  1BRS A;  2WO0 A;  2GEY A;  1N5H A;  3F14 A;  2W56 A;  3KII A;  1FGR A;  1W6Y A;  1W4N A;  3CU3 A;  5G2G A;  1RGC A;  3JVC A;  1JB2 A;  3CNX A;  4HM2 B;  2L4V A;  4BTX A;  1PFP A;  2QEX 3;  5AIF A;  2CIU A;  1RDS A;  4XB5 A;  1O7N B;  4N6V 0;  1JBT A;  1RJO A;  2K54 A;  3FLJ A;  3GZY B;  2P0M A;  3LH4 A;  5IG0 A;  3QK9 A;  3G0K A;  3CCR 3;  3CCL 3;  4MJD A;  4IT7 A;  1GY6 A;  3NHX A;  3QRD A;  3MWZ A;  1R4Y A;  5BXQ A;  3NXJ A;  1Q82 4;  3WOE B;  1ASK A;  1I0V A;  1GY5 A;  5D83 A;  4K1U A;  4EW5 A;  3DM8 A;  3NQZ A;  1CYU A;  1BSD A;  2FXT A;  2HMN B;  1MGW A;  1KQS 2;  1JV2 B;  3ALA A;  3G16 A;  3RDE A;  3G4S 3;  2B24 B;  2O3O A;  2M7O A;  1NJI 4;  1M90 4;  1B27 A;  1EKM A;  2FGT A;  2GSP A;  4IPB A;  1V58 A;  1T2I A;  3OV4 A;  4FCM A;  1VZZ A;  3SLU A;  1YVB I;  2OQE A;  1HYF A;  5M1A A;  3GRD A;  4OVM A;  1MGR A;  4HJL B;  7STD A;  2ML5 A;  1A2V A;  1FUS A;  2KCD A;  2XF3 A;  3CC4 3;  1IK3 A;  2R41 A;  1BNE A;  6RNT A;  4N6U A;  1N8Q A;  3EHC A;  1RN1 A;  1T3B A;  1GS3 A;  1LVN A;  1IVW A;  1GOU A;  1YVS A;  3H3H A;  3ROB A;  3UJM A;  3FZW A;  1DMN A;  3U1W A;  1HU9 A;  1X1Y A;  2BIR A;  1CYV A;  2GU1 A;  5CXO A;  2P0X A;  2LQV A;  4HM4 B;  5HOH A;  1N5P A;  1LOX A;  3MPH A;  3OWU A;  3TDG A;  1OHO A;  1GD4 A;  3NUV A;  2RGQ A;  4HVN A;  1RNT A;  2CFG A;  5IF6 A;  1FGO A;  1B2S A;  3BLZ A;  2F98 A;  3S5C A;  5CF2 A;  5KP4 A;  1R4C A;  5LC6 A;  3F8H A;  1JKG A;  2BHM A;  1BUQ A;  3ZG5 A;  1SII A;  2CH9 A;  2YX9 A;  3T8U A;  2BNG A;  4NRE A;  3CCE 3;  4AKZ A;  3EE1 A;  1KSI A;  1VQK 3;  3F40 A;  4BL2 A;  4CPK A;  3G6E 3;  2CW9 A;  3I55 3;  1IV9 A;  3UL5 A;  1RSN A;  3FH1 A;  3DY5 A;  1FUT A;  1RGL A;  1O7H B;  5EEO A;  3RGA A;  3F7S A;  2I9W A;  4RBN A;  5DRE A;  1JRQ A;  3B8L A;  3DH2 A;  3NBJ A;  4BL3 A;  1K9M 4;  1YI2 3;  3SXX A;  5EQL A;  3AMO B;  2OCT A;  3FG4 A;  3X3Z A;  4EV5 A;  3LTC A;  2KF6 A;  3GZR A;  3SYU A;  1STF I;  1TFK A;  1OHS A;  3X3X A;  1YGW A;  1UUV B;  1W01 A;  1YJW 3;  3HX8 A;  5AI1 A;  3KN4 A;  4WHA A;  2K0M A;  4IIA A;  4EXR A;  1I0X A;  6GSP A;  1EA2 A;  1RGE A;  3O8Y A;  1I2G A;  1UW1 A;  3V98 A;  4KT3 B;  1MWS A;  5AYR B;  4J5G A;  4K90 B;  2F99 A;  4XDW A;  1ROA A;  6STD A;  1UGI A;  2GBX B;  2CWV A;  1B2X A;  1RGK A;  1NNV A;  1WMN A;  3MYT A;  1V57 A;  2RFR A;  5IEP A;  4HM8 B;  3S27 A;  2AAE A;  1KWI A;  3KZT A;  2O9U X;  3LTB A;  2BMQ B;  4ILF A;  1OF5 A;  1MWT A;  1V74 A;  1MWR A;  4NHF A;  4AKY A;  1RGH A;  4NPB A;  4KVH A;  1SPU A;  2A15 A;  3T8N A;  2E2V A;  2WGQ A;  1UI7 A;  1Q42 A;  3MKI A;  4XBY A;  5M19 A;  1YHQ 3;  1RCL A;  1U8C B;  2XSO B;  3EF8 A;  3FF2 A;  3K0Z A;  1T2H A;  2MC8 A;  1EG9 B;  3MG1 A;  1B20 A;  5AIG A;  3JUP A;  2YFL B;  3UL6 A;  1TFO A;  3N9H A;  3K5T A;  3URP A;  1BAN A;  3LXU X;  3SOY A;  1M1K 4;  2XR8 B;  4H61 A;  1BNI A;  1IU7 A;  3NBR A;  4RNT A;  4WFO A;  3NM2 A;  3CCQ 3;  1I3I A;  3WDG B;  1RLS A;  2XEP A;  1BGS A;  2Z7A A;  3HOH A;  2Z76 A;  2GXF A;  2IMJ A;  1S5A A;  2RCD A;  3EN1 B;  3HII A;  5JPP A;  2XGL A;  1E97 A;  5IG5 A;  3X41 A;  3D79 A;  2CWU A;  1G0T A;  5IW9 A;  3AGO A;  4G1M B;  1U5O A;  3B7C A;  4MMY B;  1AY7 A;  1N9J A;  1W5Z A;  2BO9 B;  2HML B;  3Q3F A;  4HOH A;  1TP6 A;  2H0I A;  4QWT A;  3VF1 A;  1JZO A;  3UB1 A;  3EBY A;  3NM7 A;  2HMO B;  5G1L A;  2L1S A;  3KKG A;  4O2H A;  1K8A 4;  1UDI I;  4FCZ A;  5I97 A;  1OUN A;  4XDV A;  3OWS A;  3PCR A;  4HKV B;  5KP3 A;  1RGF A;  4N6L A;  3WR2 A;  1DMQ A;  2W04 A;  4WP5 A;  1BNS A;  1GMP A;  1UGH I;  2W9P A;  4AEQ A;  2QA4 3;  5DRV A;  2OTJ 3;  3AHS A;  2PNC A;  1VQ8 3;  4K61 A;  1K28 A;  3BNC A;  2CWT A;  1JN5 A;  8RNT A;  3CCS 3;  3CPO A;  2D42 A;  3S28 A;  4CDL A;  1X1W A;  2QGU A;  3EB8 A;  5CK6 A;  3BNE A;  5EVH A;  5AEU B;  1OCV A;  1UUG B;  5AII A;  3JUQ A;  4HYZ A;  1S72 3;  1CEW I;  5ELU A;  1BSB A;  3DUK A;  2XSH B;  1RCK A;  4CCV A;  2QIY A;  4LMI A;  2P05 A;  1YIJ 3;  1NDO B;  5G1K A;  4J9A A;  1X1U A;  5CLK A;  2OOV C;  3EC9 A;  1VQ4 3;  3LML A;  4L8P A;  3NV0 B;  3HI7 A;  4HM6 B;  2GU3 A;  4EYC A;  1YJ9 3;  2W56 B;  3K9M C;  3ECF A;  1IVX A;  3H51 A;  3MG3 A;  5STD A;  5KP1 A;  1DVD A;  4OUQ A;  2IA7 A;  3M8C A;  4H3U A;  1Q7H A;  1GSP A;  1FA3 A;  1YNV X;  4OK0 A;  4JRF A;  2UGI A;  2W9Q A;  1TJD A;  3CC2 3;  1G02 A;  3A76 A;  2AAD A;  3LTA A;  2Z6B A;  3DXO A;  1BRG A;  1JJ2 2;  1BRN L;  1RGA A;  3N8B A;  1I8V A;  2H0H A;  2HOH A;  2CX0 A;  1VQO 3;  1DE3 A;  1I2E A;  3FG1 A;  4KFF A;  3LOY A;  2BT3 A;  4CJN A;  5AYS C;  5BU4 A;  3IMA B;  1TRP A;  1W02 A;  4BU4 A;  4HZ9 B;  1QVF 2;  1BUJ A;  1BRH A;  1DYU A;  1I2F A;  2LYX A;  3DGO A;  4GB5 A;  4EBG A;  1FGT A;  3F7X A;  4TX4 A;  2OTL 3;  2ZDJ A;  5TGN A;  5M18 A;  4FR9 A;  3PS8 A;  1M9G A;  1LQG C;  1QAK A;  3S29 A;  3FSD A;  1NB5 I;  4HBR A;  1L5G B;  2W2C A;  1OH0 A;  2XFS A;  5FGO A;  1YIT 3;  2W0Q A;  3CCV 3;  2IUK A;  1IVU A;  1W6C A;  3KSP A;  1GOY A;  5A0O B;  2CHC A;  1FYS A;  4MEI A;  3IJE B;  1RGG A;  1BSC A;  1WTH A;  4N6M A;  1FGM A;  2V1L A;  3N54 B;  2WGO A;  3OWY A;  4GHO A;  3EX9 A;  4KZ1 A;  5AEW B;  2WOH A;  1GOV A;  5BVB A;  1PU4 A;  3CMA 3;  4XBT A;  4N6O B;  2C11 A;  2CG1 A;  1RRH A;  4LYL B;  5IER A;  3ZG0 A;  2C4B A;  2E2T A;  4LEH A;  3DMC A;  1LRA A;  3D9R A;  2XGN A;  4R9K A;  1IT8 A;  4RNZ A;  1JKG B;  1AV4 A;  1RN7 A;  3VGN A;  1BVI A;  3CC7 3;  4FMB A;  2P38 A;  1UCK A;  1QJG A;  1A2K A;  1MNL A;  3BB9 A;  2BMR B;  4I5Q A;  3I56 3;  1BOX A;  5IG3 A;  2BMO B;  3EQQ B;  4J5K A;  4U13 A;  1BRJ A;  4WWU C;  3J7Y d;  1X1X A;  2Q07 A;  2RBI A;  2SBL A;  3DGL A;  1B2Z A;  3DGN A;  3GZB A;  4WYK A;  1JBR A;  2F4Y A;  4J8T A;  1GYB A;  4JF8 A;  2F56 A;  1ROV A;  1B2M A;  1MOL A;  1LQM B;  4DKI A;  1BIR A;  1EUI C;  3ZFZ A;  2SAR A;  1ULI B;  3D5G A;  1W6G A;  1BSE A;  1CQS A;  1HKX A;  3V99 A;  4HM5 B;  1Q40 B;  3K7C A;  1QAL A;  3DZL A;  4X2O A;  5FW5 A;  4EV2 A;  1IQY A;  1E3V A;  1PY3 A;  3D4A A;  3AHW A;  1TRQ A;  2F5W A;  3SED A;  1UUW B;  5CF1 A;  1RKY A;  2E2U A;  4N6T A;  2ZHX B;  2IUJ A;  2CKF B;  1BRK A;  3NQY A;  1SIH A;  1K73 4;  1VQQ A;  4RNY A;  4ORL A;  2HMK B;  1D6Z A;  1BAO A;  4HM7 B;  2F5M A;  5IG4 A;  2HMJ B;  2YFJ B;  3JUN A;  3CXC 2;  2GEX A;  1KD1 4;  3STD A;  4FMD A;  3WOD G;  1C7H A;  7GSP A;  1VQP 3;  1A2P A;  4KFE A;  2UUG C;  1JZD A;  3FCS B; 
#chains in the Genus database with same CATH homology
 1IYY A;  1RTU A;  1RSN A;  1FUT A;  1RGL A;  1PYL A;  5BIR A;  1GSP A;  1YNV X;  3DH2 A;  5RNT A;  1G02 A;  2AAD A;  1JBS A;  1RHL A;  2KF6 A;  1BRN L;  1BRG A;  3SYU A;  1LOV A;  1BNR A;  1Q9E A;  1RGA A;  1YGW A;  1I8V A;  2HOH A;  1RN4 A;  2BU4 A;  9RNT A;  2ZA4 A;  1DE3 A;  1I2E A;  5BU4 A;  1I0X A;  6GSP A;  1TRP A;  1UCL A;  1RGE A;  4BU4 A;  7RNT A;  1I2G A;  1BUJ A;  1BRH A;  1I2F A;  4J5G A;  4BIR A;  1DET A;  4HAA A;  1C54 A;  1BNF A;  3BU4 A;  1B2X A;  1RGK A;  3KCH A;  1GMQ A;  1B2U A;  1I3F A;  1FW7 A;  2AAE A;  1BSA A;  1BU4 A;  1GOY A;  3D5I A;  1BRS A;  1FYS A;  1RGG A;  4GSP A;  1BSC A;  1RGH A;  2KAA A;  1RMS A;  1RCL A;  1RGC A;  4GHO A;  1HZ1 A;  1GOV A;  1T2H A;  3A5E A;  1TTO A;  1LOW A;  1B20 A;  1RDS A;  1JBT A;  1BNG A;  3BIR A;  2C4B A;  3GSP A;  3URP A;  1BAN A;  1LRA A;  1R4Y A;  1I0V A;  1BNI A;  1BVI A;  1ZGX A;  4RNT A;  1BSD A;  1FZU A;  1UCK A;  1BNJ A;  1I3I A;  1RLS A;  1MGW A;  2RNT A;  1BGS A;  1UCI A;  3WHO A;  1GMR A;  3HOH A;  3RNT A;  1BOX A;  1B27 A;  4J5K A;  2GSP A;  1BRJ A;  1T2I A;  5GSP A;  3AGO A;  1X1X A;  1B21 A;  1HYF A;  2KF3 A;  2RBI A;  1B2Z A;  1AY7 A;  4HOH A;  3Q3F A;  1JBR A;  1BRI A;  2F4Y A;  1MGR A;  1FUS A;  2F56 A;  1B2M A;  1BNE A;  6RNT A;  1BIR A;  1RN1 A;  1I70 A;  1YVS A;  1CH0 A;  1GOU A;  1RGF A;  3WR2 A;  1RNB A;  1X1Y A;  2SAR A;  2BIR A;  1BNS A;  1GMP A;  3D5G A;  1BSE A;  3AHS A;  2KF5 A;  1AQZ A;  5HOH A;  3D4A A;  1PY3 A;  8RNT A;  3AHW A;  1TRQ A;  2F5W A;  1RNT A;  1X1W A;  1B3S A;  2KF4 A;  1B2S A;  1BRK A;  1BSB A;  1LOY A;  1SAR A;  1RCK A;  1UCJ A;  1LNI A;  1BAO A;  1X1U A;  3AGN A;  2F5M A;  3DGY A;  7GSP A;  1A2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...