1BSCA

Crystal structural analysis of mutations in the hydrophobic cores of barnase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRVLYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bscA00
2RNTA 1I2GA 1UCJA 1RGLA 1BRIA 9RNTA 1BRKA 3WHOA 2F5MA 1RGEA 3RNTA 1B2SA 1TRQA 2AADA 4GSPA 1PYLA 1LOYA 5BU4A 7GSPA 1DETA 1JBTA 1IYYA 3Q3FA 4GHOA 1YNVX 2F5WA 1BRNL 3AHWA 1BSAA 1LNIA 1RSNA 1G02A 1GMRA 1B2XA 1Q9EA 3AGNA 1GOUA 1BSEA 4BU4A 1GMPA 1GOYA 1R4YA 1RTUA 1I2EA 3AGOA 7RNTA 1GMQA 1JBRA 2F4YA 2BU4A 1GOVA 1BRSA 1UCKA 1BANA 1GSPA 6RNTA 1B2MA 4HOHA 2SARA 1X1UA 1RCLA 3KCHA 1RGFA 1BNEA 4HAAA 2HOHA 1RDSA 1ZGXA 4J5GA 1MGWA 5HOHA 1B3SA 1RNTA 1JBSA 4BIRA 3GSPA 1BSBA 2BIRA 2C4BA 1HYFA 1RGHA 1FZUA 2ZA4A 1I3IA 3D5GA 1BGSA 1X1WA 3D5IA 1B27A 1BOXA 1BVIA 3BIRA 1FW7A 1B21A 1I3FA 1BRGA 1UCLA 1UCIA 1MGRA 1B2UA 5BIRA 1BU4A 1I2FA 1X1XA 1YVSA 1T2IA 1BNIA 1RN1A 1BAOA 2RBIA 1B20A 1RGCA 2AAEA 1I0XA 1X1YA 1LOVA 3A5EA 3DGYA 1RGGA 1PY3A 1LRAA 1RGAA 1A2PA 1LOWA 1FUTA 3AHSA 1I70A 3D4AA 1FUSA 1BSCA 6GSPA 2KF4A 1B2ZA 5RNTA 1FYSA 1BUJA 3DH2A 1DE3A 1RLSA 2KF6A 2GSPA 1HZ1A 1RCKA 1BNRA 1C54A 3SYUA 3WR2A 4J5KA 1T2HA 2KF3A 1BNFA 1CH0A 2KAAA 1BSDA 1BNJA 1I0VA 1AY7A 1RMSA 1BIRA 3HOHA 4RNTA 2KF5A 1AQZA 1TRPA 3URPA 1I8VA 1BRHA 1BNGA 3BU4A 1BNSA 1TTOA 1RGKA 1YGWA 2F56A 5GSPA 8RNTA 1RHLA 1SARA 1RN4A 1BRJA 1RNBA
chains in the Genus database with same CATH superfamily
1UGHI 2O3OA 3CCJ3 2RNTA 1UCJA 3QK9A 4IIAA 1TJDA 3B4PA 2BT3A 1FGRA 2C10A 2XRXB 2FXTA 1MWRA 2F5MA 3KSED 3M8CA 3WHOA 7STDA 5M19A 1S723 1MWUA 1QALA 2XGNA 1LOYA 2XEPA 2FGTA 2GBWB 4BL2A 1Q824 5TGNA 3KKGA 3OW22 1EQKA 1LXEA 3JUMA 1JJ22 1A67A 3MG1A 4HKVB 3G6E3 1QAKA 3EBYA 2Z6BA 3CCE3 3Q1CA 1VQ63 1EA2A 4RNYA 1GMRA 4R1KA 5DREA 1GY7A 2BO9B 5AYSC 1NB3I 1IT8A 4RNZA 3NM7A 4JF8A 5IG3A 1F8NA 3AGNA 1Q7HA 1WMPA 5DRVA 1BSEA 1AV4A 1E3VA 2Y74A 4LEHA 3X3ZA 1O7PB 1MNLA 1R4YA 3MHEA 1JB2A 4HM1B 2WOFA 3F7SA 5JPUA 3KIIA 1VQO3 3CCR3 4FMDA 5ELUA 3RGAA 2PZVA 3F8XA 3FLJA 3EF8A 3G0KA 4RBNA 4AKYA 1B2MA 1TFOA 1TUHA 2E2UA 1JRQA 4HOHA 4HM5B 1U5OA 3G16A 1X1UA 1IK3A 1RGFA 3ER7A 4HAAA 3SXXA 1QJGA 4J5GA 1MGWA 3FF2A 5HOHA 5G1LA 4HZBB 3KZTA 3ECFA 1ROVA 4BIRA 4N6UA 1W00A 1YI23 1FGQA 1PFPA 1E97A 2OWPA 2WGQA 1HYFA 3EBTA 2ZA4A 2ML5A 2CFKA 3S28A 4HYZA 3VSYA 1YIJ3 3CPOA 3X42A 2CWTA 1N9EA 1BVIA 2YFLB 1RRHA 5IG0A 1JN5A 5G1KA 5IERA 4OUQA 4BTYA 1GYBA 5KP4A 1RKYA 1D6ZA 2HMLB 4HVNA 3MG3A 1UUGB 1VQ73 1D6YA 2IUKA 1RN1A 1OCVA 1UDII 3QRDA 2MF7A 1YHQ3 3FG3A 3DGLA 2E2TA 3CME3 2OTL3 3FG1A 1LRAA 2BHMA 3K0ZA 2H0IA 3J7Yd 1FGMA 1W6GA 3Q2PA 3PGBA 3H51A 3D4AA 4OK0A 1FUSA 1NJI4 4NPBA 1K9M4 4L8PA 1GY6A 3IJEB 4HM2B 1WMOA 4FR9A 6GSPA 1V58A 2KCDA 4WYKA 1W2ZA 4AEQA 5RNTA 1FYSA 1BUJA 2Y73A 3X3YA 2WO0A 2QGUA 1UW1A 4CJNA 3CCS3 1N5PA 2XF3A 5I97A 2YFJB 3MKIA 1IV7A 3D3LA 3DXOA 3EX9A 3DUKA 4GB5A 2KF3A 4J5KA 3LT9A 1DVDA 5HGRA 1O7GB 4GL6A 2CW9A 2KXGA 1L5GB 4EC6A 1BNJA 1EUIC 1WNHA 1O7MB 1LQMB 3RGRA 1OGZA 6STDA 2V1LA 2W56B 3HOHA 4N6NB 3WDGB 3F40A 3IPTA 1TRPA 2HMNB 2CK3H 1IQXA 1BNGA 5JPPA 2QEX3 2OOVA 1R4CA 3LXUX 1RGKA 1W7CA 2BNGA 1FUWA 2OQEC 2ZHXB 5GSPA 9RNTA 1IVUA 2M7OA 3V98A 3X41A 1RN4A 3S5CA 1ZS7A 1OHOA 3NHXA 3F14A 1I2GA 3STDA 5EQLA 1ULIB 3CNXA 2QA43 1VQP3 3UJMA 1BRIA 1IVVA 1BRKA 3I553 3K7CA 3N8BA 4BTWA 1YJ93 3CC43 1TRQA 1CEWI 1T5YA 2AADA 1PYLA 5BU4A 1OPYA 1OF5B 3AMOB 5D82A 3Q3FA 4GHOA 1M9GA 1DVCA 1NNVA 1BRNL 1T3BA 5AEWB 3WOFB 1LNIA 5G2GA 3V92A 1B2XA 3K9MC 3NQYA 2LYXA 3DZLA 4WFOA 1O7NB 1LNHA 1N8QA 5FGOA 3ZG0A 5D83A 3HIGA 4HM8B 2XH9A 4R80A 4WWUC 1VQ93 1GOUA 2P05A 1Q40A 1GMPA 1GOYA 2IA7A 4CPKA 1IVXA 1NDOB 3MYTA 4N6TA 1O7WB 7RNTA 1GMQA 1DYUA 2W0QA 2W04A 3KN4A 1BRSA 1UCKA 6RNTA 1GSPA 2XFTA 3PXMA 4K90B 2GBXB 3CD63 2RSXA 3LTDA 1BUQA 3SVAA 1RCLA 2H0HA 1E3RA 1VQ53 1Q814 1BNEA 1HU9A 2HOHA 4H3UA 2XGLA 4DKIA 3CCL3 2Z7AA 4LMIA 1JKGA 1YGEA 1B3SA 1VQM3 4LSOA 2RFRA 3VF1A 1J2BA 2IMJA 1D6UA 2BIRA 4FMAA 4KFEA 3OXAA 1CYUA 4K61A 1SQWA 2C4BA 5IEPA 1FZUA 2K0MA 4XBTA 1EG9B 4EW5A 1ROAA 1W2B2 1BGSA 3GZBA 1X1WA 5CXOA 2CKFB 1IQ8A 4O2HA 5AYRB 1FW7A 5CF2A 3T0UA 1U8CB 4IT7A 4EV2A 3HK4A 1UCLA 3L0RA 1UCIA 3CC23 5A0OB 5BIRA 1BU4A 3KSPA 1YVSA 1T2IA 1GY5A 2STDA 3FKAA 3CXC2 5M1AA 2W2CA 3K63A 1X1YA 3JUQA 1LOVA 3A5EA 1OGXA 2BMQB 1OHSA 2CFDA 3E99A 3EE1A 3LTBA 2B24B 2F86B 3ALAA 3RDEA 3AHSA 4JRFA 4O8SA 3ZG5A 2I9WA 2K3DA 1EEJA 2IUJA 1IU7A 1BSCA 1JB4A 1TP6A 3LYGA 5M18A 2Q07A 5IW9A 1V74A 4KVHA 1DE3A 3DH2A 2PNCA 3FG4A 1VQQA 1M904 3BNBA 3B8LA 3I0YA 2GSPA 3JUNA 4G1MB 3UNLA 1IDPA 3NM2A 3SYUA 1T2HA 1BNFA 1WMNA 3LTAA 1VQ43 3CPW2 4MMZB 1CH0A 4J9AA 1A2VA 1BSDA 2B1XB 1SJWA 2C11A 3NBBA 1KWIA 1BIRA 3NBJA 2KF5A 4FMBA 3GWRA 4CDLA 1AQZA 1OHPA 2CWVA 2D42A 3N9HA 3NV0B 4XDVA 3BNCA 1TTOA 3JUPA 3NBRA 1SPUA 1YGWA 4BL3A 3HIIA 2YFIB 3PS8A 2OOVC 5STDA 4FMCA 1Q42A 1BRJA 2BMRB 1RNBA 1N9JA 1OACA 3WA3A 5AIGA 5EVHA 1C7HA 1LOXA 4LGQA 2GEXA 3OWSA 4WHAA 3ROBA 3FCSB 2H0GA 2Z76A 1G96A 4O3VA 2GEYA 3UL6A 1RGEA 1SIIA 1K28A 1ULJB 3RNTA 4GSPA 3KFQC 1DETA 1JBTA 5KP1A 1JZOA 4HM0B 2UX0A 3IMAB 4KFDA 4L7KA 4EV5A 1RSNA 1NB5I 3CU3A 1M1K4 1K41A 1G02A 1O7HB 5CLKA 1Q9EA 3S67A 3B7CA 1FGOA 3EHCA 2XSHB 3F8HA 1TU5A 3CC73 3S29A 3N54B 1OH0A 1SIHA 4TX4A 2GU1A 4X2HA 1A90A 1K734 2BMOB 2CG1A 3PCRA 1W6YA 3ZFZA 1IT7A 4OVMA 5AIHA 1KSIA 1W6CA 1JBRA 2BU4A 4FCJA 1BANA 2A15A 1EKMA 3MSOA 1S5AA 1VQN3 2SARA 5IEOA 4FCZA 1YVBI 2ZDJA 1UI8A 3OX9A 4XBYA 3FGYA 3NQZA 3CCQ3 3DGMA 1W01A 2W56A 5IENA 2SBLA 3FH1A 3EN1B 4MJDA 4R9LA 2XSOB 3X3XA 2RCDA 4HM6B 1BSBA 2WGOA 3SX1A 3I563 4HZ9B 1GD3A 1RGHA 2R4IA 2JQ5A 4MMYB 3JVCA 5LC6A 3HX8A 2P0XA 3FF0A 4O02B 3G713 1JZDA 1B27A 1BOXA 3JUOA 1RJOA 4EXRA 1W5ZA 4XM4A 5CK6A 2YX9A 4EBGA 1B21A 4N3VA 3CCM3 5KP3A 1CYVA 1MGRA 1Q7Y4 1B2UA 1TIJA 5LC7A 1I2FA 1X1XA 1IQYA 4K1VA 1V57A 2CFLA 3BLZA 2HMKB 1MOLA 2INXA 2CFWA 2RGQA 2ZL8A 5AEUB 5IG5A 5JBSA 1OF5A 3AMOA 3OWUA 1MWSA 4HM7B 2AAEA 3TDGA 3DY5A 1KD14 3DGYA 2F98A 3FZWA 4RZMA 1RGGA 2OQEA 3K5TA 3EQQB 1RGAA 1A2PA 4ORLA 5ELJA 5IG4A 1FUTA 3GRDA 1RRLA 4WP5A 2CX1A 2CWUA 3LTCA 4I5QA 1B2ZA 4U13A 4NREA 1Z1SA 1VQK3 2HMOB 1FA3A 1YJN3 1JV2B 3WOEB 2FNQA 1ISKA 2IYJA 3MG2A 4X2OA 4ZM8A 2KF6A 1HZ1A 1RCKA 1DMQA 1C54A 2W9QA 3VGNA 1IVWA 3PZWA 4HJLB 3DMCA 3WR2A 4NHFA 4LZIA 1QMAA 5BVBA 3GAXA 3G8ZA 4LYLB 4XBXA 3H3HA 1STDA 1MWTA 3SOAA 4RNTA 3GZXB 2R41A 4STDA 3MPHA 3S27A 3T8UA 2O9UX 4Q53A 3BNEA 3LMLA 2W03A 4N6LA 1YIT3 2WOHA 2F56A 2GXFA 1AR0A 1HKXA 4H61A 8RNTA 2GU3A 2XFSA 1SARA 3B4OA 2D1WA 1JNQA 3NX0A 3V99A 1JB5A 2CHCA 1AVKA 3LZAA 1JN5B 1RGLA 1FGTA 2IY2A 1UI7A 5FW5A 3SLUA 1IV9A 2OTJ3 3MWZA 1QVG2 1B2SA 2HMMB 1NO3A 2JDIH 2UGIA 3BB9A 4XDWA 5AIIA 5EEOA 3PYJA 2CH9A 2XR8B 7GSPA 1IYYA 4FCMA 1YJW3 1N5HA 1YNVX 2F5WA 3SEDA 2ML6A 3AHWA 3OV4A 1AVLA 1BSAA 3A76A 3D79A 4KZ1A 4N6MA 4K1UA 4I4KA 4ILFA 3U1WA 3UB1A 1GD4A 3D9RA 1VQL3 2Z77A 5D81A 3EJVA 4PEJA 3Q90A 4N6OB 3GZRA 4BU4A 4CCVA 4WYKB 3BNDA 2P38A 1NWWA 1RTUA 1I2EA 1RN7A 3HZPA 1A2KA 4HM3B 2P0MA 3AGOA 2F4YA 5BXQA 8CHOA 2L1SA 1GOVA 2CFGA 3DM8A 2CX0A 3CNMA 1W02A 1DMMA 3G4S3 3LH4A 3UL5A 4AKZA 1WTHA 3KCHA 1US1A 4R9KA 1PU4A 3EC9A 1OUNA 1RDSA 1ZGXA 1ZX2A 4L8OA 1Y4KA 3F9SA 1RNTA 1GS3A 2E2VA 3PCSA 1JBSA 3NV0A 3GSPA 3X40A 4XB5A 3WA2X 4KFFA 2CIUA 3F7XA 3SOYA 1I3IA 3D5GA 4EYCA 1UGIA 3D5IA 2LQVA 3BIRA 1QVF2 3CCU3 1K8A4 3KE7A 2CC3A 1I3FA 4HBRA 1BRGA 4MEIA 1UUVB 4KT3B 1BNIA 3CCV3 1TFKA 1BAOA 2RBIA 1B20A 1RGCA 3OWYA 1I0XA 4HM4B 2J8XB 3WODG 2CG0A 1PY3A 2W6JH 1QAFA 1LOWA 3NXJA 3O8YA 4IPBA 1I70A 3EN8A 1G0TA 1Q40B 1ASKA 1NU3A 1STFI 3LT8A 5AI1A 3WMDA 2OCTA 1KC84 1Q864 2KF4A 4BTXA 1KQS2 4MMXB 5CF1A 1RLSA 3HI7A 3U97A 4QWTA 1UUWB 1WQLB 2P09A 4J8TA 1BNRA 3GZYB 3DGNA 2KRTA 1VQ83 2HMJB 3FSDA 3CMA3 1N8R4 3LOYA 1DMNA 1CQSA 2KAAA 3EB8A 1I0VA 1AY7A 1RMSA 1JKGB 1VZZA 4N6V0 2F99A 2QIYA 2UUGC 3NUVA 3URPA 1I8VA 1BRHA 2W9PA 5IF6A 3BU4A 1BNSA 5AIFA 1ZO2A 2L4VA 3DGOA 4R4KA 1RHLA 1LQGC 1M1XB 1LVNA 2MC8A 3T8NA 2K54A 1W4NA
chains in the Genus database with same CATH topology
2RNTA 1I2GA 1UCJA 1RGLA 1BRIA 9RNTA 1BRKA 3WHOA 2F5MA 1RGEA 3RNTA 1B2SA 1TRQA 2AADA 4GSPA 1PYLA 1LOYA 5BU4A 7GSPA 1DETA 1JBTA 1IYYA 3Q3FA 4GHOA 1YNVX 2F5WA 1BRNL 3AHWA 1BSAA 1LNIA 1RSNA 1G02A 1GMRA 1B2XA 1Q9EA 3AGNA 1GOUA 1BSEA 4BU4A 1GMPA 1GOYA 1R4YA 1RTUA 1I2EA 3AGOA 7RNTA 1GMQA 1JBRA 2F4YA 2BU4A 1GOVA 1BRSA 1UCKA 1BANA 1GSPA 6RNTA 1B2MA 4HOHA 2SARA 1X1UA 1RCLA 3KCHA 1RGFA 1BNEA 4HAAA 2HOHA 1RDSA 1ZGXA 4J5GA 1MGWA 5HOHA 1B3SA 1RNTA 1JBSA 4BIRA 3GSPA 1BSBA 2BIRA 2C4BA 1HYFA 1RGHA 1FZUA 2ZA4A 1I3IA 3D5GA 1BGSA 1X1WA 3D5IA 1B27A 1BOXA 1BVIA 3BIRA 1FW7A 1B21A 1I3FA 1BRGA 1UCLA 1UCIA 1MGRA 1B2UA 5BIRA 1BU4A 1I2FA 1X1XA 1YVSA 1T2IA 1BNIA 1RN1A 1BAOA 2RBIA 1B20A 1RGCA 2AAEA 1I0XA 1X1YA 1LOVA 3A5EA 3DGYA 1RGGA 1PY3A 1LRAA 1RGAA 1A2PA 1LOWA 1FUTA 3AHSA 1I70A 3D4AA 1FUSA 1BSCA 6GSPA 2KF4A 1B2ZA 5RNTA 1FYSA 1BUJA 3DH2A 1DE3A 1RLSA 2KF6A 2GSPA 1HZ1A 1RCKA 1BNRA 1C54A 3SYUA 3WR2A 4J5KA 1T2HA 2KF3A 1BNFA 1CH0A 2KAAA 1BSDA 1BNJA 1I0VA 1AY7A 1RMSA 1BIRA 3HOHA 4RNTA 2KF5A 1AQZA 1TRPA 3URPA 1I8VA 1BRHA 1BNGA 3BU4A 1BNSA 1TTOA 1RGKA 1YGWA 2F56A 5GSPA 8RNTA 1RHLA 1SARA 1RN4A 1BRJA 1RNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNT A;  1I2G A;  1UCJ A;  1RGL A;  1BRI A;  9RNT A;  1BRK A;  3WHO A;  2F5M A;  1RGE A;  3RNT A;  1B2S A;  1TRQ A;  2AAD A;  4GSP A;  1PYL A;  1LOY A;  5BU4 A;  7GSP A;  1DET A;  1JBT A;  1IYY A;  3Q3F A;  4GHO A;  1YNV X;  2F5W A;  1BRN L;  3AHW A;  1BSA A;  1LNI A;  1RSN A;  1G02 A;  1GMR A;  1B2X A;  1Q9E A;  3AGN A;  1GOU A;  1BSE A;  4BU4 A;  1GMP A;  1GOY A;  1R4Y A;  1RTU A;  1I2E A;  3AGO A;  7RNT A;  1GMQ A;  1JBR A;  2F4Y A;  2BU4 A;  1GOV A;  1BRS A;  1UCK A;  1BAN A;  1GSP A;  6RNT A;  1B2M A;  4HOH A;  2SAR A;  1X1U A;  1RCL A;  3KCH A;  1RGF A;  1BNE A;  4HAA A;  2HOH A;  1RDS A;  1ZGX A;  4J5G A;  1MGW A;  5HOH A;  1B3S A;  1RNT A;  1JBS A;  4BIR A;  3GSP A;  1BSB A;  2BIR A;  2C4B A;  1HYF A;  1RGH A;  1FZU A;  2ZA4 A;  1I3I A;  3D5G A;  1BGS A;  1X1W A;  3D5I A;  1B27 A;  1BOX A;  1BVI A;  3BIR A;  1FW7 A;  1B21 A;  1I3F A;  1BRG A;  1UCL A;  1UCI A;  1MGR A;  1B2U A;  5BIR A;  1BU4 A;  1I2F A;  1X1X A;  1YVS A;  1T2I A;  1BNI A;  1RN1 A;  1BAO A;  2RBI A;  1B20 A;  1RGC A;  2AAE A;  1I0X A;  1X1Y A;  1LOV A;  3A5E A;  3DGY A;  1RGG A;  1PY3 A;  1LRA A;  1RGA A;  1A2P A;  1LOW A;  1FUT A;  3AHS A;  1I70 A;  3D4A A;  1FUS A;  1BSC A;  6GSP A;  2KF4 A;  1B2Z A;  5RNT A;  1FYS A;  1BUJ A;  3DH2 A;  1DE3 A;  1RLS A;  2KF6 A;  2GSP A;  1HZ1 A;  1RCK A;  1BNR A;  1C54 A;  3SYU A;  3WR2 A;  4J5K A;  1T2H A;  2KF3 A;  1BNF A;  1CH0 A;  2KAA A;  1BSD A;  1BNJ A;  1I0V A;  1AY7 A;  1RMS A;  1BIR A;  3HOH A;  4RNT A;  2KF5 A;  1AQZ A;  1TRP A;  3URP A;  1I8V A;  1BRH A;  1BNG A;  3BU4 A;  1BNS A;  1TTO A;  1RGK A;  1YGW A;  2F56 A;  5GSP A;  8RNT A;  1RHL A;  1SAR A;  1RN4 A;  1BRJ A;  1RNB A; 
#chains in the Genus database with same CATH topology
 1UGH I;  2O3O A;  3CCJ 3;  2RNT A;  1UCJ A;  3QK9 A;  4IIA A;  1TJD A;  3B4P A;  2BT3 A;  1FGR A;  2C10 A;  2XRX B;  2FXT A;  1MWR A;  2F5M A;  3KSE D;  3M8C A;  3WHO A;  7STD A;  5M19 A;  1S72 3;  1MWU A;  1QAL A;  2XGN A;  1LOY A;  2XEP A;  2FGT A;  2GBW B;  4BL2 A;  1Q82 4;  5TGN A;  3KKG A;  3OW2 2;  1EQK A;  1LXE A;  3JUM A;  1JJ2 2;  1A67 A;  3MG1 A;  4HKV B;  3G6E 3;  1QAK A;  3EBY A;  2Z6B A;  3CCE 3;  3Q1C A;  1VQ6 3;  1EA2 A;  4RNY A;  1GMR A;  4R1K A;  5DRE A;  1GY7 A;  2BO9 B;  5AYS C;  1NB3 I;  1IT8 A;  4RNZ A;  3NM7 A;  4JF8 A;  5IG3 A;  1F8N A;  3AGN A;  1Q7H A;  1WMP A;  5DRV A;  1BSE A;  1AV4 A;  1E3V A;  2Y74 A;  4LEH A;  3X3Z A;  1O7P B;  1MNL A;  1R4Y A;  3MHE A;  1JB2 A;  4HM1 B;  2WOF A;  3F7S A;  5JPU A;  3KII A;  1VQO 3;  3CCR 3;  4FMD A;  5ELU A;  3RGA A;  2PZV A;  3F8X A;  3FLJ A;  3EF8 A;  3G0K A;  4RBN A;  4AKY A;  1B2M A;  1TFO A;  1TUH A;  2E2U A;  1JRQ A;  4HOH A;  4HM5 B;  1U5O A;  3G16 A;  1X1U A;  1IK3 A;  1RGF A;  3ER7 A;  4HAA A;  3SXX A;  1QJG A;  4J5G A;  1MGW A;  3FF2 A;  5HOH A;  5G1L A;  4HZB B;  3KZT A;  3ECF A;  1ROV A;  4BIR A;  4N6U A;  1W00 A;  1YI2 3;  1FGQ A;  1PFP A;  1E97 A;  2OWP A;  2WGQ A;  1HYF A;  3EBT A;  2ZA4 A;  2ML5 A;  2CFK A;  3S28 A;  4HYZ A;  3VSY A;  1YIJ 3;  3CPO A;  3X42 A;  2CWT A;  1N9E A;  1BVI A;  2YFL B;  1RRH A;  5IG0 A;  1JN5 A;  5G1K A;  5IER A;  4OUQ A;  4BTY A;  1GYB A;  5KP4 A;  1RKY A;  1D6Z A;  2HML B;  4HVN A;  3MG3 A;  1UUG B;  1VQ7 3;  1D6Y A;  2IUK A;  1RN1 A;  1OCV A;  1UDI I;  3QRD A;  2MF7 A;  1YHQ 3;  3FG3 A;  3DGL A;  2E2T A;  3CME 3;  2OTL 3;  3FG1 A;  1LRA A;  2BHM A;  3K0Z A;  2H0I A;  3J7Y d;  1FGM A;  1W6G A;  3Q2P A;  3PGB A;  3H51 A;  3D4A A;  4OK0 A;  1FUS A;  1NJI 4;  4NPB A;  1K9M 4;  4L8P A;  1GY6 A;  3IJE B;  4HM2 B;  1WMO A;  4FR9 A;  6GSP A;  1V58 A;  2KCD A;  4WYK A;  1W2Z A;  4AEQ A;  5RNT A;  1FYS A;  1BUJ A;  2Y73 A;  3X3Y A;  2WO0 A;  2QGU A;  1UW1 A;  4CJN A;  3CCS 3;  1N5P A;  2XF3 A;  5I97 A;  2YFJ B;  3MKI A;  1IV7 A;  3D3L A;  3DXO A;  3EX9 A;  3DUK A;  4GB5 A;  2KF3 A;  4J5K A;  3LT9 A;  1DVD A;  5HGR A;  1O7G B;  4GL6 A;  2CW9 A;  2KXG A;  1L5G B;  4EC6 A;  1BNJ A;  1EUI C;  1WNH A;  1O7M B;  1LQM B;  3RGR A;  1OGZ A;  6STD A;  2V1L A;  2W56 B;  3HOH A;  4N6N B;  3WDG B;  3F40 A;  3IPT A;  1TRP A;  2HMN B;  2CK3 H;  1IQX A;  1BNG A;  5JPP A;  2QEX 3;  2OOV A;  1R4C A;  3LXU X;  1RGK A;  1W7C A;  2BNG A;  1FUW A;  2OQE C;  2ZHX B;  5GSP A;  9RNT A;  1IVU A;  2M7O A;  3V98 A;  3X41 A;  1RN4 A;  3S5C A;  1ZS7 A;  1OHO A;  3NHX A;  3F14 A;  1I2G A;  3STD A;  5EQL A;  1ULI B;  3CNX A;  2QA4 3;  1VQP 3;  3UJM A;  1BRI A;  1IVV A;  1BRK A;  3I55 3;  3K7C A;  3N8B A;  4BTW A;  1YJ9 3;  3CC4 3;  1TRQ A;  1CEW I;  1T5Y A;  2AAD A;  1PYL A;  5BU4 A;  1OPY A;  1OF5 B;  3AMO B;  5D82 A;  3Q3F A;  4GHO A;  1M9G A;  1DVC A;  1NNV A;  1BRN L;  1T3B A;  5AEW B;  3WOF B;  1LNI A;  5G2G A;  3V92 A;  1B2X A;  3K9M C;  3NQY A;  2LYX A;  3DZL A;  4WFO A;  1O7N B;  1LNH A;  1N8Q A;  5FGO A;  3ZG0 A;  5D83 A;  3HIG A;  4HM8 B;  2XH9 A;  4R80 A;  4WWU C;  1VQ9 3;  1GOU A;  2P05 A;  1Q40 A;  1GMP A;  1GOY A;  2IA7 A;  4CPK A;  1IVX A;  1NDO B;  3MYT A;  4N6T A;  1O7W B;  7RNT A;  1GMQ A;  1DYU A;  2W0Q A;  2W04 A;  3KN4 A;  1BRS A;  1UCK A;  6RNT A;  1GSP A;  2XFT A;  3PXM A;  4K90 B;  2GBX B;  3CD6 3;  2RSX A;  3LTD A;  1BUQ A;  3SVA A;  1RCL A;  2H0H A;  1E3R A;  1VQ5 3;  1Q81 4;  1BNE A;  1HU9 A;  2HOH A;  4H3U A;  2XGL A;  4DKI A;  3CCL 3;  2Z7A A;  4LMI A;  1JKG A;  1YGE A;  1B3S A;  1VQM 3;  4LSO A;  2RFR A;  3VF1 A;  1J2B A;  2IMJ A;  1D6U A;  2BIR A;  4FMA A;  4KFE A;  3OXA A;  1CYU A;  4K61 A;  1SQW A;  2C4B A;  5IEP A;  1FZU A;  2K0M A;  4XBT A;  1EG9 B;  4EW5 A;  1ROA A;  1W2B 2;  1BGS A;  3GZB A;  1X1W A;  5CXO A;  2CKF B;  1IQ8 A;  4O2H A;  5AYR B;  1FW7 A;  5CF2 A;  3T0U A;  1U8C B;  4IT7 A;  4EV2 A;  3HK4 A;  1UCL A;  3L0R A;  1UCI A;  3CC2 3;  5A0O B;  5BIR A;  1BU4 A;  3KSP A;  1YVS A;  1T2I A;  1GY5 A;  2STD A;  3FKA A;  3CXC 2;  5M1A A;  2W2C A;  3K63 A;  1X1Y A;  3JUQ A;  1LOV A;  3A5E A;  1OGX A;  2BMQ B;  1OHS A;  2CFD A;  3E99 A;  3EE1 A;  3LTB A;  2B24 B;  2F86 B;  3ALA A;  3RDE A;  3AHS A;  4JRF A;  4O8S A;  3ZG5 A;  2I9W A;  2K3D A;  1EEJ A;  2IUJ A;  1IU7 A;  1BSC A;  1JB4 A;  1TP6 A;  3LYG A;  5M18 A;  2Q07 A;  5IW9 A;  1V74 A;  4KVH A;  1DE3 A;  3DH2 A;  2PNC A;  3FG4 A;  1VQQ A;  1M90 4;  3BNB A;  3B8L A;  3I0Y A;  2GSP A;  3JUN A;  4G1M B;  3UNL A;  1IDP A;  3NM2 A;  3SYU A;  1T2H A;  1BNF A;  1WMN A;  3LTA A;  1VQ4 3;  3CPW 2;  4MMZ B;  1CH0 A;  4J9A A;  1A2V A;  1BSD A;  2B1X B;  1SJW A;  2C11 A;  3NBB A;  1KWI A;  1BIR A;  3NBJ A;  2KF5 A;  4FMB A;  3GWR A;  4CDL A;  1AQZ A;  1OHP A;  2CWV A;  2D42 A;  3N9H A;  3NV0 B;  4XDV A;  3BNC A;  1TTO A;  3JUP A;  3NBR A;  1SPU A;  1YGW A;  4BL3 A;  3HII A;  2YFI B;  3PS8 A;  2OOV C;  5STD A;  4FMC A;  1Q42 A;  1BRJ A;  2BMR B;  1RNB A;  1N9J A;  1OAC A;  3WA3 A;  5AIG A;  5EVH A;  1C7H A;  1LOX A;  4LGQ A;  2GEX A;  3OWS A;  4WHA A;  3ROB A;  3FCS B;  2H0G A;  2Z76 A;  1G96 A;  4O3V A;  2GEY A;  3UL6 A;  1RGE A;  1SII A;  1K28 A;  1ULJ B;  3RNT A;  4GSP A;  3KFQ C;  1DET A;  1JBT A;  5KP1 A;  1JZO A;  4HM0 B;  2UX0 A;  3IMA B;  4KFD A;  4L7K A;  4EV5 A;  1RSN A;  1NB5 I;  3CU3 A;  1M1K 4;  1K41 A;  1G02 A;  1O7H B;  5CLK A;  1Q9E A;  3S67 A;  3B7C A;  1FGO A;  3EHC A;  2XSH B;  3F8H A;  1TU5 A;  3CC7 3;  3S29 A;  3N54 B;  1OH0 A;  1SIH A;  4TX4 A;  2GU1 A;  4X2H A;  1A90 A;  1K73 4;  2BMO B;  2CG1 A;  3PCR A;  1W6Y A;  3ZFZ A;  1IT7 A;  4OVM A;  5AIH A;  1KSI A;  1W6C A;  1JBR A;  2BU4 A;  4FCJ A;  1BAN A;  2A15 A;  1EKM A;  3MSO A;  1S5A A;  1VQN 3;  2SAR A;  5IEO A;  4FCZ A;  1YVB I;  2ZDJ A;  1UI8 A;  3OX9 A;  4XBY A;  3FGY A;  3NQZ A;  3CCQ 3;  3DGM A;  1W01 A;  2W56 A;  5IEN A;  2SBL A;  3FH1 A;  3EN1 B;  4MJD A;  4R9L A;  2XSO B;  3X3X A;  2RCD A;  4HM6 B;  1BSB A;  2WGO A;  3SX1 A;  3I56 3;  4HZ9 B;  1GD3 A;  1RGH A;  2R4I A;  2JQ5 A;  4MMY B;  3JVC A;  5LC6 A;  3HX8 A;  2P0X A;  3FF0 A;  4O02 B;  3G71 3;  1JZD A;  1B27 A;  1BOX A;  3JUO A;  1RJO A;  4EXR A;  1W5Z A;  4XM4 A;  5CK6 A;  2YX9 A;  4EBG A;  1B21 A;  4N3V A;  3CCM 3;  5KP3 A;  1CYV A;  1MGR A;  1Q7Y 4;  1B2U A;  1TIJ A;  5LC7 A;  1I2F A;  1X1X A;  1IQY A;  4K1V A;  1V57 A;  2CFL A;  3BLZ A;  2HMK B;  1MOL A;  2INX A;  2CFW A;  2RGQ A;  2ZL8 A;  5AEU B;  5IG5 A;  5JBS A;  1OF5 A;  3AMO A;  3OWU A;  1MWS A;  4HM7 B;  2AAE A;  3TDG A;  3DY5 A;  1KD1 4;  3DGY A;  2F98 A;  3FZW A;  4RZM A;  1RGG A;  2OQE A;  3K5T A;  3EQQ B;  1RGA A;  1A2P A;  4ORL A;  5ELJ A;  5IG4 A;  1FUT A;  3GRD A;  1RRL A;  4WP5 A;  2CX1 A;  2CWU A;  3LTC A;  4I5Q A;  1B2Z A;  4U13 A;  4NRE A;  1Z1S A;  1VQK 3;  2HMO B;  1FA3 A;  1YJN 3;  1JV2 B;  3WOE B;  2FNQ A;  1ISK A;  2IYJ A;  3MG2 A;  4X2O A;  4ZM8 A;  2KF6 A;  1HZ1 A;  1RCK A;  1DMQ A;  1C54 A;  2W9Q A;  3VGN A;  1IVW A;  3PZW A;  4HJL B;  3DMC A;  3WR2 A;  4NHF A;  4LZI A;  1QMA A;  5BVB A;  3GAX A;  3G8Z A;  4LYL B;  4XBX A;  3H3H A;  1STD A;  1MWT A;  3SOA A;  4RNT A;  3GZX B;  2R41 A;  4STD A;  3MPH A;  3S27 A;  3T8U A;  2O9U X;  4Q53 A;  3BNE A;  3LML A;  2W03 A;  4N6L A;  1YIT 3;  2WOH A;  2F56 A;  2GXF A;  1AR0 A;  1HKX A;  4H61 A;  8RNT A;  2GU3 A;  2XFS A;  1SAR A;  3B4O A;  2D1W A;  1JNQ A;  3NX0 A;  3V99 A;  1JB5 A;  2CHC A;  1AVK A;  3LZA A;  1JN5 B;  1RGL A;  1FGT A;  2IY2 A;  1UI7 A;  5FW5 A;  3SLU A;  1IV9 A;  2OTJ 3;  3MWZ A;  1QVG 2;  1B2S A;  2HMM B;  1NO3 A;  2JDI H;  2UGI A;  3BB9 A;  4XDW A;  5AII A;  5EEO A;  3PYJ A;  2CH9 A;  2XR8 B;  7GSP A;  1IYY A;  4FCM A;  1YJW 3;  1N5H A;  1YNV X;  2F5W A;  3SED A;  2ML6 A;  3AHW A;  3OV4 A;  1AVL A;  1BSA A;  3A76 A;  3D79 A;  4KZ1 A;  4N6M A;  4K1U A;  4I4K A;  4ILF A;  3U1W A;  3UB1 A;  1GD4 A;  3D9R A;  1VQL 3;  2Z77 A;  5D81 A;  3EJV A;  4PEJ A;  3Q90 A;  4N6O B;  3GZR A;  4BU4 A;  4CCV A;  4WYK B;  3BND A;  2P38 A;  1NWW A;  1RTU A;  1I2E A;  1RN7 A;  3HZP A;  1A2K A;  4HM3 B;  2P0M A;  3AGO A;  2F4Y A;  5BXQ A;  8CHO A;  2L1S A;  1GOV A;  2CFG A;  3DM8 A;  2CX0 A;  3CNM A;  1W02 A;  1DMM A;  3G4S 3;  3LH4 A;  3UL5 A;  4AKZ A;  1WTH A;  3KCH A;  1US1 A;  4R9K A;  1PU4 A;  3EC9 A;  1OUN A;  1RDS A;  1ZGX A;  1ZX2 A;  4L8O A;  1Y4K A;  3F9S A;  1RNT A;  1GS3 A;  2E2V A;  3PCS A;  1JBS A;  3NV0 A;  3GSP A;  3X40 A;  4XB5 A;  3WA2 X;  4KFF A;  2CIU A;  3F7X A;  3SOY A;  1I3I A;  3D5G A;  4EYC A;  1UGI A;  3D5I A;  2LQV A;  3BIR A;  1QVF 2;  3CCU 3;  1K8A 4;  3KE7 A;  2CC3 A;  1I3F A;  4HBR A;  1BRG A;  4MEI A;  1UUV B;  4KT3 B;  1BNI A;  3CCV 3;  1TFK A;  1BAO A;  2RBI A;  1B20 A;  1RGC A;  3OWY A;  1I0X A;  4HM4 B;  2J8X B;  3WOD G;  2CG0 A;  1PY3 A;  2W6J H;  1QAF A;  1LOW A;  3NXJ A;  3O8Y A;  4IPB A;  1I70 A;  3EN8 A;  1G0T A;  1Q40 B;  1ASK A;  1NU3 A;  1STF I;  3LT8 A;  5AI1 A;  3WMD A;  2OCT A;  1KC8 4;  1Q86 4;  2KF4 A;  4BTX A;  1KQS 2;  4MMX B;  5CF1 A;  1RLS A;  3HI7 A;  3U97 A;  4QWT A;  1UUW B;  1WQL B;  2P09 A;  4J8T A;  1BNR A;  3GZY B;  3DGN A;  2KRT A;  1VQ8 3;  2HMJ B;  3FSD A;  3CMA 3;  1N8R 4;  3LOY A;  1DMN A;  1CQS A;  2KAA A;  3EB8 A;  1I0V A;  1AY7 A;  1RMS A;  1JKG B;  1VZZ A;  4N6V 0;  2F99 A;  2QIY A;  2UUG C;  3NUV A;  3URP A;  1I8V A;  1BRH A;  2W9P A;  5IF6 A;  3BU4 A;  1BNS A;  5AIF A;  1ZO2 A;  2L4V A;  3DGO A;  4R4K A;  1RHL A;  1LQG C;  1M1X B;  1LVN A;  2MC8 A;  3T8N A;  2K54 A;  1W4N A; 
#chains in the Genus database with same CATH homology
 2RNT A;  1I2G A;  1UCJ A;  1RGL A;  1BRI A;  9RNT A;  1BRK A;  3WHO A;  2F5M A;  1RGE A;  3RNT A;  1B2S A;  1TRQ A;  2AAD A;  4GSP A;  1PYL A;  1LOY A;  5BU4 A;  7GSP A;  1DET A;  1JBT A;  1IYY A;  3Q3F A;  4GHO A;  1YNV X;  2F5W A;  1BRN L;  3AHW A;  1BSA A;  1LNI A;  1RSN A;  1G02 A;  1GMR A;  1B2X A;  1Q9E A;  3AGN A;  1GOU A;  1BSE A;  4BU4 A;  1GMP A;  1GOY A;  1R4Y A;  1RTU A;  1I2E A;  3AGO A;  7RNT A;  1GMQ A;  1JBR A;  2F4Y A;  2BU4 A;  1GOV A;  1BRS A;  1UCK A;  1BAN A;  1GSP A;  6RNT A;  1B2M A;  4HOH A;  2SAR A;  1X1U A;  1RCL A;  3KCH A;  1RGF A;  1BNE A;  4HAA A;  2HOH A;  1RDS A;  1ZGX A;  4J5G A;  1MGW A;  5HOH A;  1B3S A;  1RNT A;  1JBS A;  4BIR A;  3GSP A;  1BSB A;  2BIR A;  2C4B A;  1HYF A;  1RGH A;  1FZU A;  2ZA4 A;  1I3I A;  3D5G A;  1BGS A;  1X1W A;  3D5I A;  1B27 A;  1BOX A;  1BVI A;  3BIR A;  1FW7 A;  1B21 A;  1I3F A;  1BRG A;  1UCL A;  1UCI A;  1MGR A;  1B2U A;  5BIR A;  1BU4 A;  1I2F A;  1X1X A;  1YVS A;  1T2I A;  1BNI A;  1RN1 A;  1BAO A;  2RBI A;  1B20 A;  1RGC A;  2AAE A;  1I0X A;  1X1Y A;  1LOV A;  3A5E A;  3DGY A;  1RGG A;  1PY3 A;  1LRA A;  1RGA A;  1A2P A;  1LOW A;  1FUT A;  3AHS A;  1I70 A;  3D4A A;  1FUS A;  1BSC A;  6GSP A;  2KF4 A;  1B2Z A;  5RNT A;  1FYS A;  1BUJ A;  3DH2 A;  1DE3 A;  1RLS A;  2KF6 A;  2GSP A;  1HZ1 A;  1RCK A;  1BNR A;  1C54 A;  3SYU A;  3WR2 A;  4J5K A;  1T2H A;  2KF3 A;  1BNF A;  1CH0 A;  2KAA A;  1BSD A;  1BNJ A;  1I0V A;  1AY7 A;  1RMS A;  1BIR A;  3HOH A;  4RNT A;  2KF5 A;  1AQZ A;  1TRP A;  3URP A;  1I8V A;  1BRH A;  1BNG A;  3BU4 A;  1BNS A;  1TTO A;  1RGK A;  1YGW A;  2F56 A;  5GSP A;  8RNT A;  1RHL A;  1SAR A;  1RN4 A;  1BRJ A;  1RNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...