1BSCA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRVLYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bscA00
1T2IA 5BIRA 1FUSA 1BSEA 1JBRA 3DGYA 1LNIA 1RDSA 4GSPA 1LOWA 1X1YA 1UCIA 1I0VA 1B2UA 2RNTA 1X1WA 3D5GA 1BUJA 3Q3FA 1AQZA 3HOHA 5HOHA 1BAOA 2AAEA 3AHSA 2F5WA 2AADA 2F4YA 1RCLA 1B27A 1T2HA 1BNEA 4GHOA 1GOVA 3BIRA 1BNJA 1SARA 1RLSA 1B2SA 1CH0A 1FYSA 2GSPA 6RNTA 1DETA 2KF3A 2F56A 1B21A 1RGAA 1B3SA 1BOXA 8RNTA 1B2MA 1X1XA 2BU4A 1DE3A 1FW7A 1BSBA 3D4AA 3DH2A 1GOYA 2ZA4A 1I70A 1FZUA 1R4YA 1TRQA 1RGEA 2BIRA 3BU4A 1HZ1A 3WR2A 7GSPA 1BSAA 3D5IA 1RN1A 1LOVA 1BRHA 1I2FA 9RNTA 1BGSA 1BIRA 1FUTA 4RNTA 1I2GA 2KAAA 1AY7A 2F5MA 1I2EA 3AGNA 1GSPA 1YGWA 3SYUA 1ZGXA 1BU4A 3RNTA 1B2ZA 1B2XA 1BRJA 1RGGA 1GOUA 2KF6A 1TRPA 1JBSA 2SARA 1A2PA 1RGHA 1BRKA 1RN4A 1TTOA 1BNIA 3AGOA 1C54A 1Q9EA 3AHWA 1MGRA 1RGCA 1BVIA 1PY3A 1YVSA 1HYFA 5GSPA 1I3IA 1BRNL 1I8VA 4J5KA 2C4BA 1RHLA 1LRAA 1YNVX 1RSNA 1X1UA 2KF4A 1PYLA 3KCHA 4HOHA 1UCJA 1I0XA 1BRIA 1BRSA 1GMRA 4J5GA 1B20A 5RNTA 1GMPA 1RTUA 1BANA 1MGWA 1RCKA 1IYYA 1BNFA 1BNRA 1RNBA 3URPA 1RGLA 1BSCA 1BNSA 1JBTA 6GSPA 1BSDA 1BRGA 3WHOA 1UCKA 4BIRA 1RMSA 5BU4A 2HOHA 1BNGA 7RNTA 4BU4A 1GMQA 1RGKA 3GSPA 3A5EA 4HAAA 2KF5A 1I3FA 1RGFA 1UCLA 2RBIA 1LOYA 1RNTA 1G02A
chains in the Genus database with same CATH superfamily
4N6OB 3WODG 1T2IA 1FGRA 4CPKA 1JBRA 4GSPA 2BO9B 1JB4A 2QGUA 2IMJA 1LOWA 3NV0B 4KVHA 6STDA 1YHQ3 1UCIA 1I0VA 3PGBA 2RNTA 1NNVA 1DVDA 1FGOA 2GBWB 2AAEA 2HMLB 3KFQC 2CFGA 1NO3A 2F5WA 1MWRA 1EKMA 2AADA 2P09A 3FG3A 2A15A 1O7GB 2O3OA 2ML6A 1T2HA 3F8HA 1BNEA 3TDGA 3EQQB 1GOVA 1WTHA 2ML5A 3HIIA 2HMMB 2YFJB 2WOHA 1IQYA 1SARA 1W02A 1RLSA 3VF1A 2W03A 3S28A 1JNQA 4XBTA 1CH0A 3K5TA 2KF3A 3HX8A 4H3UA 2CC3A 3OV4A 1RGAA 1K8A4 1ROAA 1E3VA 1X1XA 3DZLA 1M904 2BU4A 1DE3A 5EQLA 1HU9A 4EV5A 1N5PA 3F7SA 1UUVB 5EEOA 1IV7A 2GBXB 3OWYA 2CG0A 4R4KA 3NBJA 3I553 1RRLA 5TGNA 3EBYA 2M7OA 1W2B2 1ROVA 3DGMA 5KP4A 4FCMA 3F9SA 9RNTA 4NPBA 2OQEA 1IV9A 4IIAA 2E2VA 1VQP3 1FGQA 2XRXB 1Q40A 1AY7A 3BNCA 4BTYA 1I2EA 3AGNA 4LYLB 1JJ22 1ZGXA 3NXJA 4HM1B 1WQLB 1NDOB 2FXTA 3BNEA 3PCRA 3RNTA 3VSYA 1BRJA 1QVF2 1IVWA 1RGGA 1UUWB 3T0UA 1UDII 3ALAA 3OXAA 3PYJA 1JBSA 1A2PA 4R1KA 1RGHA 1ZO2A 3AMOB 5LC6A 1RN4A 1GYBA 1TTOA 2K0MA 3FKAA 2W56A 2QIYA 3QRDA 3MG2A 1UI8A 2IYJA 1PFPA 3SX1A 1E97A 1BVIA 1STFI 1N5HA 3RGAA 1U5OA 4HJLB 1BRNL 2C4BA 4FCZA 4HM8B 3NV0A 1TUHA 4GL6A 1OHOA 5I97A 1O7MB 2BMOB 3NQYA 1LRAA 1OHPA 2WGOA 4HOHA 4L8PA 1I0XA 1BRIA 1BRSA 5BVBA 3CCM3 1RKYA 1TJDA 2W2CA 2ZHXB 5RNTA 5ELJA 4WYKB 3QK9A 1KD14 4FR9A 1JN5B 1BANA 1Q7HA 1RTUA 3T8NA 1RCKA 3ROBA 4HVNA 2W6JH 3NQZA 4BTXA 3CME3 5IW9A 1BNRA 1RNBA 1IDPA 1IT8A 2F99A 1BSCA 3X3XA 1VQ93 1OACA 2IA7A 1SIHA 2XSHB 4FCJA 1FA3A 4NREA 1Q814 2CIUA 2XR8B 1IQ8A 1RMSA 1E3RA 3D79A 3IPTA 1BNGA 4WP5A 4BU4A 1ASKA 3BNBA 3NHXA 3D9RA 1RGKA 4H61A 5G1KA 3Q2PA 3FZWA 1AV4A 2KF5A 1RGFA 1OUNA 4N6TA 4RBNA 1A67A 2B24B 3SVAA 3FF0A 3UJMA 3CCV3 1G02A 2JDIH 3RDEA 1KSIA 1FUSA 3H51A 1LNIA 3G6E3 4O8SA 1B2UA 4HYZA 3D5GA 5IENA 1AQZA 3HOHA 3O8YA 1BAOA 3KSPA 3G8ZA 4N6MA 3ZG5A 3KKGA 2HMKB 2KXGA 5KP1A 1SPUA 3DM8A 1O7WB 5AYRB 1VQ43 1Q40B 3G16A 2KRTA 2GU1A 3B4OA 2LYXA 3MKIA 2HMJB 4O2HA 3LT8A 2OTL3 4MMZB 3Q1CA 4HM4B 1VQ53 4HKVB 1RJOA 1FYSA 2OCTA 5IG4A 3CPW2 6RNTA 2OQEC 5IEPA 5IEOA 1IK3A 3V98A 2GXFA 1B2MA 2F86B 2I9WA 8RNTA 1W2ZA 1GS3A 3MG3A 1GD3A 2P38A 1OGZA 3CU3A 2E2UA 1CEWI 3D4AA 4LGQA 1TP6A 2JQ5A 3B4PA 3KSED 2K54A 1GOYA 3MG1A 4N6UA 2ZA4A 1TRQA 1FZUA 1W00A 3E99A 2UGIA 5HGRA 2BMQB 4Q53A 1DMQA 5D82A 1IU7A 2BNGA 1JV2B 2CFKA 5D81A 5CK6A 3ZFZA 1ULIB 2GEYA 3AMOA 1LOVA 1BRHA 1I2FA 3X42A 3K0ZA 2STDA 2KAAA 3LTAA 1YIJ3 3SXXA 1M1XB 3G4S3 1N8QA 2CFWA 2F5MA 2XH9A 1LNHA 1BU4A 1LQMB 1OH0A 3U97A 3PXMA 1B2ZA 3UNLA 2KF6A 1CQSA 1TRPA 4KZ1A 2D1WA 4HBRA 1JKGB 2YX9A 1FUWA 1T3BA 1V74A 8CHOA 5IERA 5AEWB 1MGRA 5AI1A 2PNCA 1YVSA 1HYFA 2CKFB 3WOFB 3L0RA 3EN8A 2J8XB 3LMLA 4J5KA 3T8UA 1QAKA 4N6LA 3I563 1L5GB 1IT7A 1OGXA 1RSNA 4WFOA 2ZDJA 4LMIA 2XGNA 3X3YA 1UW1A 1UCJA 1OF5A 1WNHA 3D3LA 3V92A 1GMRA 4J5GA 1IVXA 2C11A 2KCDA 1HKXA 1DMNA 3I0YA 1OCVA 4XDVA 3CXC2 2CW9A 1IYYA 4K90B 2CFDA 3WDGB 1W5ZA 1CYVA 1CYUA 1JB2A 2BT3A 3BLZA 3URPA 1RGLA 1A2VA 1BNSA 2FNQA 3CNXA 2CH9A 3KE7A 1BSDA 3EN1B 3WHOA 1GD4A 4X2HA 2CK3H 4RNZA 2MC8A 3K9MC 2L1SA 7RNTA 4WHAA 1DMMA 2W04A 4TX4A 4L8OA 3F40A 3GZBA 4O3VA 4OVMA 3A5EA 4GB5A 1UCLA 1STDA 3FG4A 4CDLA 2WOFA 3JUOA 4FMCA 1O7NB 3GZRA 4HM6B 1YJ93 3ECFA 1ZS7A 2XSOB 4KFFA 1ULJB 1M1K4 3DGYA 1RDSA 1W6GA 2GEXA 3MPHA 5A0OB 4RNYA 2XEPA 1X1YA 2QEX3 2FGTA 1T5YA 2K3DA 4IT7A 4KFEA 1JZOA 3DGLA 1LOXA 1OF5B 1N9EA 3AHSA 1KQS2 1ISKA 2D42A 5M19A 4BL2A 3CCJ3 2QA43 1SIIA 1MOLA 2O9UX 5BXQA 2CX1A 3LYGA 2F4YA 1VQM3 1B27A 3NM7A 5EVHA 3UL5A 1J2BA 3IMAB 4LZIA 3CCS3 3NM2A 1JZDA 1Q42A 3BIRA 5JPPA 1BNJA 3LOYA 5JBSA 4EXRA 3V99A 3N54B 1S5AA 3OX9A 4OUQA 3NUVA 1DETA 5IG3A 1BOXA 4WWUC 4RZMA 1TFOA 3N9HA 1QMAA 1FGTA 2P0MA 5CF1A 4U13A 3S5CA 1IVUA 4BL3A 2BIRA 1EUIC 1TIJA 3A76A 4N3VA 5G1LA 3WA2X 4HM5B 3LH4A 3BU4A 3VGNA 2RFRA 3X3ZA 1US1A 3MWZA 3STDA 1BSAA 1RN1A 2IY2A 3JUMA 3EX9A 1TFKA 1BGSA 1BIRA 4STDA 1U8CB 2H0IA 3PS8A 4IPBA 3CC43 5AIHA 3SOYA 2W9QA 1YJN3 4CJNA 1KC84 3JVCA 3MHEA 3FCSB 2Z7AA 1GSPA 1YGWA 3EJVA 3B8LA 5IG0A 1VQ83 1FGMA 2OOVA 1GOUA 4I5QA 3K7CA 2SARA 3NX0A 4K1VA 2CX0A 4K61A 2OTJ3 1QALA 3GAXA 5AIGA 4N6V0 4MJDA 1GY7A 1C54A 1Q9EA 1K41A 3CCR3 3AHWA 1RGCA 3G0KA 2R41A 1G96A 1JB5A 4I4KA 5GSPA 3DXOA 1I3IA 1DYUA 1UI7A 2Z6BA 1JN5A 1I8VA 3LTDA 3PZWA 2LQVA 2CG1A 1RHLA 3SEDA 3X41A 3UB1A 3CMA3 2B1XB 1KWIA 3KIIA 1X1UA 1D6UA 2KF4A 5FGOA 1GY5A 3KCHA 2RSXA 5DRVA 3MSOA 3HIGA 2XF3A 1EEJA 2INXA 1MWSA 1B20A 4HM2B 1JKGA 1IVVA 3B7CA 1SJWA 2BMRB 1MGWA 2P05A 3BB9A 3FH1A 4EBGA 1YI23 1NU3A 1SQWA 1RN7A 3F7XA 3LTCA 4EYCA 5M18A 2Z77A 4PEJA 5AEUB 4KFDA 1K734 3JUNA 4XB5A 2OWPA 4NHFA 1R4CA 3EF8A 3WMDA 3G713 1M9GA 2IUJA 1YGEA 1UCKA 1UGHI 4BIRA 1EG9B 1AR0A 3HZPA 5BU4A 3OW22 1NB3I 2W0QA 3F8XA 3CC23 1V58A 4HM3B 1VQN3 4G1MB 3GSPA 1W4NA 1WMOA 4OK0A 2HMOB 1I3FA 4X2OA 4AKZA 2WO0A 1WMPA 1C7HA 3NBBA 1A90A 1LOYA 4R9KA 1RNTA 4JRFA 2UX0A 5CF2A 1W6CA 1A2KA 1O7HB 5BIRA 1BSEA 2Y73A 3FLJA 3MYTA 1NJI4 2V1LA 1QAFA 5M1AA 5D83A 5AIFA 3X40A 5STDA 4CCVA 1VQ73 1O7PB 1X1WA 2PZVA 1BUJA 3Q3FA 4LEHA 1F8NA 5HOHA 1JRQA 3EB8A 1Q864 3DMCA 1MWTA 3OWSA 3S29A 3CCL3 3GWRA 1RCLA 4J8TA 1W6YA 2H0HA 3ER7A 2W9PA 4GHOA 2C10A 1QVG2 1GY6A 1VQ63 4MMXB 3DGNA 1UUGB 1YIT3 5KP3A 4WYKA 3H3HA 3JUPA 7STDA 2OOVC 1YJW3 2Y74A 1MNLA 1B2SA 2ZL8A 3CNMA 3IJEB 3GZXB 4HM0B 3SLUA 1Q824 2GSPA 3EE1A 3KN4A 1N8R4 2F56A 1LVNA 1B21A 2XFSA 1B3SA 1K28A 4DKIA 3HI7A 3EHCA 3RGRA 2MF7A 5FW5A 1FW7A 1BSBA 2R4IA 3DH2A 4AKYA 1TU5A 3CC73 2CFLA 1EQKA 2Z76A 4HZBB 4R80A 3KZTA 1I70A 3GZYB 1R4YA 3FGYA 1RGEA 3HK4A 5ELUA 3N8BA 4ILFA 1HZ1A 1ZX2A 1Q7Y4 3WR2A 4L7KA 7GSPA 1NB5I 2W56B 1IQXA 3D5IA 2Q07A 3EBTA 3U1WA 3F14A 3CCE3 1FUTA 4RNTA 1I2GA 4HM7B 4MEIA 4KT3B 3OWUA 2WGQA 1LQGC 3FG1A 3SYUA 2CWTA 2CWUA 3GRDA 3K63A 1MWUA 4XM4A 1AVLA 2HMNB 3WOEB 3WA3A 1B2XA 2IUKA 5CXOA 3S27A 1BUQA 4ORLA 1YVBI 1BRKA 1DVCA 3AGOA 1BNIA 5IG5A 1V57A 3BNDA 1QJGA 1S723 4QWTA 3LZAA 3JUQA 4XBYA 1VQO3 1PY3A 2YFIB 2YFLB 5CLKA 1D6ZA 1N9JA 3LTBA 4FMDA 5G2GA 3S67A 4ZM8A 3DUKA 4JF8A 1UGIA 3M8CA 3FSDA 4LSOA 1YNVX 2GU3A 4O02B 4EW5A 1PYLA 3J7Yd 5JPUA 3CPOA 1NWWA 1W7CA 2RCDA 4K1UA 4BTWA 5AYSC 1WMNA 1OPYA 2CWVA 4EC6A 4AEQA 2CHCA 1GMPA 4HZ9B 4FMAA 2RGQA 1BNFA 2L4VA 5LC7A 1AVKA 1EA2A 4J9AA 1Z1SA 1Y4KA 3DGOA 1PU4A 1VQK3 2F98A 3Q90A 1JBTA 6GSPA 5IF6A 3LXUX 4XBXA 3UL6A 1LXEA 1BRGA 2P0XA 4FMBA 3CCU3 4EV2A 3SOAA 2BHMA 1VQL3 1VQQA 1VZZA 3PCSA 3NBRA 2HOHA 4MMYB 1D6YA 5DREA 3ZG0A 3DY5A 1G0TA 5AIIA 3LT9A 1GMQA 1W01A 3FF2A 4HAAA 3CD63 4XDWA 1OHSA 1RRHA 4N6NB 2XFTA 2UUGC 3CCQ3 2E2TA 2SBLA 1K9M4 4R9LA 2RBIA 2XGLA 2H0GA 3EC9A
chains in the Genus database with same CATH topology
1T2IA 5BIRA 1FUSA 1BSEA 1JBRA 3DGYA 1LNIA 1RDSA 4GSPA 1LOWA 1X1YA 1UCIA 1I0VA 1B2UA 2RNTA 1X1WA 3D5GA 1BUJA 3Q3FA 1AQZA 3HOHA 5HOHA 1BAOA 2AAEA 3AHSA 2F5WA 2AADA 2F4YA 1RCLA 1B27A 1T2HA 1BNEA 4GHOA 1GOVA 3BIRA 1BNJA 1SARA 1RLSA 1B2SA 1CH0A 1FYSA 2GSPA 6RNTA 1DETA 2KF3A 2F56A 1B21A 1RGAA 1B3SA 1BOXA 8RNTA 1B2MA 1X1XA 2BU4A 1DE3A 1FW7A 1BSBA 3D4AA 3DH2A 1GOYA 2ZA4A 1I70A 1FZUA 1R4YA 1TRQA 1RGEA 2BIRA 3BU4A 1HZ1A 3WR2A 7GSPA 1BSAA 3D5IA 1RN1A 1LOVA 1BRHA 1I2FA 9RNTA 1BGSA 1BIRA 1FUTA 4RNTA 1I2GA 2KAAA 1AY7A 2F5MA 1I2EA 3AGNA 1GSPA 1YGWA 3SYUA 1ZGXA 1BU4A 3RNTA 1B2ZA 1B2XA 1BRJA 1RGGA 1GOUA 2KF6A 1TRPA 1JBSA 2SARA 1A2PA 1RGHA 1BRKA 1RN4A 1TTOA 1BNIA 3AGOA 1C54A 1Q9EA 3AHWA 1MGRA 1RGCA 1BVIA 1PY3A 1YVSA 1HYFA 5GSPA 1I3IA 1BRNL 1I8VA 4J5KA 2C4BA 1RHLA 1LRAA 1YNVX 1RSNA 1X1UA 2KF4A 1PYLA 3KCHA 4HOHA 1UCJA 1I0XA 1BRIA 1BRSA 1GMRA 4J5GA 1B20A 5RNTA 1GMPA 1RTUA 1BANA 1MGWA 1RCKA 1IYYA 1BNFA 1BNRA 1RNBA 3URPA 1RGLA 1BSCA 1BNSA 1JBTA 6GSPA 1BSDA 1BRGA 3WHOA 1UCKA 4BIRA 1RMSA 5BU4A 2HOHA 1BNGA 7RNTA 4BU4A 1GMQA 1RGKA 3GSPA 3A5EA 4HAAA 2KF5A 1I3FA 1RGFA 1UCLA 2RBIA 1LOYA 1RNTA 1G02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2I A;  5BIR A;  1FUS A;  1BSE A;  1JBR A;  3DGY A;  1LNI A;  1RDS A;  4GSP A;  1LOW A;  1X1Y A;  1UCI A;  1I0V A;  1B2U A;  2RNT A;  1X1W A;  3D5G A;  1BUJ A;  3Q3F A;  1AQZ A;  3HOH A;  5HOH A;  1BAO A;  2AAE A;  3AHS A;  2F5W A;  2AAD A;  2F4Y A;  1RCL A;  1B27 A;  1T2H A;  1BNE A;  4GHO A;  1GOV A;  3BIR A;  1BNJ A;  1SAR A;  1RLS A;  1B2S A;  1CH0 A;  1FYS A;  2GSP A;  6RNT A;  1DET A;  2KF3 A;  2F56 A;  1B21 A;  1RGA A;  1B3S A;  1BOX A;  8RNT A;  1B2M A;  1X1X A;  2BU4 A;  1DE3 A;  1FW7 A;  1BSB A;  3D4A A;  3DH2 A;  1GOY A;  2ZA4 A;  1I70 A;  1FZU A;  1R4Y A;  1TRQ A;  1RGE A;  2BIR A;  3BU4 A;  1HZ1 A;  3WR2 A;  7GSP A;  1BSA A;  3D5I A;  1RN1 A;  1LOV A;  1BRH A;  1I2F A;  9RNT A;  1BGS A;  1BIR A;  1FUT A;  4RNT A;  1I2G A;  2KAA A;  1AY7 A;  2F5M A;  1I2E A;  3AGN A;  1GSP A;  1YGW A;  3SYU A;  1ZGX A;  1BU4 A;  3RNT A;  1B2Z A;  1B2X A;  1BRJ A;  1RGG A;  1GOU A;  2KF6 A;  1TRP A;  1JBS A;  2SAR A;  1A2P A;  1RGH A;  1BRK A;  1RN4 A;  1TTO A;  1BNI A;  3AGO A;  1C54 A;  1Q9E A;  3AHW A;  1MGR A;  1RGC A;  1BVI A;  1PY3 A;  1YVS A;  1HYF A;  5GSP A;  1I3I A;  1BRN L;  1I8V A;  4J5K A;  2C4B A;  1RHL A;  1LRA A;  1YNV X;  1RSN A;  1X1U A;  2KF4 A;  1PYL A;  3KCH A;  4HOH A;  1UCJ A;  1I0X A;  1BRI A;  1BRS A;  1GMR A;  4J5G A;  1B20 A;  5RNT A;  1GMP A;  1RTU A;  1BAN A;  1MGW A;  1RCK A;  1IYY A;  1BNF A;  1BNR A;  1RNB A;  3URP A;  1RGL A;  1BSC A;  1BNS A;  1JBT A;  6GSP A;  1BSD A;  1BRG A;  3WHO A;  1UCK A;  4BIR A;  1RMS A;  5BU4 A;  2HOH A;  1BNG A;  7RNT A;  4BU4 A;  1GMQ A;  1RGK A;  3GSP A;  3A5E A;  4HAA A;  2KF5 A;  1I3F A;  1RGF A;  1UCL A;  2RBI A;  1LOY A;  1RNT A;  1G02 A; 
#chains in the Genus database with same CATH topology
 4N6O B;  3WOD G;  1T2I A;  1FGR A;  4CPK A;  1JBR A;  4GSP A;  2BO9 B;  1JB4 A;  2QGU A;  2IMJ A;  1LOW A;  3NV0 B;  4KVH A;  6STD A;  1YHQ 3;  1UCI A;  1I0V A;  3PGB A;  2RNT A;  1NNV A;  1DVD A;  1FGO A;  2GBW B;  2AAE A;  2HML B;  3KFQ C;  2CFG A;  1NO3 A;  2F5W A;  1MWR A;  1EKM A;  2AAD A;  2P09 A;  3FG3 A;  2A15 A;  1O7G B;  2O3O A;  2ML6 A;  1T2H A;  3F8H A;  1BNE A;  3TDG A;  3EQQ B;  1GOV A;  1WTH A;  2ML5 A;  3HII A;  2HMM B;  2YFJ B;  2WOH A;  1IQY A;  1SAR A;  1W02 A;  1RLS A;  3VF1 A;  2W03 A;  3S28 A;  1JNQ A;  4XBT A;  1CH0 A;  3K5T A;  2KF3 A;  3HX8 A;  4H3U A;  2CC3 A;  3OV4 A;  1RGA A;  1K8A 4;  1ROA A;  1E3V A;  1X1X A;  3DZL A;  1M90 4;  2BU4 A;  1DE3 A;  5EQL A;  1HU9 A;  4EV5 A;  1N5P A;  3F7S A;  1UUV B;  5EEO A;  1IV7 A;  2GBX B;  3OWY A;  2CG0 A;  4R4K A;  3NBJ A;  3I55 3;  1RRL A;  5TGN A;  3EBY A;  2M7O A;  1W2B 2;  1ROV A;  3DGM A;  5KP4 A;  4FCM A;  3F9S A;  9RNT A;  4NPB A;  2OQE A;  1IV9 A;  4IIA A;  2E2V A;  1VQP 3;  1FGQ A;  2XRX B;  1Q40 A;  1AY7 A;  3BNC A;  4BTY A;  1I2E A;  3AGN A;  4LYL B;  1JJ2 2;  1ZGX A;  3NXJ A;  4HM1 B;  1WQL B;  1NDO B;  2FXT A;  3BNE A;  3PCR A;  3RNT A;  3VSY A;  1BRJ A;  1QVF 2;  1IVW A;  1RGG A;  1UUW B;  3T0U A;  1UDI I;  3ALA A;  3OXA A;  3PYJ A;  1JBS A;  1A2P A;  4R1K A;  1RGH A;  1ZO2 A;  3AMO B;  5LC6 A;  1RN4 A;  1GYB A;  1TTO A;  2K0M A;  3FKA A;  2W56 A;  2QIY A;  3QRD A;  3MG2 A;  1UI8 A;  2IYJ A;  1PFP A;  3SX1 A;  1E97 A;  1BVI A;  1STF I;  1N5H A;  3RGA A;  1U5O A;  4HJL B;  1BRN L;  2C4B A;  4FCZ A;  4HM8 B;  3NV0 A;  1TUH A;  4GL6 A;  1OHO A;  5I97 A;  1O7M B;  2BMO B;  3NQY A;  1LRA A;  1OHP A;  2WGO A;  4HOH A;  4L8P A;  1I0X A;  1BRI A;  1BRS A;  5BVB A;  3CCM 3;  1RKY A;  1TJD A;  2W2C A;  2ZHX B;  5RNT A;  5ELJ A;  4WYK B;  3QK9 A;  1KD1 4;  4FR9 A;  1JN5 B;  1BAN A;  1Q7H A;  1RTU A;  3T8N A;  1RCK A;  3ROB A;  4HVN A;  2W6J H;  3NQZ A;  4BTX A;  3CME 3;  5IW9 A;  1BNR A;  1RNB A;  1IDP A;  1IT8 A;  2F99 A;  1BSC A;  3X3X A;  1VQ9 3;  1OAC A;  2IA7 A;  1SIH A;  2XSH B;  4FCJ A;  1FA3 A;  4NRE A;  1Q81 4;  2CIU A;  2XR8 B;  1IQ8 A;  1RMS A;  1E3R A;  3D79 A;  3IPT A;  1BNG A;  4WP5 A;  4BU4 A;  1ASK A;  3BNB A;  3NHX A;  3D9R A;  1RGK A;  4H61 A;  5G1K A;  3Q2P A;  3FZW A;  1AV4 A;  2KF5 A;  1RGF A;  1OUN A;  4N6T A;  4RBN A;  1A67 A;  2B24 B;  3SVA A;  3FF0 A;  3UJM A;  3CCV 3;  1G02 A;  2JDI H;  3RDE A;  1KSI A;  1FUS A;  3H51 A;  1LNI A;  3G6E 3;  4O8S A;  1B2U A;  4HYZ A;  3D5G A;  5IEN A;  1AQZ A;  3HOH A;  3O8Y A;  1BAO A;  3KSP A;  3G8Z A;  4N6M A;  3ZG5 A;  3KKG A;  2HMK B;  2KXG A;  5KP1 A;  1SPU A;  3DM8 A;  1O7W B;  5AYR B;  1VQ4 3;  1Q40 B;  3G16 A;  2KRT A;  2GU1 A;  3B4O A;  2LYX A;  3MKI A;  2HMJ B;  4O2H A;  3LT8 A;  2OTL 3;  4MMZ B;  3Q1C A;  4HM4 B;  1VQ5 3;  4HKV B;  1RJO A;  1FYS A;  2OCT A;  5IG4 A;  3CPW 2;  6RNT A;  2OQE C;  5IEP A;  5IEO A;  1IK3 A;  3V98 A;  2GXF A;  1B2M A;  2F86 B;  2I9W A;  8RNT A;  1W2Z A;  1GS3 A;  3MG3 A;  1GD3 A;  2P38 A;  1OGZ A;  3CU3 A;  2E2U A;  1CEW I;  3D4A A;  4LGQ A;  1TP6 A;  2JQ5 A;  3B4P A;  3KSE D;  2K54 A;  1GOY A;  3MG1 A;  4N6U A;  2ZA4 A;  1TRQ A;  1FZU A;  1W00 A;  3E99 A;  2UGI A;  5HGR A;  2BMQ B;  4Q53 A;  1DMQ A;  5D82 A;  1IU7 A;  2BNG A;  1JV2 B;  2CFK A;  5D81 A;  5CK6 A;  3ZFZ A;  1ULI B;  2GEY A;  3AMO A;  1LOV A;  1BRH A;  1I2F A;  3X42 A;  3K0Z A;  2STD A;  2KAA A;  3LTA A;  1YIJ 3;  3SXX A;  1M1X B;  3G4S 3;  1N8Q A;  2CFW A;  2F5M A;  2XH9 A;  1LNH A;  1BU4 A;  1LQM B;  1OH0 A;  3U97 A;  3PXM A;  1B2Z A;  3UNL A;  2KF6 A;  1CQS A;  1TRP A;  4KZ1 A;  2D1W A;  4HBR A;  1JKG B;  2YX9 A;  1FUW A;  1T3B A;  1V74 A;  8CHO A;  5IER A;  5AEW B;  1MGR A;  5AI1 A;  2PNC A;  1YVS A;  1HYF A;  2CKF B;  3WOF B;  3L0R A;  3EN8 A;  2J8X B;  3LML A;  4J5K A;  3T8U A;  1QAK A;  4N6L A;  3I56 3;  1L5G B;  1IT7 A;  1OGX A;  1RSN A;  4WFO A;  2ZDJ A;  4LMI A;  2XGN A;  3X3Y A;  1UW1 A;  1UCJ A;  1OF5 A;  1WNH A;  3D3L A;  3V92 A;  1GMR A;  4J5G A;  1IVX A;  2C11 A;  2KCD A;  1HKX A;  1DMN A;  3I0Y A;  1OCV A;  4XDV A;  3CXC 2;  2CW9 A;  1IYY A;  4K90 B;  2CFD A;  3WDG B;  1W5Z A;  1CYV A;  1CYU A;  1JB2 A;  2BT3 A;  3BLZ A;  3URP A;  1RGL A;  1A2V A;  1BNS A;  2FNQ A;  3CNX A;  2CH9 A;  3KE7 A;  1BSD A;  3EN1 B;  3WHO A;  1GD4 A;  4X2H A;  2CK3 H;  4RNZ A;  2MC8 A;  3K9M C;  2L1S A;  7RNT A;  4WHA A;  1DMM A;  2W04 A;  4TX4 A;  4L8O A;  3F40 A;  3GZB A;  4O3V A;  4OVM A;  3A5E A;  4GB5 A;  1UCL A;  1STD A;  3FG4 A;  4CDL A;  2WOF A;  3JUO A;  4FMC A;  1O7N B;  3GZR A;  4HM6 B;  1YJ9 3;  3ECF A;  1ZS7 A;  2XSO B;  4KFF A;  1ULJ B;  1M1K 4;  3DGY A;  1RDS A;  1W6G A;  2GEX A;  3MPH A;  5A0O B;  4RNY A;  2XEP A;  1X1Y A;  2QEX 3;  2FGT A;  1T5Y A;  2K3D A;  4IT7 A;  4KFE A;  1JZO A;  3DGL A;  1LOX A;  1OF5 B;  1N9E A;  3AHS A;  1KQS 2;  1ISK A;  2D42 A;  5M19 A;  4BL2 A;  3CCJ 3;  2QA4 3;  1SII A;  1MOL A;  2O9U X;  5BXQ A;  2CX1 A;  3LYG A;  2F4Y A;  1VQM 3;  1B27 A;  3NM7 A;  5EVH A;  3UL5 A;  1J2B A;  3IMA B;  4LZI A;  3CCS 3;  3NM2 A;  1JZD A;  1Q42 A;  3BIR A;  5JPP A;  1BNJ A;  3LOY A;  5JBS A;  4EXR A;  3V99 A;  3N54 B;  1S5A A;  3OX9 A;  4OUQ A;  3NUV A;  1DET A;  5IG3 A;  1BOX A;  4WWU C;  4RZM A;  1TFO A;  3N9H A;  1QMA A;  1FGT A;  2P0M A;  5CF1 A;  4U13 A;  3S5C A;  1IVU A;  4BL3 A;  2BIR A;  1EUI C;  1TIJ A;  3A76 A;  4N3V A;  5G1L A;  3WA2 X;  4HM5 B;  3LH4 A;  3BU4 A;  3VGN A;  2RFR A;  3X3Z A;  1US1 A;  3MWZ A;  3STD A;  1BSA A;  1RN1 A;  2IY2 A;  3JUM A;  3EX9 A;  1TFK A;  1BGS A;  1BIR A;  4STD A;  1U8C B;  2H0I A;  3PS8 A;  4IPB A;  3CC4 3;  5AIH A;  3SOY A;  2W9Q A;  1YJN 3;  4CJN A;  1KC8 4;  3JVC A;  3MHE A;  3FCS B;  2Z7A A;  1GSP A;  1YGW A;  3EJV A;  3B8L A;  5IG0 A;  1VQ8 3;  1FGM A;  2OOV A;  1GOU A;  4I5Q A;  3K7C A;  2SAR A;  3NX0 A;  4K1V A;  2CX0 A;  4K61 A;  2OTJ 3;  1QAL A;  3GAX A;  5AIG A;  4N6V 0;  4MJD A;  1GY7 A;  1C54 A;  1Q9E A;  1K41 A;  3CCR 3;  3AHW A;  1RGC A;  3G0K A;  2R41 A;  1G96 A;  1JB5 A;  4I4K A;  5GSP A;  3DXO A;  1I3I A;  1DYU A;  1UI7 A;  2Z6B A;  1JN5 A;  1I8V A;  3LTD A;  3PZW A;  2LQV A;  2CG1 A;  1RHL A;  3SED A;  3X41 A;  3UB1 A;  3CMA 3;  2B1X B;  1KWI A;  3KII A;  1X1U A;  1D6U A;  2KF4 A;  5FGO A;  1GY5 A;  3KCH A;  2RSX A;  5DRV A;  3MSO A;  3HIG A;  2XF3 A;  1EEJ A;  2INX A;  1MWS A;  1B20 A;  4HM2 B;  1JKG A;  1IVV A;  3B7C A;  1SJW A;  2BMR B;  1MGW A;  2P05 A;  3BB9 A;  3FH1 A;  4EBG A;  1YI2 3;  1NU3 A;  1SQW A;  1RN7 A;  3F7X A;  3LTC A;  4EYC A;  5M18 A;  2Z77 A;  4PEJ A;  5AEU B;  4KFD A;  1K73 4;  3JUN A;  4XB5 A;  2OWP A;  4NHF A;  1R4C A;  3EF8 A;  3WMD A;  3G71 3;  1M9G A;  2IUJ A;  1YGE A;  1UCK A;  1UGH I;  4BIR A;  1EG9 B;  1AR0 A;  3HZP A;  5BU4 A;  3OW2 2;  1NB3 I;  2W0Q A;  3F8X A;  3CC2 3;  1V58 A;  4HM3 B;  1VQN 3;  4G1M B;  3GSP A;  1W4N A;  1WMO A;  4OK0 A;  2HMO B;  1I3F A;  4X2O A;  4AKZ A;  2WO0 A;  1WMP A;  1C7H A;  3NBB A;  1A90 A;  1LOY A;  4R9K A;  1RNT A;  4JRF A;  2UX0 A;  5CF2 A;  1W6C A;  1A2K A;  1O7H B;  5BIR A;  1BSE A;  2Y73 A;  3FLJ A;  3MYT A;  1NJI 4;  2V1L A;  1QAF A;  5M1A A;  5D83 A;  5AIF A;  3X40 A;  5STD A;  4CCV A;  1VQ7 3;  1O7P B;  1X1W A;  2PZV A;  1BUJ A;  3Q3F A;  4LEH A;  1F8N A;  5HOH A;  1JRQ A;  3EB8 A;  1Q86 4;  3DMC A;  1MWT A;  3OWS A;  3S29 A;  3CCL 3;  3GWR A;  1RCL A;  4J8T A;  1W6Y A;  2H0H A;  3ER7 A;  2W9P A;  4GHO A;  2C10 A;  1QVG 2;  1GY6 A;  1VQ6 3;  4MMX B;  3DGN A;  1UUG B;  1YIT 3;  5KP3 A;  4WYK A;  3H3H A;  3JUP A;  7STD A;  2OOV C;  1YJW 3;  2Y74 A;  1MNL A;  1B2S A;  2ZL8 A;  3CNM A;  3IJE B;  3GZX B;  4HM0 B;  3SLU A;  1Q82 4;  2GSP A;  3EE1 A;  3KN4 A;  1N8R 4;  2F56 A;  1LVN A;  1B21 A;  2XFS A;  1B3S A;  1K28 A;  4DKI A;  3HI7 A;  3EHC A;  3RGR A;  2MF7 A;  5FW5 A;  1FW7 A;  1BSB A;  2R4I A;  3DH2 A;  4AKY A;  1TU5 A;  3CC7 3;  2CFL A;  1EQK A;  2Z76 A;  4HZB B;  4R80 A;  3KZT A;  1I70 A;  3GZY B;  1R4Y A;  3FGY A;  1RGE A;  3HK4 A;  5ELU A;  3N8B A;  4ILF A;  1HZ1 A;  1ZX2 A;  1Q7Y 4;  3WR2 A;  4L7K A;  7GSP A;  1NB5 I;  2W56 B;  1IQX A;  3D5I A;  2Q07 A;  3EBT A;  3U1W A;  3F14 A;  3CCE 3;  1FUT A;  4RNT A;  1I2G A;  4HM7 B;  4MEI A;  4KT3 B;  3OWU A;  2WGQ A;  1LQG C;  3FG1 A;  3SYU A;  2CWT A;  2CWU A;  3GRD A;  3K63 A;  1MWU A;  4XM4 A;  1AVL A;  2HMN B;  3WOE B;  3WA3 A;  1B2X A;  2IUK A;  5CXO A;  3S27 A;  1BUQ A;  4ORL A;  1YVB I;  1BRK A;  1DVC A;  3AGO A;  1BNI A;  5IG5 A;  1V57 A;  3BND A;  1QJG A;  1S72 3;  4QWT A;  3LZA A;  3JUQ A;  4XBY A;  1VQO 3;  1PY3 A;  2YFI B;  2YFL B;  5CLK A;  1D6Z A;  1N9J A;  3LTB A;  4FMD A;  5G2G A;  3S67 A;  4ZM8 A;  3DUK A;  4JF8 A;  1UGI A;  3M8C A;  3FSD A;  4LSO A;  1YNV X;  2GU3 A;  4O02 B;  4EW5 A;  1PYL A;  3J7Y d;  5JPU A;  3CPO A;  1NWW A;  1W7C A;  2RCD A;  4K1U A;  4BTW A;  5AYS C;  1WMN A;  1OPY A;  2CWV A;  4EC6 A;  4AEQ A;  2CHC A;  1GMP A;  4HZ9 B;  4FMA A;  2RGQ A;  1BNF A;  2L4V A;  5LC7 A;  1AVK A;  1EA2 A;  4J9A A;  1Z1S A;  1Y4K A;  3DGO A;  1PU4 A;  1VQK 3;  2F98 A;  3Q90 A;  1JBT A;  6GSP A;  5IF6 A;  3LXU X;  4XBX A;  3UL6 A;  1LXE A;  1BRG A;  2P0X A;  4FMB A;  3CCU 3;  4EV2 A;  3SOA A;  2BHM A;  1VQL 3;  1VQQ A;  1VZZ A;  3PCS A;  3NBR A;  2HOH A;  4MMY B;  1D6Y A;  5DRE A;  3ZG0 A;  3DY5 A;  1G0T A;  5AII A;  3LT9 A;  1GMQ A;  1W01 A;  3FF2 A;  4HAA A;  3CD6 3;  4XDW A;  1OHS A;  1RRH A;  4N6N B;  2XFT A;  2UUG C;  3CCQ 3;  2E2T A;  2SBL A;  1K9M 4;  4R9L A;  2RBI A;  2XGL A;  2H0G A;  3EC9 A; 
#chains in the Genus database with same CATH homology
 1T2I A;  5BIR A;  1FUS A;  1BSE A;  1JBR A;  3DGY A;  1LNI A;  1RDS A;  4GSP A;  1LOW A;  1X1Y A;  1UCI A;  1I0V A;  1B2U A;  2RNT A;  1X1W A;  3D5G A;  1BUJ A;  3Q3F A;  1AQZ A;  3HOH A;  5HOH A;  1BAO A;  2AAE A;  3AHS A;  2F5W A;  2AAD A;  2F4Y A;  1RCL A;  1B27 A;  1T2H A;  1BNE A;  4GHO A;  1GOV A;  3BIR A;  1BNJ A;  1SAR A;  1RLS A;  1B2S A;  1CH0 A;  1FYS A;  2GSP A;  6RNT A;  1DET A;  2KF3 A;  2F56 A;  1B21 A;  1RGA A;  1B3S A;  1BOX A;  8RNT A;  1B2M A;  1X1X A;  2BU4 A;  1DE3 A;  1FW7 A;  1BSB A;  3D4A A;  3DH2 A;  1GOY A;  2ZA4 A;  1I70 A;  1FZU A;  1R4Y A;  1TRQ A;  1RGE A;  2BIR A;  3BU4 A;  1HZ1 A;  3WR2 A;  7GSP A;  1BSA A;  3D5I A;  1RN1 A;  1LOV A;  1BRH A;  1I2F A;  9RNT A;  1BGS A;  1BIR A;  1FUT A;  4RNT A;  1I2G A;  2KAA A;  1AY7 A;  2F5M A;  1I2E A;  3AGN A;  1GSP A;  1YGW A;  3SYU A;  1ZGX A;  1BU4 A;  3RNT A;  1B2Z A;  1B2X A;  1BRJ A;  1RGG A;  1GOU A;  2KF6 A;  1TRP A;  1JBS A;  2SAR A;  1A2P A;  1RGH A;  1BRK A;  1RN4 A;  1TTO A;  1BNI A;  3AGO A;  1C54 A;  1Q9E A;  3AHW A;  1MGR A;  1RGC A;  1BVI A;  1PY3 A;  1YVS A;  1HYF A;  5GSP A;  1I3I A;  1BRN L;  1I8V A;  4J5K A;  2C4B A;  1RHL A;  1LRA A;  1YNV X;  1RSN A;  1X1U A;  2KF4 A;  1PYL A;  3KCH A;  4HOH A;  1UCJ A;  1I0X A;  1BRI A;  1BRS A;  1GMR A;  4J5G A;  1B20 A;  5RNT A;  1GMP A;  1RTU A;  1BAN A;  1MGW A;  1RCK A;  1IYY A;  1BNF A;  1BNR A;  1RNB A;  3URP A;  1RGL A;  1BSC A;  1BNS A;  1JBT A;  6GSP A;  1BSD A;  1BRG A;  3WHO A;  1UCK A;  4BIR A;  1RMS A;  5BU4 A;  2HOH A;  1BNG A;  7RNT A;  4BU4 A;  1GMQ A;  1RGK A;  3GSP A;  3A5E A;  4HAA A;  2KF5 A;  1I3F A;  1RGF A;  1UCL A;  2RBI A;  1LOY A;  1RNT A;  1G02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...