4ORLA

Crystal structure of a duf4783 family protein (bacova_04304) from bacteroides ovatus atcc 8483 at 1.40 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
GQEIPAGVITAFKRGSSQELSKYMGDKVNLVFQGRSTNVDKQKATAAMQEFFTKNKVSGFNVNHQGKRDESSFVIGTLATTNGNFRVNCFLKKVQNQYLIHQIRIDKINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_04304) from Bacteroides ovatus ATCC 8483 at 1.40 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 33
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4orlA00
2B1XB 2PZVA 4X2OA 3SOYA 5AEWB 4PEJA 1JN5A 4WYKB 3MG2A 3UJMA 6STDA 3E99A 3MYTA 4L8PA 1OF5A 4HM5B 4HVNA 4CDLA 3GZRA 3F9SA 1OGZA 5IG3A 1CQSA 2BMRB 3CNMA 5DRVA 3WMDA 4WWUC 1GY7A 1TP6A 5TGNA 1QMAA 1C7HA 2JQ5A 3FH1A 5EVHA 1O7NB 2UX0A 4ORLA 3CU3A 3NHXA 1GY5A 1U5OA 1GS3A 3UNLA 1TUHA 4XB5A 1Q40B 2YFLB 5HGRA 4GB5A 4WYKA 4K1UA 3EX9A 2HMNB 2Z77A 1UUVB 3OWSA 3CPOA 1NDOB 3SOAA 1OHPA 1OUNA 3JUMA 2YFIB 3G16A 5AIGA 3F8HA 3OWUA 1JB4A 1EG9B 5IEPA 3BLZA 1O7WB 3EN8A 3GRDA 1EA2A 1E3RA 1K41A 3NM2A 1DMNA 3KSPA 1OCVA 3EF8A 3ER7A 4WP5A 1OPYA 2HMJB 1ZO2A 3Q90A 5BXQA 2B24B 5IENA 1Q40A 2HMLB 4LEHA 3B4PA 3STDA 3FZWA 2Z76A 2CKFB 1O7PB 2BNGA 3F40A 5IEOA 3NUVA 3OX9A 4H3UA 5FW5A 3I0YA 3VGNA 4J9AA 2GEYA 5KP4A 3LYGA 4HM0B 4XBXA 3HK4A 3ECFA 2XSOB 1OH0A 4XBYA 2GBXB 4L8OA 3IPTA 3FF2A 2RFRA 3OWYA 2F98A 2QIYA 3M8CA 2INXA 2GXFA 3EN1B 5CF2A 3HX8A 3EBYA 1VZZA 4FCMA 3GWRA 1ZX2A 4HM6B 1BUQA 4Q53A 1OHSA 2BMQB 5CK6A 3RGAA 1OGXA 5STDA 4XM4A 4I4KA 1S5AA 5KP3A 1GY6A 2I9WA 2F99A 3K0ZA 4X2HA 1O7GB 3EQQB 4XBTA 8CHOA 1ISKA 2RCDA 5KP1A 4OVMA 3RGRA 4HM7B 2XR8B 3F7XA 3JUOA 1JKGB 5JPPA 3MG3A 1NU3A 3DM8A 3FLJA 3BB9A 5CLKA 1UUWB 3FGYA 3KKGA 1Z1SA 3GZBA 5AIFA 3OXAA 4HM1B 1GYBA 3JUQA 1DMQA 3MHEA 1W01A 3NBRA 3JUPA 4HZBB 3CNXA 4MJDA 3S5CA 3F14A 4LMIA 3NV0A 2A15A 3GZYB 2HMMB 5IG4A 7STDA 3MG1A 5CXOA 3HZPA 4R9KA 1W00A 2YFJB 4R1KA 3B4OA 5D81A 1JKGA 1STDA 2STDA 5IERA 1W02A 5DREA 3OV4A 4XDWA 2QGUA 3LZAA 5AEUB 3NXJA 5CF1A 4OUQA 4HKVB 1JB5A 3DZLA 5IG0A 4K1VA 3VSYA 3T8NA 5G2GA 4N3VA 3MKIA 3F7SA 5D83A 5AI1A 3SEDA 2Z7AA 5AIHA 1A2KA 1SJWA 4HJLB 1DMMA 4IIAA 3FKAA 3EJVA 3JUNA 3MSOA 4R9LA 5AIIA 1QJGA 3FSDA 3EHCA 1NWWA 1Q42A 3B7CA 3D9RA 4HM2B 2GBWB 3NV0B 1OHOA 3B8LA 4HM8B 1O7HB 3ROBA 3T8UA 4KVHA 5JPUA 1O7MB 4STDA 4U13A 2RGQA 4FCJA 3DMCA 5IF6A 2HMKB 3G8ZA 2BMOB 3H3HA 1JB2A 2IMJA 1HKXA 3DUKA 4HM4B 4XDVA 2R4IA 1JN5B 5BVBA 3EBTA 1IDPA 2F86B 2GEXA 3H51A 2XRXB 3FF0A 1OF5B 3EC9A 1E3VA 5D82A 1ULJB 3K7CA 3F8XA 1W6YA 3KE7A 2W2CA 3GZXB 3KZTA 3G0KA 1ULIB 3A76A 1E97A 2OWPA 4LGQA 1WQLB 4J8TA 4L7KA 2K54A 2HMOB 3DXOA 5IG5A 4HM3B 1AR0A 4HZ9B 4RZMA 2CHCA 1ASKA 2XSHB
chains in the Genus database with same CATH superfamily
1TIJA 2P38A 1L5GB 1RN7A 3N54B 5BIRA 3X3YA 2B1XB 2CFLA 1HZ1A 2BIRA 1BNGA 1FYSA 1LOXA 1W2B2 1AVKA 1HYFA 1Q864 1UDII 1D6ZA 2PZVA 4X2OA 2CWVA 3SOYA 5AEWB 4K61A 4PEJA 1JN5A 4WYKB 2OOVA 1B2SA 3MG2A 1YNVX 8RNTA 1KSIA 3UJMA 6STDA 4KFEA 4RNYA 1JRQA 2CWTA 1BNFA 3E99A 1BOXA 3NM7A 3AMOA 3MYTA 1TRPA 2P05A 1UGHI 3O8YA 3X3XA 4L8PA 5M19A 1OF5A 1UCLA 1RTUA 3U1WA 3TDGA 5A0OB 1BAOA 4HM5B 4KFDA 1GOVA 3X41A 4HVNA 2FNQA 2V1LA 3GZRA 3WDGB 3F9SA 4CDLA 3G6E3 1OGZA 5IG3A 4LSOA 3WHOA 1B2ZA 3GAXA 1CQSA 2BMRB 3CNMA 1Y4KA 3CMA3 2XGNA 5DRVA 5ELJA 1B3SA 1WMOA 3DGOA 3WMDA 4WWUC 1LNIA 3S29A 4N6TA 5AYSC 1IVVA 1GY7A 4KFFA 1TP6A 3D3LA 2IUJA 3CCS3 1A67A 1I0XA 1SARA 2E2VA 5TGNA 1JZOA 1QMAA 1C7HA 2JQ5A 3FH1A 3CCE3 1YIT3 1FUTA 1A2VA 1SQWA 2F4YA 3BNBA 3DGNA 5EVHA 1RNBA 4FMBA 2PNCA 1O7NB 3AHSA 3CCU3 1BSAA 4ZM8A 1TRQA 1KQS2 1V57A 1DETA 2UX0A 1RGCA 1B2MA 1W6CA 4O2HA 4ORLA 1UCKA 3DH2A 2Y74A 3CU3A 4FMDA 2KF6A 3WA3A 3NHXA 1GY5A 1U5OA 3QRDA 1GS3A 3FG1A 4RNTA 1TUHA 3UNLA 4CCVA 5EEOA 4XB5A 1JV2B 3UL5A 1Q40B 1BU4A 1BNRA 1I2EA 2YFLB 5HGRA 1X1UA 3D79A 4GB5A 4WYKA 1FGRA 1K734 4K1UA 4O02B 1WTHA 3EX9A 3I553 5LC6A 5JBSA 2HMNB 1RRHA 2Z77A 4R4KA 1BRIA 1UUVB 1B2XA 2W9PA 3OWSA 3ZFZA 3CPOA 1NDOB 3SOAA 1OHPA 2KF5A 1OUNA 3LXUX 3ZG0A 3T0UA 3JUMA 2YFIB 3FG3A 3G16A 3URPA 1D6UA 2OQEC 5AIGA 3HIGA 4IT7A 3KCHA 3CD63 3WOFB 3LT9A 1KWIA 1KD14 3F8HA 2UGIA 1RGGA 3OWUA 1JB4A 3DGYA 4J5GA 1BANA 2IUKA 1EG9B 1CYUA 3CCV3 1BIRA 5IEPA 4O8SA 1IYYA 3BLZA 1O7WB 3EN8A 2C4BA 3PYJA 3GRDA 4I5QA 1G02A 1FGTA 1EA2A 1BRNL 1E3RA 1ROAA 1K41A 1TFKA 3NM2A 4FR9A 4MMYB 1U8CB 1QAFA 3FCSB 1DMNA 3KSPA 1KC84 1BSCA 3Q1CA 5M18A 1YGWA 2W56B 2GSPA 1AQZA 1CEWI 1OCVA 2D1WA 3AHWA 3EF8A 2XH9A 1RKYA 3DY5A 3CCQ3 3AGNA 3ER7A 2KF4A 3FG4A 4WP5A 2OQEA 1IVWA 2IY2A 1OPYA 1PU4A 1US1A 1RGHA 2HMJB 2CH9A 1DE3A 3V99A 1AVLA 1ZO2A 3Q90A 2P0MA 4AEQA 4AKYA 5BXQA 1UCJA 2B24B 1LVNA 3LMLA 1N5PA 1C54A 1BRKA 1I0VA 1Q40A 1UGIA 3IMAB 5IENA 3X42A 1G96A 1W2ZA 2HMLB 3B4PA 1RN1A 3FZWA 4LEHA 3STDA 3CC73 1X1WA 2Z76A 2CKFB 1O7PB 2BNGA 5M1AA 3X3ZA 1QALA 2CC3A 4AKZA 1VQO3 4RBNA 3F40A 3LH4A 5IEOA 3QK9A 3NUVA 1NO3A 4FMCA 3D5GA 1W4NA 3OX9A 4H3UA 1LQMB 5FW5A 2LYXA 3ALAA 1N9EA 1IK3A 2XGLA 1IV7A 2C10A 3CME3 3I0YA 1R4YA 1RLSA 3PCRA 1M9GA 3VGNA 4J9AA 2GEYA 2E2TA 5KP4A 1VQL3 3LYGA 4HM0B 1GOYA 1FZUA 7RNTA 3X40A 1YVSA 3S28A 2MC8A 1QVG2 1T3BA 4IPBA 4XBXA 2SARA 1WNHA 4GHOA 2Z6BA 5AYRB 4BL2A 4CPKA 2CFKA 1RRLA 3IJEB 3LOYA 4N6LA 1RMSA 1VQ43 1WMPA 5HOHA 3HK4A 1Q7HA 2H0GA 3ECFA 4BTXA 1YJW3 2KXGA 1AV4A 2XSOB 2CFWA 2CFDA 5GSPA 1OH0A 5LC7A 1QAKA 3HOHA 6GSPA 2CIUA 4XBYA 1QVF2 2GBXB 1YVBI 4L8OA 1W5ZA 1FGQA 1LOWA 3BNCA 3IPTA 3FF2A 1IQ8A 2RFRA 1F8NA 2W56A 3OWYA 3NBBA 1VQ63 2D42A 3L0RA 3PGBA 2F98A 2QIYA 1VQP3 3M8CA 1TTOA 1X1YA 3PS8A 1BRSA 1BNJA 2INXA 2K0MA 2GXFA 3DGLA 1JBRA 3EN1B 2XSHB 3NX0A 3G4S3 5CF2A 3WOEB 3HX8A 3EBYA 1VZZA 4FCMA 3GWRA 3KIIA 1ZX2A 1RCLA 4HAAA 1GSPA 4HM6B 2OTJ3 1BUQA 1LOYA 1YGEA 4Q53A 1OHSA 1MWUA 4TX4A 3SXXA 2KF3A 1JBTA 2BHMA 1YIJ3 1YJ93 3NQYA 1S723 2BMQB 1AY7A 2CG1A 5CK6A 3BIRA 4ILFA 3RGAA 3RNTA 5I97A 1GMQA 1T5YA 1OGXA 5STDA 2CFGA 4RZMA 1N9JA 1FGOA 1I3IA 4XM4A 5G1LA 1JZDA 3BNDA 4I4KA 4MMXB 1S5AA 5KP3A 1B20A 3N9HA 4J5KA 1GY6A 3KN4A 3BNEA 3N8BA 2I9WA 4K90B 2F99A 3K0ZA 5RNTA 1M1K4 4X2HA 4NREA 4WHAA 1BSDA 2R41A 2WO0A 1M1XB 1UUGB 1RGKA 1O7GB 1RN4A 3EQQB 4KT3B 3S27A 1Q824 1M904 1GMPA 1Q9EA 4XBTA 1WMNA 1ROVA 8CHOA 1SIHA 5ELUA 1ISKA 2RCDA 4O3VA 4EV2A 4H61A 4R80A 1EUIC 1LNHA 2ZHXB 5KP1A 4OVMA 1VQQA 3RGRA 4BIRA 1RSNA 4HM7B 2XEPA 1IQXA 7GSPA 4GSPA 4N6MA 2XR8B 3F7XA 1MNLA 1VQK3 3PXMA 2P0XA 2F5MA 3JUOA 1VQ93 1JKGB 5JPPA 1D6YA 2WGQA 3MG3A 3NQZA 3Q3FA 3DM8A 4JF8A 1VQM3 1NNVA 2P09A 3FLJA 1OACA 2W0QA 3BB9A 4GL6A 4MEIA 3EB8A 3MPHA 3WA2X 1JBSA 1T2IA 4WFOA 5CLKA 4BTYA 1IU7A 1EKMA 3V92A 2FGTA 5BU4A 1UUWB 3U97A 3FGYA 4EC6A 4NHFA 3KKGA 1Z1SA 1GD3A 1CH0A 1ZS7A 3GZBA 5AIFA 1PYLA 1IQYA 3OXAA 4HM1B 1GYBA 3JUQA 3KFQC 1DMQA 2ZA4A 3VF1A 3MHEA 1W01A 2IYJA 4EV5A 1N8R4 1BRJA 1RGEA 1LQGC 1RNTA 3NBRA 3V98A 3NBJA 2QA43 3JUPA 4HZBB 3CNXA 4RNZA 4MJDA 2W04A 1BNSA 1V58A 1EQKA 1I2GA 2BO9B 1RDSA 1MOLA 3RDEA 1W7CA 3GSPA 4NPBA 3S5CA 4EBGA 3F14A 4LMIA 1ZGXA 2H0IA 3CC43 1IV9A 1TJDA 2FXTA 3NV0A 1MGWA 3GZYB 4MMZB 2CG0A 2HMMB 5IG4A 7STDA 3MG1A 1MWRA 1I2FA 4LYLB 2RSXA 5CXOA 1Q7Y4 2WGOA 3HZPA 4R9KA 1CYVA 3CC23 5G1KA 4EYCA 1W00A 3G713 3PCSA 2YFJB 1JNQA 3Q2PA 4EW5A 4R1KA 1FW7A 2QEX3 3B4OA 5D81A 1JKGA 1RJOA 1STDA 2AAEA 2STDA 1T2HA 5IERA 3CPW2 1RHLA 1W02A 2MF7A 5DREA 3OV4A 4XDWA 1BVIA 2QGUA 2ZL8A 3LZAA 1I3FA 1BNEA 2RBIA 2SBLA 5AEUB 3HI7A 1JJ22 1PY3A 3NXJA 2BT3A 3UL6A 5CF1A 4OUQA 1FA3A 1RGFA 4HKVB 3EE1A 1JB5A 3DZLA 4JRFA 3LT8A 4K1VA 5IG0A 2UUGC 1UI7A 3K5TA 1G0TA 3VSYA 2Y73A 3T8NA 1K8A4 1RGLA 1K28A 3WR2A 2O9UX 4HYZA 5G2GA 4N3VA 1TU5A 1Q814 4BTWA 3MKIA 1X1XA 1GD4A 3F7SA 3K9MC 5D83A 2J8XB 1LXEA 1BRGA 5AI1A 2W9QA 2Z7AA 3SEDA 5AIHA 2CX1A 5FGOA 1A2KA 1YHQ3 1A90A 3AGOA 3SVAA 1DYUA 1SJWA 4HJLB 3CCL3 4LZIA 1DMMA 2ZDJA 1HU9A 3SLUA 1B2UA 4IIAA 3FKAA 4N6OB 1RGAA 1V74A 3EJVA 1I8VA 3JUNA 4EXRA 9RNTA 1BSEA 3MSOA 1MWTA 4R9LA 2KAAA 5AIIA 3LTBA 2XF3A 1QJGA 3FSDA 2F5WA 3DGMA 1BRHA 3EHCA 2CK3H 1NWWA 3A5EA 1IVXA 1Q42A 2E2UA 3B7CA 1FUSA 3LTDA 4KZ1A 3HIIA 3CCJ3 4N6NB 1NB3I 4QWTA 3KSED 4OK0A 3D9RA 4HM2B 2GBWB 2H0HA 1OHOA 3B8LA 3NV0B 1YI23 2O3OA 1IT8A 2CW9A 2ML5A 3I563 4HM8B 1O7HB 3ROBA 1K9M4 2KCDA 2F56A 1IT7A 2HOHA 4N6UA 2KRTA 3SYUA 3T8UA 2BU4A 2JDIH 4KVHA 3S67A 1GOUA 1UW1A 5JPUA 1MGRA 4HOHA 1NB5I 1O7MB 4HBRA 2YX9A 4STDA 4BL3A 4U13A 1VQ83 4CJNA 2GU1A 3K63A 4DKIA 2RGQA 2WOFA 4FCZA 2CX0A 4FCJA 3DMCA 3LTCA 5IF6A 2HMKB 1B27A 3D4AA 3G8ZA 2BMOB 1BSBA 6RNTA 2IA7A 3BU4A 1MWSA 3H3HA 1EEJA 3MWZA 4BU4A 3CCM3 2ML6A 1JB2A 2IMJA 1HKXA 2Q07A 3DUKA 4HM4B 4XDVA 2OTL3 1A2PA 3LTAA 2R4IA 1PFPA 1JN5B 1RCKA 1TFOA 3EBTA 5BVBA 1IDPA 3CXC2 2F86B 1R4CA 5IW9A 1FGMA 1UCIA 3AMOB 1W6GA 2GEXA 3H51A 1J2BA 1DVDA 2XRXB 3FF0A 1VQN3 1OF5B 1BUJA 2W03A 3EC9A 1E3VA 2M7OA 3PZWA 1GMRA 1LOVA 4G1MB 5D82A 3OW22 2OCTA 3CCR3 3D5IA 2L1SA 2W6JH 3JVCA 1BGSA 3SX1A 1SIIA 1ULJB 3K7CA 1N5HA 1VQ73 2CWUA 3F8XA 1FUWA 1W6YA 1LRAA 1STFI 3KE7A 2W2CA 3GZXB 3KZTA 1IVUA 2XFTA 2LQVA 1ULIB 3A76A 3G0KA 1NJI4 1E97A 2GU3A 2OWPA 4LGQA 1WQLB 1BNIA 1DVCA 2OOVC 4J8TA 1SPUA 1UI8A 4L7KA 3ZG5A 2C11A 1VQ53 1I70A 2K54A 4N6V0 5EQLA 3WODG 1B21A 2K3DA 2WOHA 2RNTA 1N8QA 3J7Yd 1YJN3 2HMOB 3DXOA 5IG5A 4FMAA 3UB1A 4HM3B 1AR0A 2L4VA 4HZ9B 2AADA 1NU3A 2XFSA 2CHCA 1ASKA 2A15A
chains in the Genus database with same CATH topology
1TIJA 2P38A 1L5GB 1RN7A 3N54B 3X3YA 2B1XB 2CFLA 1LOXA 1W2B2 1AVKA 1Q864 1D6ZA 2PZVA 4X2OA 2CWVA 3SOYA 5AEWB 4K61A 4PEJA 1JN5A 4WYKB 2OOVA 3MG2A 1KSIA 3UJMA 6STDA 4KFEA 4RNYA 1JRQA 2CWTA 3E99A 3NM7A 3AMOA 3MYTA 2P05A 3X3XA 3O8YA 4L8PA 1OF5A 3U1WA 3TDGA 5A0OB 4KFDA 4HM5B 3X41A 4HVNA 2FNQA 2V1LA 3GZRA 3WDGB 3F9SA 4CDLA 3G6E3 1OGZA 5IG3A 4LSOA 3GAXA 1CQSA 2BMRB 3CNMA 1Y4KA 3CMA3 2XGNA 5DRVA 5ELJA 1WMOA 3DGOA 3WMDA 4WWUC 3S29A 4N6TA 5AYSC 1IVVA 1GY7A 4KFFA 1TP6A 3D3LA 2IUJA 3CCS3 1A67A 2E2VA 5TGNA 3CCE3 1QMAA 1C7HA 2JQ5A 3FH1A 1YIT3 1SQWA 1A2VA 3BNBA 3DGNA 5EVHA 4FMBA 2PNCA 1O7NB 3CCU3 4ZM8A 1KQS2 2UX0A 1W6CA 4O2HA 4ORLA 2Y74A 3CU3A 4FMDA 3WA3A 3NHXA 1GY5A 1U5OA 3QRDA 1GS3A 3FG1A 3UNLA 1TUHA 4CCVA 5EEOA 4XB5A 1JV2B 3UL5A 1Q40B 2YFLB 5HGRA 4GB5A 4WYKA 1FGRA 1K734 4K1UA 4O02B 1WTHA 3EX9A 3I553 5LC6A 5JBSA 2HMNB 1RRHA 2Z77A 4R4KA 1UUVB 2W9PA 3OWSA 3CPOA 1NDOB 3SOAA 1OHPA 1OUNA 3LXUX 3T0UA 3JUMA 2YFIB 3FG3A 3G16A 1D6UA 2OQEC 5AIGA 3HIGA 4IT7A 3CD63 3WOFB 3LT9A 1KWIA 1KD14 3F8HA 3OWUA 1JB4A 2IUKA 1EG9B 3CCV3 5IEPA 4O8SA 3BLZA 1O7WB 3EN8A 3PYJA 3GRDA 1FGTA 1EA2A 1E3RA 1ROAA 1K41A 1TFKA 3NM2A 4FR9A 4MMYB 1U8CB 1QAFA 3FCSB 1DMNA 3KSPA 1KC84 3Q1CA 2W56B 1CEWI 1OCVA 2D1WA 1RKYA 3EF8A 2XH9A 3CCQ3 3DY5A 3ER7A 3FG4A 4WP5A 2OQEA 1IVWA 1OPYA 1PU4A 1US1A 2HMJB 2CH9A 3V99A 1AVLA 1ZO2A 3Q90A 2P0MA 4AEQA 4AKYA 5BXQA 2B24B 1LVNA 3LMLA 1N5PA 5IENA 1Q40A 3IMAB 3X42A 1G96A 1W2ZA 2HMLB 3B4PA 4LEHA 3FZWA 3STDA 3CC73 2Z76A 2CKFB 1O7PB 2BNGA 3X3ZA 4AKZA 1QALA 2CC3A 1VQO3 4RBNA 3F40A 3LH4A 5IEOA 3QK9A 3NUVA 1NO3A 4FMCA 1W4NA 3OX9A 4H3UA 5FW5A 2LYXA 3ALAA 1N9EA 1IK3A 2XGLA 1IV7A 2C10A 3CME3 3I0YA 3PCRA 1M9GA 3VGNA 4J9AA 2GEYA 2E2TA 5KP4A 1VQL3 3LYGA 4HM0B 3X40A 3S28A 2MC8A 1QVG2 4IPBA 4XBXA 1WNHA 2Z6BA 5AYRB 2CFKA 1RRLA 3IJEB 3LOYA 4N6LA 1VQ43 1WMPA 3HK4A 3ECFA 4BTXA 1YJW3 2KXGA 1AV4A 2XSOB 2CFWA 2CFDA 1OH0A 5LC7A 1QAKA 2CIUA 4XBYA 1QVF2 2GBXB 1YVBI 4L8OA 1W5ZA 1FGQA 3BNCA 3IPTA 3FF2A 1IQ8A 2RFRA 1F8NA 2W56A 3OWYA 3NBBA 1VQ63 2D42A 3L0RA 3PGBA 2F98A 2QIYA 1VQP3 3M8CA 3PS8A 2INXA 2K0MA 2GXFA 3DGLA 3EN1B 3NX0A 3G4S3 5CF2A 3WOEB 3HX8A 3EBYA 1VZZA 4FCMA 3GWRA 3KIIA 1ZX2A 4HM6B 2OTJ3 1BUQA 1YGEA 4Q53A 1OHSA 4TX4A 3SXXA 2BHMA 1YIJ3 1YJ93 3NQYA 1S723 2BMQB 2CG1A 5CK6A 3RGAA 5I97A 1T5YA 1OGXA 5STDA 2CFGA 4RZMA 1N9JA 1FGOA 4XM4A 4I4KA 3BNDA 4MMXB 1S5AA 5KP3A 3N9HA 1GY6A 3KN4A 3BNEA 3N8BA 2I9WA 4K90B 2F99A 3K0ZA 1M1K4 4X2HA 4NREA 4WHAA 2WO0A 1M1XB 3S27A 1Q824 1O7GB 3EQQB 1CYUA 1M904 4XBTA 1WMNA 1ROVA 8CHOA 1SIHA 5ELUA 1ISKA 2RCDA 4O3VA 4EV2A 4H61A 4R80A 1LNHA 5KP1A 4OVMA 3RGRA 4HM7B 2XEPA 1IQXA 4N6MA 2XR8B 3F7XA 1MNLA 1VQK3 3PXMA 2P0XA 3JUOA 1VQ93 1JKGB 5JPPA 1D6YA 2WGQA 3MG3A 3NQZA 3DM8A 4JF8A 1VQM3 2P09A 3FLJA 1OACA 2W0QA 3BB9A 4GL6A 4MEIA 3EB8A 3MPHA 3WA2X 4WFOA 5CLKA 4BTYA 1IU7A 1EKMA 3V92A 2FGTA 1UUWB 3U97A 3FGYA 4EC6A 4NHFA 3KKGA 1Z1SA 1GD3A 3GZBA 5AIFA 1IQYA 3OXAA 4HM1B 1GYBA 3JUQA 3KFQC 1DMQA 3VF1A 3MHEA 1W01A 4EV5A 1N8R4 3V98A 3NBRA 3NBJA 2QA43 3JUPA 4HZBB 3CNXA 4RNZA 4MJDA 2W04A 1EQKA 2BO9B 1MOLA 3RDEA 1W7CA 3S5CA 4EBGA 3F14A 4LMIA 3CC43 1IV9A 2FXTA 3NV0A 2A15A 3GZYB 4MMZB 2CG0A 2HMMB 5IG4A 7STDA 3MG1A 2RSXA 5CXOA 1Q7Y4 2WGOA 3HZPA 4R9KA 1CYVA 3CC23 4EYCA 1W00A 3G713 3PCSA 2YFJB 1JNQA 3Q2PA 4R1KA 2QEX3 3B4OA 5D81A 1JKGA 1RJOA 1STDA 3CPW2 2STDA 5IERA 1W02A 2MF7A 5DREA 3OV4A 4XDWA 2QGUA 2ZL8A 3LZAA 2SBLA 5AEUB 3HI7A 1JJ22 3NXJA 2BT3A 3UL6A 5CF1A 4OUQA 1FA3A 4HKVB 3EE1A 1JB5A 3DZLA 4JRFA 3LT8A 4K1VA 5IG0A 3K5TA 1UI7A 3VSYA 1K8A4 2Y73A 3T8NA 1K28A 2O9UX 4HYZA 5G2GA 4N3VA 1TU5A 1Q814 4BTWA 3MKIA 1GD4A 3F7SA 3K9MC 5D83A 1LXEA 5AI1A 3SEDA 2W9QA 2Z7AA 5AIHA 1YHQ3 5FGOA 1A2KA 1A90A 3SVAA 1DYUA 1SJWA 4HJLB 3CCL3 4LZIA 1DMMA 2ZDJA 1HU9A 3SLUA 4IIAA 3FKAA 4N6OB 1V74A 3EJVA 3JUNA 4EXRA 3MSOA 4R9LA 5AIIA 3LTBA 2XF3A 1QJGA 3FSDA 3DGMA 3EHCA 2CK3H 1NWWA 1IVXA 1Q42A 2E2UA 3B7CA 3CCJ3 3LTDA 4KZ1A 3HIIA 4N6NB 1NB3I 4QWTA 3KSED 4OK0A 3D9RA 4HM2B 2GBWB 3NV0B 1OHOA 3B8LA 1YI23 2O3OA 1IT8A 2CW9A 2ML5A 3I563 4HM8B 1O7HB 3ROBA 1K9M4 2KCDA 1IT7A 4N6UA 3T8UA 2KRTA 2JDIH 3S67A 4KVHA 1UW1A 5JPUA 1NB5I 1O7MB 4HBRA 2YX9A 4STDA 4U13A 1VQ83 2GU1A 3K63A 2RGQA 2WOFA 4FCZA 4FCJA 3DMCA 3LTCA 5IF6A 2HMKB 3G8ZA 2BMOB 2IA7A 3H3HA 3MWZA 3CCM3 2ML6A 1JB2A 2IMJA 1HKXA 2Q07A 3DUKA 4HM4B 4XDVA 2OTL3 3LTAA 2R4IA 1PFPA 1JN5B 1TFOA 3EBTA 5BVBA 1IDPA 3CXC2 2F86B 1R4CA 5IW9A 1FGMA 3AMOB 1W6GA 2GEXA 3H51A 1J2BA 1DVDA 2XRXB 3FF0A 1VQN3 1OF5B 2W03A 3EC9A 1E3VA 2M7OA 3PZWA 4G1MB 5D82A 3OW22 2OCTA 3CCR3 3JVCA 2W6JH 3SX1A 1SIIA 1ULJB 3K7CA 1N5HA 1VQ73 2CWUA 3F8XA 1FUWA 1W6YA 1STFI 3KE7A 2W2CA 3GZXB 3KZTA 1IVUA 2XFTA 2LQVA 1ULIB 3A76A 3G0KA 1NJI4 1E97A 2GU3A 2OWPA 4LGQA 1WQLB 1DVCA 2OOVC 4J8TA 4L7KA 1SPUA 1UI8A 2C11A 1VQ53 2K54A 4N6V0 5EQLA 2WOHA 1N8QA 3J7Yd 1YJN3 2HMOB 3DXOA 5IG5A 4FMAA 3UB1A 4HM3B 1AR0A 2L4VA 4HZ9B 3WODG 1NU3A 2XFSA 2CHCA 1ASKA 2XSHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1X B;  2PZV A;  4X2O A;  3SOY A;  5AEW B;  4PEJ A;  1JN5 A;  4WYK B;  3MG2 A;  3UJM A;  6STD A;  3E99 A;  3MYT A;  4L8P A;  1OF5 A;  4HM5 B;  4HVN A;  4CDL A;  3GZR A;  3F9S A;  1OGZ A;  5IG3 A;  1CQS A;  2BMR B;  3CNM A;  5DRV A;  3WMD A;  4WWU C;  1GY7 A;  1TP6 A;  5TGN A;  1QMA A;  1C7H A;  2JQ5 A;  3FH1 A;  5EVH A;  1O7N B;  2UX0 A;  4ORL A;  3CU3 A;  3NHX A;  1GY5 A;  1U5O A;  1GS3 A;  3UNL A;  1TUH A;  4XB5 A;  1Q40 B;  2YFL B;  5HGR A;  4GB5 A;  4WYK A;  4K1U A;  3EX9 A;  2HMN B;  2Z77 A;  1UUV B;  3OWS A;  3CPO A;  1NDO B;  3SOA A;  1OHP A;  1OUN A;  3JUM A;  2YFI B;  3G16 A;  5AIG A;  3F8H A;  3OWU A;  1JB4 A;  1EG9 B;  5IEP A;  3BLZ A;  1O7W B;  3EN8 A;  3GRD A;  1EA2 A;  1E3R A;  1K41 A;  3NM2 A;  1DMN A;  3KSP A;  1OCV A;  3EF8 A;  3ER7 A;  4WP5 A;  1OPY A;  2HMJ B;  1ZO2 A;  3Q90 A;  5BXQ A;  2B24 B;  5IEN A;  1Q40 A;  2HML B;  4LEH A;  3B4P A;  3STD A;  3FZW A;  2Z76 A;  2CKF B;  1O7P B;  2BNG A;  3F40 A;  5IEO A;  3NUV A;  3OX9 A;  4H3U A;  5FW5 A;  3I0Y A;  3VGN A;  4J9A A;  2GEY A;  5KP4 A;  3LYG A;  4HM0 B;  4XBX A;  3HK4 A;  3ECF A;  2XSO B;  1OH0 A;  4XBY A;  2GBX B;  4L8O A;  3IPT A;  3FF2 A;  2RFR A;  3OWY A;  2F98 A;  2QIY A;  3M8C A;  2INX A;  2GXF A;  3EN1 B;  5CF2 A;  3HX8 A;  3EBY A;  1VZZ A;  4FCM A;  3GWR A;  1ZX2 A;  4HM6 B;  1BUQ A;  4Q53 A;  1OHS A;  2BMQ B;  5CK6 A;  3RGA A;  1OGX A;  5STD A;  4XM4 A;  4I4K A;  1S5A A;  5KP3 A;  1GY6 A;  2I9W A;  2F99 A;  3K0Z A;  4X2H A;  1O7G B;  3EQQ B;  4XBT A;  8CHO A;  1ISK A;  2RCD A;  5KP1 A;  4OVM A;  3RGR A;  4HM7 B;  2XR8 B;  3F7X A;  3JUO A;  1JKG B;  5JPP A;  3MG3 A;  1NU3 A;  3DM8 A;  3FLJ A;  3BB9 A;  5CLK A;  1UUW B;  3FGY A;  3KKG A;  1Z1S A;  3GZB A;  5AIF A;  3OXA A;  4HM1 B;  1GYB A;  3JUQ A;  1DMQ A;  3MHE A;  1W01 A;  3NBR A;  3JUP A;  4HZB B;  3CNX A;  4MJD A;  3S5C A;  3F14 A;  4LMI A;  3NV0 A;  2A15 A;  3GZY B;  2HMM B;  5IG4 A;  7STD A;  3MG1 A;  5CXO A;  3HZP A;  4R9K A;  1W00 A;  2YFJ B;  4R1K A;  3B4O A;  5D81 A;  1JKG A;  1STD A;  2STD A;  5IER A;  1W02 A;  5DRE A;  3OV4 A;  4XDW A;  2QGU A;  3LZA A;  5AEU B;  3NXJ A;  5CF1 A;  4OUQ A;  4HKV B;  1JB5 A;  3DZL A;  5IG0 A;  4K1V A;  3VSY A;  3T8N A;  5G2G A;  4N3V A;  3MKI A;  3F7S A;  5D83 A;  5AI1 A;  3SED A;  2Z7A A;  5AIH A;  1A2K A;  1SJW A;  4HJL B;  1DMM A;  4IIA A;  3FKA A;  3EJV A;  3JUN A;  3MSO A;  4R9L A;  5AII A;  1QJG A;  3FSD A;  3EHC A;  1NWW A;  1Q42 A;  3B7C A;  3D9R A;  4HM2 B;  2GBW B;  3NV0 B;  1OHO A;  3B8L A;  4HM8 B;  1O7H B;  3ROB A;  3T8U A;  4KVH A;  5JPU A;  1O7M B;  4STD A;  4U13 A;  2RGQ A;  4FCJ A;  3DMC A;  5IF6 A;  2HMK B;  3G8Z A;  2BMO B;  3H3H A;  1JB2 A;  2IMJ A;  1HKX A;  3DUK A;  4HM4 B;  4XDV A;  2R4I A;  1JN5 B;  5BVB A;  3EBT A;  1IDP A;  2F86 B;  2GEX A;  3H51 A;  2XRX B;  3FF0 A;  1OF5 B;  3EC9 A;  1E3V A;  5D82 A;  1ULJ B;  3K7C A;  3F8X A;  1W6Y A;  3KE7 A;  2W2C A;  3GZX B;  3KZT A;  3G0K A;  1ULI B;  3A76 A;  1E97 A;  2OWP A;  4LGQ A;  1WQL B;  4J8T A;  4L7K A;  2K54 A;  2HMO B;  3DXO A;  5IG5 A;  4HM3 B;  1AR0 A;  4HZ9 B;  4RZM A;  2CHC A;  1ASK A;  2XSH B; 
#chains in the Genus database with same CATH topology
 1TIJ A;  2P38 A;  1L5G B;  1RN7 A;  3N54 B;  5BIR A;  3X3Y A;  2B1X B;  2CFL A;  1HZ1 A;  2BIR A;  1BNG A;  1FYS A;  1LOX A;  1W2B 2;  1AVK A;  1HYF A;  1Q86 4;  1UDI I;  1D6Z A;  2PZV A;  4X2O A;  2CWV A;  3SOY A;  5AEW B;  4K61 A;  4PEJ A;  1JN5 A;  4WYK B;  2OOV A;  1B2S A;  3MG2 A;  1YNV X;  8RNT A;  1KSI A;  3UJM A;  6STD A;  4KFE A;  4RNY A;  1JRQ A;  2CWT A;  1BNF A;  3E99 A;  1BOX A;  3NM7 A;  3AMO A;  3MYT A;  1TRP A;  2P05 A;  1UGH I;  3O8Y A;  3X3X A;  4L8P A;  5M19 A;  1OF5 A;  1UCL A;  1RTU A;  3U1W A;  3TDG A;  5A0O B;  1BAO A;  4HM5 B;  4KFD A;  1GOV A;  3X41 A;  4HVN A;  2FNQ A;  2V1L A;  3GZR A;  3WDG B;  3F9S A;  4CDL A;  3G6E 3;  1OGZ A;  5IG3 A;  4LSO A;  3WHO A;  1B2Z A;  3GAX A;  1CQS A;  2BMR B;  3CNM A;  1Y4K A;  3CMA 3;  2XGN A;  5DRV A;  5ELJ A;  1B3S A;  1WMO A;  3DGO A;  3WMD A;  4WWU C;  1LNI A;  3S29 A;  4N6T A;  5AYS C;  1IVV A;  1GY7 A;  4KFF A;  1TP6 A;  3D3L A;  2IUJ A;  3CCS 3;  1A67 A;  1I0X A;  1SAR A;  2E2V A;  5TGN A;  1JZO A;  1QMA A;  1C7H A;  2JQ5 A;  3FH1 A;  3CCE 3;  1YIT 3;  1FUT A;  1A2V A;  1SQW A;  2F4Y A;  3BNB A;  3DGN A;  5EVH A;  1RNB A;  4FMB A;  2PNC A;  1O7N B;  3AHS A;  3CCU 3;  1BSA A;  4ZM8 A;  1TRQ A;  1KQS 2;  1V57 A;  1DET A;  2UX0 A;  1RGC A;  1B2M A;  1W6C A;  4O2H A;  4ORL A;  1UCK A;  3DH2 A;  2Y74 A;  3CU3 A;  4FMD A;  2KF6 A;  3WA3 A;  3NHX A;  1GY5 A;  1U5O A;  3QRD A;  1GS3 A;  3FG1 A;  4RNT A;  1TUH A;  3UNL A;  4CCV A;  5EEO A;  4XB5 A;  1JV2 B;  3UL5 A;  1Q40 B;  1BU4 A;  1BNR A;  1I2E A;  2YFL B;  5HGR A;  1X1U A;  3D79 A;  4GB5 A;  4WYK A;  1FGR A;  1K73 4;  4K1U A;  4O02 B;  1WTH A;  3EX9 A;  3I55 3;  5LC6 A;  5JBS A;  2HMN B;  1RRH A;  2Z77 A;  4R4K A;  1BRI A;  1UUV B;  1B2X A;  2W9P A;  3OWS A;  3ZFZ A;  3CPO A;  1NDO B;  3SOA A;  1OHP A;  2KF5 A;  1OUN A;  3LXU X;  3ZG0 A;  3T0U A;  3JUM A;  2YFI B;  3FG3 A;  3G16 A;  3URP A;  1D6U A;  2OQE C;  5AIG A;  3HIG A;  4IT7 A;  3KCH A;  3CD6 3;  3WOF B;  3LT9 A;  1KWI A;  1KD1 4;  3F8H A;  2UGI A;  1RGG A;  3OWU A;  1JB4 A;  3DGY A;  4J5G A;  1BAN A;  2IUK A;  1EG9 B;  1CYU A;  3CCV 3;  1BIR A;  5IEP A;  4O8S A;  1IYY A;  3BLZ A;  1O7W B;  3EN8 A;  2C4B A;  3PYJ A;  3GRD A;  4I5Q A;  1G02 A;  1FGT A;  1EA2 A;  1BRN L;  1E3R A;  1ROA A;  1K41 A;  1TFK A;  3NM2 A;  4FR9 A;  4MMY B;  1U8C B;  1QAF A;  3FCS B;  1DMN A;  3KSP A;  1KC8 4;  1BSC A;  3Q1C A;  5M18 A;  1YGW A;  2W56 B;  2GSP A;  1AQZ A;  1CEW I;  1OCV A;  2D1W A;  3AHW A;  3EF8 A;  2XH9 A;  1RKY A;  3DY5 A;  3CCQ 3;  3AGN A;  3ER7 A;  2KF4 A;  3FG4 A;  4WP5 A;  2OQE A;  1IVW A;  2IY2 A;  1OPY A;  1PU4 A;  1US1 A;  1RGH A;  2HMJ B;  2CH9 A;  1DE3 A;  3V99 A;  1AVL A;  1ZO2 A;  3Q90 A;  2P0M A;  4AEQ A;  4AKY A;  5BXQ A;  1UCJ A;  2B24 B;  1LVN A;  3LML A;  1N5P A;  1C54 A;  1BRK A;  1I0V A;  1Q40 A;  1UGI A;  3IMA B;  5IEN A;  3X42 A;  1G96 A;  1W2Z A;  2HML B;  3B4P A;  1RN1 A;  3FZW A;  4LEH A;  3STD A;  3CC7 3;  1X1W A;  2Z76 A;  2CKF B;  1O7P B;  2BNG A;  5M1A A;  3X3Z A;  1QAL A;  2CC3 A;  4AKZ A;  1VQO 3;  4RBN A;  3F40 A;  3LH4 A;  5IEO A;  3QK9 A;  3NUV A;  1NO3 A;  4FMC A;  3D5G A;  1W4N A;  3OX9 A;  4H3U A;  1LQM B;  5FW5 A;  2LYX A;  3ALA A;  1N9E A;  1IK3 A;  2XGL A;  1IV7 A;  2C10 A;  3CME 3;  3I0Y A;  1R4Y A;  1RLS A;  3PCR A;  1M9G A;  3VGN A;  4J9A A;  2GEY A;  2E2T A;  5KP4 A;  1VQL 3;  3LYG A;  4HM0 B;  1GOY A;  1FZU A;  7RNT A;  3X40 A;  1YVS A;  3S28 A;  2MC8 A;  1QVG 2;  1T3B A;  4IPB A;  4XBX A;  2SAR A;  1WNH A;  4GHO A;  2Z6B A;  5AYR B;  4BL2 A;  4CPK A;  2CFK A;  1RRL A;  3IJE B;  3LOY A;  4N6L A;  1RMS A;  1VQ4 3;  1WMP A;  5HOH A;  3HK4 A;  1Q7H A;  2H0G A;  3ECF A;  4BTX A;  1YJW 3;  2KXG A;  1AV4 A;  2XSO B;  2CFW A;  2CFD A;  5GSP A;  1OH0 A;  5LC7 A;  1QAK A;  3HOH A;  6GSP A;  2CIU A;  4XBY A;  1QVF 2;  2GBX B;  1YVB I;  4L8O A;  1W5Z A;  1FGQ A;  1LOW A;  3BNC A;  3IPT A;  3FF2 A;  1IQ8 A;  2RFR A;  1F8N A;  2W56 A;  3OWY A;  3NBB A;  1VQ6 3;  2D42 A;  3L0R A;  3PGB A;  2F98 A;  2QIY A;  1VQP 3;  3M8C A;  1TTO A;  1X1Y A;  3PS8 A;  1BRS A;  1BNJ A;  2INX A;  2K0M A;  2GXF A;  3DGL A;  1JBR A;  3EN1 B;  2XSH B;  3NX0 A;  3G4S 3;  5CF2 A;  3WOE B;  3HX8 A;  3EBY A;  1VZZ A;  4FCM A;  3GWR A;  3KII A;  1ZX2 A;  1RCL A;  4HAA A;  1GSP A;  4HM6 B;  2OTJ 3;  1BUQ A;  1LOY A;  1YGE A;  4Q53 A;  1OHS A;  1MWU A;  4TX4 A;  3SXX A;  2KF3 A;  1JBT A;  2BHM A;  1YIJ 3;  1YJ9 3;  3NQY A;  1S72 3;  2BMQ B;  1AY7 A;  2CG1 A;  5CK6 A;  3BIR A;  4ILF A;  3RGA A;  3RNT A;  5I97 A;  1GMQ A;  1T5Y A;  1OGX A;  5STD A;  2CFG A;  4RZM A;  1N9J A;  1FGO A;  1I3I A;  4XM4 A;  5G1L A;  1JZD A;  3BND A;  4I4K A;  4MMX B;  1S5A A;  5KP3 A;  1B20 A;  3N9H A;  4J5K A;  1GY6 A;  3KN4 A;  3BNE A;  3N8B A;  2I9W A;  4K90 B;  2F99 A;  3K0Z A;  5RNT A;  1M1K 4;  4X2H A;  4NRE A;  4WHA A;  1BSD A;  2R41 A;  2WO0 A;  1M1X B;  1UUG B;  1RGK A;  1O7G B;  1RN4 A;  3EQQ B;  4KT3 B;  3S27 A;  1Q82 4;  1M90 4;  1GMP A;  1Q9E A;  4XBT A;  1WMN A;  1ROV A;  8CHO A;  1SIH A;  5ELU A;  1ISK A;  2RCD A;  4O3V A;  4EV2 A;  4H61 A;  4R80 A;  1EUI C;  1LNH A;  2ZHX B;  5KP1 A;  4OVM A;  1VQQ A;  3RGR A;  4BIR A;  1RSN A;  4HM7 B;  2XEP A;  1IQX A;  7GSP A;  4GSP A;  4N6M A;  2XR8 B;  3F7X A;  1MNL A;  1VQK 3;  3PXM A;  2P0X A;  2F5M A;  3JUO A;  1VQ9 3;  1JKG B;  5JPP A;  1D6Y A;  2WGQ A;  3MG3 A;  3NQZ A;  3Q3F A;  3DM8 A;  4JF8 A;  1VQM 3;  1NNV A;  2P09 A;  3FLJ A;  1OAC A;  2W0Q A;  3BB9 A;  4GL6 A;  4MEI A;  3EB8 A;  3MPH A;  3WA2 X;  1JBS A;  1T2I A;  4WFO A;  5CLK A;  4BTY A;  1IU7 A;  1EKM A;  3V92 A;  2FGT A;  5BU4 A;  1UUW B;  3U97 A;  3FGY A;  4EC6 A;  4NHF A;  3KKG A;  1Z1S A;  1GD3 A;  1CH0 A;  1ZS7 A;  3GZB A;  5AIF A;  1PYL A;  1IQY A;  3OXA A;  4HM1 B;  1GYB A;  3JUQ A;  3KFQ C;  1DMQ A;  2ZA4 A;  3VF1 A;  3MHE A;  1W01 A;  2IYJ A;  4EV5 A;  1N8R 4;  1BRJ A;  1RGE A;  1LQG C;  1RNT A;  3NBR A;  3V98 A;  3NBJ A;  2QA4 3;  3JUP A;  4HZB B;  3CNX A;  4RNZ A;  4MJD A;  2W04 A;  1BNS A;  1V58 A;  1EQK A;  1I2G A;  2BO9 B;  1RDS A;  1MOL A;  3RDE A;  1W7C A;  3GSP A;  4NPB A;  3S5C A;  4EBG A;  3F14 A;  4LMI A;  1ZGX A;  2H0I A;  3CC4 3;  1IV9 A;  1TJD A;  2FXT A;  3NV0 A;  1MGW A;  3GZY B;  4MMZ B;  2CG0 A;  2HMM B;  5IG4 A;  7STD A;  3MG1 A;  1MWR A;  1I2F A;  4LYL B;  2RSX A;  5CXO A;  1Q7Y 4;  2WGO A;  3HZP A;  4R9K A;  1CYV A;  3CC2 3;  5G1K A;  4EYC A;  1W00 A;  3G71 3;  3PCS A;  2YFJ B;  1JNQ A;  3Q2P A;  4EW5 A;  4R1K A;  1FW7 A;  2QEX 3;  3B4O A;  5D81 A;  1JKG A;  1RJO A;  1STD A;  2AAE A;  2STD A;  1T2H A;  5IER A;  3CPW 2;  1RHL A;  1W02 A;  2MF7 A;  5DRE A;  3OV4 A;  4XDW A;  1BVI A;  2QGU A;  2ZL8 A;  3LZA A;  1I3F A;  1BNE A;  2RBI A;  2SBL A;  5AEU B;  3HI7 A;  1JJ2 2;  1PY3 A;  3NXJ A;  2BT3 A;  3UL6 A;  5CF1 A;  4OUQ A;  1FA3 A;  1RGF A;  4HKV B;  3EE1 A;  1JB5 A;  3DZL A;  4JRF A;  3LT8 A;  4K1V A;  5IG0 A;  2UUG C;  1UI7 A;  3K5T A;  1G0T A;  3VSY A;  2Y73 A;  3T8N A;  1K8A 4;  1RGL A;  1K28 A;  3WR2 A;  2O9U X;  4HYZ A;  5G2G A;  4N3V A;  1TU5 A;  1Q81 4;  4BTW A;  3MKI A;  1X1X A;  1GD4 A;  3F7S A;  3K9M C;  5D83 A;  2J8X B;  1LXE A;  1BRG A;  5AI1 A;  2W9Q A;  2Z7A A;  3SED A;  5AIH A;  2CX1 A;  5FGO A;  1A2K A;  1YHQ 3;  1A90 A;  3AGO A;  3SVA A;  1DYU A;  1SJW A;  4HJL B;  3CCL 3;  4LZI A;  1DMM A;  2ZDJ A;  1HU9 A;  3SLU A;  1B2U A;  4IIA A;  3FKA A;  4N6O B;  1RGA A;  1V74 A;  3EJV A;  1I8V A;  3JUN A;  4EXR A;  9RNT A;  1BSE A;  3MSO A;  1MWT A;  4R9L A;  2KAA A;  5AII A;  3LTB A;  2XF3 A;  1QJG A;  3FSD A;  2F5W A;  3DGM A;  1BRH A;  3EHC A;  2CK3 H;  1NWW A;  3A5E A;  1IVX A;  1Q42 A;  2E2U A;  3B7C A;  1FUS A;  3LTD A;  4KZ1 A;  3HII A;  3CCJ 3;  4N6N B;  1NB3 I;  4QWT A;  3KSE D;  4OK0 A;  3D9R A;  4HM2 B;  2GBW B;  2H0H A;  1OHO A;  3B8L A;  3NV0 B;  1YI2 3;  2O3O A;  1IT8 A;  2CW9 A;  2ML5 A;  3I56 3;  4HM8 B;  1O7H B;  3ROB A;  1K9M 4;  2KCD A;  2F56 A;  1IT7 A;  2HOH A;  4N6U A;  2KRT A;  3SYU A;  3T8U A;  2BU4 A;  2JDI H;  4KVH A;  3S67 A;  1GOU A;  1UW1 A;  5JPU A;  1MGR A;  4HOH A;  1NB5 I;  1O7M B;  4HBR A;  2YX9 A;  4STD A;  4BL3 A;  4U13 A;  1VQ8 3;  4CJN A;  2GU1 A;  3K63 A;  4DKI A;  2RGQ A;  2WOF A;  4FCZ A;  2CX0 A;  4FCJ A;  3DMC A;  3LTC A;  5IF6 A;  2HMK B;  1B27 A;  3D4A A;  3G8Z A;  2BMO B;  1BSB A;  6RNT A;  2IA7 A;  3BU4 A;  1MWS A;  3H3H A;  1EEJ A;  3MWZ A;  4BU4 A;  3CCM 3;  2ML6 A;  1JB2 A;  2IMJ A;  1HKX A;  2Q07 A;  3DUK A;  4HM4 B;  4XDV A;  2OTL 3;  1A2P A;  3LTA A;  2R4I A;  1PFP A;  1JN5 B;  1RCK A;  1TFO A;  3EBT A;  5BVB A;  1IDP A;  3CXC 2;  2F86 B;  1R4C A;  5IW9 A;  1FGM A;  1UCI A;  3AMO B;  1W6G A;  2GEX A;  3H51 A;  1J2B A;  1DVD A;  2XRX B;  3FF0 A;  1VQN 3;  1OF5 B;  1BUJ A;  2W03 A;  3EC9 A;  1E3V A;  2M7O A;  3PZW A;  1GMR A;  1LOV A;  4G1M B;  5D82 A;  3OW2 2;  2OCT A;  3CCR 3;  3D5I A;  2L1S A;  2W6J H;  3JVC A;  1BGS A;  3SX1 A;  1SII A;  1ULJ B;  3K7C A;  1N5H A;  1VQ7 3;  2CWU A;  3F8X A;  1FUW A;  1W6Y A;  1LRA A;  1STF I;  3KE7 A;  2W2C A;  3GZX B;  3KZT A;  1IVU A;  2XFT A;  2LQV A;  1ULI B;  3A76 A;  3G0K A;  1NJI 4;  1E97 A;  2GU3 A;  2OWP A;  4LGQ A;  1WQL B;  1BNI A;  1DVC A;  2OOV C;  4J8T A;  1SPU A;  1UI8 A;  4L7K A;  3ZG5 A;  2C11 A;  1VQ5 3;  1I70 A;  2K54 A;  4N6V 0;  5EQL A;  3WOD G;  1B21 A;  2K3D A;  2WOH A;  2RNT A;  1N8Q A;  3J7Y d;  1YJN 3;  2HMO B;  3DXO A;  5IG5 A;  4FMA A;  3UB1 A;  4HM3 B;  1AR0 A;  2L4V A;  4HZ9 B;  2AAD A;  1NU3 A;  2XFS A;  2CHC A;  1ASK A;  2A15 A; 
#chains in the Genus database with same CATH homology
 1TIJ A;  2P38 A;  1L5G B;  1RN7 A;  3N54 B;  3X3Y A;  2B1X B;  2CFL A;  1LOX A;  1W2B 2;  1AVK A;  1Q86 4;  1D6Z A;  2PZV A;  4X2O A;  2CWV A;  3SOY A;  5AEW B;  4K61 A;  4PEJ A;  1JN5 A;  4WYK B;  2OOV A;  3MG2 A;  1KSI A;  3UJM A;  6STD A;  4KFE A;  4RNY A;  1JRQ A;  2CWT A;  3E99 A;  3NM7 A;  3AMO A;  3MYT A;  2P05 A;  3X3X A;  3O8Y A;  4L8P A;  1OF5 A;  3U1W A;  3TDG A;  5A0O B;  4KFD A;  4HM5 B;  3X41 A;  4HVN A;  2FNQ A;  2V1L A;  3GZR A;  3WDG B;  3F9S A;  4CDL A;  3G6E 3;  1OGZ A;  5IG3 A;  4LSO A;  3GAX A;  1CQS A;  2BMR B;  3CNM A;  1Y4K A;  3CMA 3;  2XGN A;  5DRV A;  5ELJ A;  1WMO A;  3DGO A;  3WMD A;  4WWU C;  3S29 A;  4N6T A;  5AYS C;  1IVV A;  1GY7 A;  4KFF A;  1TP6 A;  3D3L A;  2IUJ A;  3CCS 3;  1A67 A;  2E2V A;  5TGN A;  3CCE 3;  1QMA A;  1C7H A;  2JQ5 A;  3FH1 A;  1YIT 3;  1SQW A;  1A2V A;  3BNB A;  3DGN A;  5EVH A;  4FMB A;  2PNC A;  1O7N B;  3CCU 3;  4ZM8 A;  1KQS 2;  2UX0 A;  1W6C A;  4O2H A;  4ORL A;  2Y74 A;  3CU3 A;  4FMD A;  3WA3 A;  3NHX A;  1GY5 A;  1U5O A;  3QRD A;  1GS3 A;  3FG1 A;  3UNL A;  1TUH A;  4CCV A;  5EEO A;  4XB5 A;  1JV2 B;  3UL5 A;  1Q40 B;  2YFL B;  5HGR A;  4GB5 A;  4WYK A;  1FGR A;  1K73 4;  4K1U A;  4O02 B;  1WTH A;  3EX9 A;  3I55 3;  5LC6 A;  5JBS A;  2HMN B;  1RRH A;  2Z77 A;  4R4K A;  1UUV B;  2W9P A;  3OWS A;  3CPO A;  1NDO B;  3SOA A;  1OHP A;  1OUN A;  3LXU X;  3T0U A;  3JUM A;  2YFI B;  3FG3 A;  3G16 A;  1D6U A;  2OQE C;  5AIG A;  3HIG A;  4IT7 A;  3CD6 3;  3WOF B;  3LT9 A;  1KWI A;  1KD1 4;  3F8H A;  3OWU A;  1JB4 A;  2IUK A;  1EG9 B;  3CCV 3;  5IEP A;  4O8S A;  3BLZ A;  1O7W B;  3EN8 A;  3PYJ A;  3GRD A;  1FGT A;  1EA2 A;  1E3R A;  1ROA A;  1K41 A;  1TFK A;  3NM2 A;  4FR9 A;  4MMY B;  1U8C B;  1QAF A;  3FCS B;  1DMN A;  3KSP A;  1KC8 4;  3Q1C A;  2W56 B;  1CEW I;  1OCV A;  2D1W A;  1RKY A;  3EF8 A;  2XH9 A;  3CCQ 3;  3DY5 A;  3ER7 A;  3FG4 A;  4WP5 A;  2OQE A;  1IVW A;  1OPY A;  1PU4 A;  1US1 A;  2HMJ B;  2CH9 A;  3V99 A;  1AVL A;  1ZO2 A;  3Q90 A;  2P0M A;  4AEQ A;  4AKY A;  5BXQ A;  2B24 B;  1LVN A;  3LML A;  1N5P A;  5IEN A;  1Q40 A;  3IMA B;  3X42 A;  1G96 A;  1W2Z A;  2HML B;  3B4P A;  4LEH A;  3FZW A;  3STD A;  3CC7 3;  2Z76 A;  2CKF B;  1O7P B;  2BNG A;  3X3Z A;  4AKZ A;  1QAL A;  2CC3 A;  1VQO 3;  4RBN A;  3F40 A;  3LH4 A;  5IEO A;  3QK9 A;  3NUV A;  1NO3 A;  4FMC A;  1W4N A;  3OX9 A;  4H3U A;  5FW5 A;  2LYX A;  3ALA A;  1N9E A;  1IK3 A;  2XGL A;  1IV7 A;  2C10 A;  3CME 3;  3I0Y A;  3PCR A;  1M9G A;  3VGN A;  4J9A A;  2GEY A;  2E2T A;  5KP4 A;  1VQL 3;  3LYG A;  4HM0 B;  3X40 A;  3S28 A;  2MC8 A;  1QVG 2;  4IPB A;  4XBX A;  1WNH A;  2Z6B A;  5AYR B;  2CFK A;  1RRL A;  3IJE B;  3LOY A;  4N6L A;  1VQ4 3;  1WMP A;  3HK4 A;  3ECF A;  4BTX A;  1YJW 3;  2KXG A;  1AV4 A;  2XSO B;  2CFW A;  2CFD A;  1OH0 A;  5LC7 A;  1QAK A;  2CIU A;  4XBY A;  1QVF 2;  2GBX B;  1YVB I;  4L8O A;  1W5Z A;  1FGQ A;  3BNC A;  3IPT A;  3FF2 A;  1IQ8 A;  2RFR A;  1F8N A;  2W56 A;  3OWY A;  3NBB A;  1VQ6 3;  2D42 A;  3L0R A;  3PGB A;  2F98 A;  2QIY A;  1VQP 3;  3M8C A;  3PS8 A;  2INX A;  2K0M A;  2GXF A;  3DGL A;  3EN1 B;  3NX0 A;  3G4S 3;  5CF2 A;  3WOE B;  3HX8 A;  3EBY A;  1VZZ A;  4FCM A;  3GWR A;  3KII A;  1ZX2 A;  4HM6 B;  2OTJ 3;  1BUQ A;  1YGE A;  4Q53 A;  1OHS A;  4TX4 A;  3SXX A;  2BHM A;  1YIJ 3;  1YJ9 3;  3NQY A;  1S72 3;  2BMQ B;  2CG1 A;  5CK6 A;  3RGA A;  5I97 A;  1T5Y A;  1OGX A;  5STD A;  2CFG A;  4RZM A;  1N9J A;  1FGO A;  4XM4 A;  4I4K A;  3BND A;  4MMX B;  1S5A A;  5KP3 A;  3N9H A;  1GY6 A;  3KN4 A;  3BNE A;  3N8B A;  2I9W A;  4K90 B;  2F99 A;  3K0Z A;  1M1K 4;  4X2H A;  4NRE A;  4WHA A;  2WO0 A;  1M1X B;  3S27 A;  1Q82 4;  1O7G B;  3EQQ B;  1CYU A;  1M90 4;  4XBT A;  1WMN A;  1ROV A;  8CHO A;  1SIH A;  5ELU A;  1ISK A;  2RCD A;  4O3V A;  4EV2 A;  4H61 A;  4R80 A;  1LNH A;  5KP1 A;  4OVM A;  3RGR A;  4HM7 B;  2XEP A;  1IQX A;  4N6M A;  2XR8 B;  3F7X A;  1MNL A;  1VQK 3;  3PXM A;  2P0X A;  3JUO A;  1VQ9 3;  1JKG B;  5JPP A;  1D6Y A;  2WGQ A;  3MG3 A;  3NQZ A;  3DM8 A;  4JF8 A;  1VQM 3;  2P09 A;  3FLJ A;  1OAC A;  2W0Q A;  3BB9 A;  4GL6 A;  4MEI A;  3EB8 A;  3MPH A;  3WA2 X;  4WFO A;  5CLK A;  4BTY A;  1IU7 A;  1EKM A;  3V92 A;  2FGT A;  1UUW B;  3U97 A;  3FGY A;  4EC6 A;  4NHF A;  3KKG A;  1Z1S A;  1GD3 A;  3GZB A;  5AIF A;  1IQY A;  3OXA A;  4HM1 B;  1GYB A;  3JUQ A;  3KFQ C;  1DMQ A;  3VF1 A;  3MHE A;  1W01 A;  4EV5 A;  1N8R 4;  3V98 A;  3NBR A;  3NBJ A;  2QA4 3;  3JUP A;  4HZB B;  3CNX A;  4RNZ A;  4MJD A;  2W04 A;  1EQK A;  2BO9 B;  1MOL A;  3RDE A;  1W7C A;  3S5C A;  4EBG A;  3F14 A;  4LMI A;  3CC4 3;  1IV9 A;  2FXT A;  3NV0 A;  2A15 A;  3GZY B;  4MMZ B;  2CG0 A;  2HMM B;  5IG4 A;  7STD A;  3MG1 A;  2RSX A;  5CXO A;  1Q7Y 4;  2WGO A;  3HZP A;  4R9K A;  1CYV A;  3CC2 3;  4EYC A;  1W00 A;  3G71 3;  3PCS A;  2YFJ B;  1JNQ A;  3Q2P A;  4R1K A;  2QEX 3;  3B4O A;  5D81 A;  1JKG A;  1RJO A;  1STD A;  3CPW 2;  2STD A;  5IER A;  1W02 A;  2MF7 A;  5DRE A;  3OV4 A;  4XDW A;  2QGU A;  2ZL8 A;  3LZA A;  2SBL A;  5AEU B;  3HI7 A;  1JJ2 2;  3NXJ A;  2BT3 A;  3UL6 A;  5CF1 A;  4OUQ A;  1FA3 A;  4HKV B;  3EE1 A;  1JB5 A;  3DZL A;  4JRF A;  3LT8 A;  4K1V A;  5IG0 A;  3K5T A;  1UI7 A;  3VSY A;  1K8A 4;  2Y73 A;  3T8N A;  1K28 A;  2O9U X;  4HYZ A;  5G2G A;  4N3V A;  1TU5 A;  1Q81 4;  4BTW A;  3MKI A;  1GD4 A;  3F7S A;  3K9M C;  5D83 A;  1LXE A;  5AI1 A;  3SED A;  2W9Q A;  2Z7A A;  5AIH A;  1YHQ 3;  5FGO A;  1A2K A;  1A90 A;  3SVA A;  1DYU A;  1SJW A;  4HJL B;  3CCL 3;  4LZI A;  1DMM A;  2ZDJ A;  1HU9 A;  3SLU A;  4IIA A;  3FKA A;  4N6O B;  1V74 A;  3EJV A;  3JUN A;  4EXR A;  3MSO A;  4R9L A;  5AII A;  3LTB A;  2XF3 A;  1QJG A;  3FSD A;  3DGM A;  3EHC A;  2CK3 H;  1NWW A;  1IVX A;  1Q42 A;  2E2U A;  3B7C A;  3CCJ 3;  3LTD A;  4KZ1 A;  3HII A;  4N6N B;  1NB3 I;  4QWT A;  3KSE D;  4OK0 A;  3D9R A;  4HM2 B;  2GBW B;  3NV0 B;  1OHO A;  3B8L A;  1YI2 3;  2O3O A;  1IT8 A;  2CW9 A;  2ML5 A;  3I56 3;  4HM8 B;  1O7H B;  3ROB A;  1K9M 4;  2KCD A;  1IT7 A;  4N6U A;  3T8U A;  2KRT A;  2JDI H;  3S67 A;  4KVH A;  1UW1 A;  5JPU A;  1NB5 I;  1O7M B;  4HBR A;  2YX9 A;  4STD A;  4U13 A;  1VQ8 3;  2GU1 A;  3K63 A;  2RGQ A;  2WOF A;  4FCZ A;  4FCJ A;  3DMC A;  3LTC A;  5IF6 A;  2HMK B;  3G8Z A;  2BMO B;  2IA7 A;  3H3H A;  3MWZ A;  3CCM 3;  2ML6 A;  1JB2 A;  2IMJ A;  1HKX A;  2Q07 A;  3DUK A;  4HM4 B;  4XDV A;  2OTL 3;  3LTA A;  2R4I A;  1PFP A;  1JN5 B;  1TFO A;  3EBT A;  5BVB A;  1IDP A;  3CXC 2;  2F86 B;  1R4C A;  5IW9 A;  1FGM A;  3AMO B;  1W6G A;  2GEX A;  3H51 A;  1J2B A;  1DVD A;  2XRX B;  3FF0 A;  1VQN 3;  1OF5 B;  2W03 A;  3EC9 A;  1E3V A;  2M7O A;  3PZW A;  4G1M B;  5D82 A;  3OW2 2;  2OCT A;  3CCR 3;  3JVC A;  2W6J H;  3SX1 A;  1SII A;  1ULJ B;  3K7C A;  1N5H A;  1VQ7 3;  2CWU A;  3F8X A;  1FUW A;  1W6Y A;  1STF I;  3KE7 A;  2W2C A;  3GZX B;  3KZT A;  1IVU A;  2XFT A;  2LQV A;  1ULI B;  3A76 A;  3G0K A;  1NJI 4;  1E97 A;  2GU3 A;  2OWP A;  4LGQ A;  1WQL B;  1DVC A;  2OOV C;  4J8T A;  4L7K A;  1SPU A;  1UI8 A;  2C11 A;  1VQ5 3;  2K54 A;  4N6V 0;  5EQL A;  2WOH A;  1N8Q A;  3J7Y d;  1YJN 3;  2HMO B;  3DXO A;  5IG5 A;  4FMA A;  3UB1 A;  4HM3 B;  1AR0 A;  2L4V A;  4HZ9 B;  3WOD G;  1NU3 A;  2XFS A;  2CHC A;  1ASK A;  2XSH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...