4ORLA

Crystal structure of a duf4783 family protein (bacova_04304) from bacteroides ovatus atcc 8483 at 1.40 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
GQEIPAGVITAFKRGSSQELSKYMGDKVNLVFQGRSTNVDKQKATAAMQEFFTKNKVSGFNVNHQGKRDESSFVIGTLATTNGNFRVNCFLKKVQNQYLIHQIRIDKINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACOVA_04304) from Bacteroides ovatus ATCC 8483 at 1.40 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 33
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4orlA00
3G8ZA 3IPTA 1HKXA 3OXAA 3FGYA 3MSOA 3DM8A 8CHOA 3HZPA 4WYKA 5D83A 2HMNB 1TUHA 1DMMA 1ASKA 2INXA 3DZLA 1NU3A 2BMRB 1QJGA 2RGQA 1OCVA 3EJVA 3GZRA 4GB5A 3H3HA 4HZ9B 4RZMA 3GRDA 3STDA 3B4PA 5TGNA 2Z7AA 1OH0A 3RGAA 3CNXA 4CDLA 4XBXA 2GBWB 3UNLA 4X2HA 2HMMB 3B7CA 1C7HA 1OPYA 4HM5B 4HM8B 4K1UA 3SOAA 5CLKA 1GY5A 2R4IA 2B1XB 3FKAA 1GS3A 3NBRA 2A15A 3CNMA 1QMAA 2YFLB 4HM6B 3MKIA 1JB2A 1GYBA 1E97A 4HM7B 1Q40B 2BMQB 2RCDA 1S5AA 4FCMA 4ORLA 4WYKB 3FF2A 3KSPA 1CQSA 1O7NB 3G0KA 3OV4A 4LEHA 5G2GA 4X2OA 3RGRA 5AEUB 4HM0B 1NWWA 5KP3A 3LZAA 3KZTA 1OF5A 3OWUA 2GEXA 1JKGB 4I4KA 3WMDA 5IEPA 2QIYA 4N3VA 1TP6A 2XSOB 3KE7A 4HM3B 4R1KA 5D82A 2K54A 3F9SA 5DREA 5IF6A 1EA2A 3CPOA 1AR0A 3F7XA 3F40A 1SJWA 4HM4B 4XBTA 1VZZA 1W6YA 2BNGA 1O7HB 3MG1A 4R9KA 1EG9B 3B8LA 3ER7A 1DMQA 3NUVA 3UJMA 3Q90A 4J8TA 3JUMA 5AIGA 1OGZA 3NV0A 3MG3A 3BB9A 4OUQA 5IG5A 1NDOB 1OUNA 1JKGA 1Q42A 3A76A 1OHSA 3MHEA 4IIAA 2XR8B 4MJDA 4L8PA 5CXOA 4LGQA 1W00A 5CF2A 2PZVA 3NM2A 5IEOA 2F99A 3GZYB 1O7MB 3ROBA 3SEDA 1Q40A 4HJLB 1JB5A 1OHOA 2XRXB 3JUQA 2OWPA 5CK6A 2QGUA 1OHPA 1BUQA 2GXFA 2GBXB 3CU3A 3F7SA 3I0YA 3K7CA 3GZXB 4HVNA 4R9LA 7STDA 2HMOB 2B24B 5IG3A 3NHXA 1ZX2A 4LMIA 4OVMA 4K1VA 1Z1SA 3OWSA 5AIHA 3EF8A 4Q53A 4KVHA 3F8XA 5IG4A 3EX9A 3OWYA 3FF0A 3DUKA 2W2CA 3T8NA 5BXQA 4J9AA 3VGNA 1ISKA 3HX8A 2XSHB 1E3RA 2JQ5A 5BVBA 6STDA 4XM4A 5KP4A 1O7PB 3MYTA 5IERA 3DMCA 3FZWA 4STDA 1JB4A 4HKVB 1W02A 3FLJA 3JUOA 5IENA 1ULJB 5DRVA 3NXJA 3JUPA 3K0ZA 1WQLB 1W01A 2UX0A 3HK4A 1GY6A 1DMNA 5AI1A 4L7KA 1OGXA 3LYGA 3S5CA 1JN5A 1O7WB 3EN1B 2HMKB 5AIIA 1E3VA 4XDVA 1K41A 1ULIB 2BMOB 3FSDA 3OX9A 4XB5A 2GEYA 1ZO2A 3JUNA 3EQQB 1O7GB 4HZBB 3H51A 1GY7A 3KKGA 3F8HA 1IDPA 5D81A 4L8OA 4U13A 4XBYA 2Z77A 4HM1B 1U5OA 2F98A 4XDWA 3E99A 3EBTA 2IMJA 4WWUC 3EN8A 5HGRA 5IG0A 5AEWB 4H3UA 3NV0B 3D9RA 4PEJA 4WP5A 2CHCA 2YFIB 2RFRA 2YFJB 2Z76A 3ECFA 2HMLB 3M8CA 2STDA 3VSYA 3EC9A 3T8UA 5AIFA 3EBYA 2CKFB 1UUVB 3BLZA 4FCJA 3SOYA 5FW5A 1JN5B 4HM2B 2I9WA 1UUWB 5KP1A 1A2KA 5STDA 2F86B 3MG2A 3FH1A 5CF1A 3B4OA 5JPUA 5EVHA 5JPPA 3F14A 3GZBA 3DXOA 3GWRA 2HMJB 1OF5B 1STDA 3EHCA 3G16A
chains in the Genus database with same CATH superfamily
1NJI4 3IPTA 3OXAA 3MSOA 3U1WA 1BANA 1KWIA 3SVAA 4EV2A 1CYUA 2L1SA 2KAAA 3EB8A 2C11A 1TUHA 1UI8A 2HMNB 2INXA 1NU3A 1RN1A 2CWTA 4FMBA 5M18A 4MMXB 1J2BA 5TGNA 4BIRA 2Z7AA 1OH0A 3RGAA 4XBXA 1IT7A 1F8NA 2GBWB 4HOHA 2LYXA 3B7CA 3KSED 4HM5B 1YHQ3 4CCVA 1QVG2 1RKYA 3FKAA 7RNTA 1QMAA 1A2PA 1GYBA 1E97A 1BRIA 1BNRA 1UCJA 3IJEB 1RCLA 1LQMB 2W03A 3FF2A 3KSPA 4FCMA 2CX0A 3G0KA 3CCV3 3D5IA 1BRSA 1X1XA 1FA3A 1KC84 3HOHA 2E2VA 3NBJA 1M1XB 1OF5A 1SARA 2GEXA 3NM7A 1L5GB 1RGEA 2FXTA 4N3VA 3KE7A 1RGCA 3CCU3 3F9SA 3FG1A 1K734 1Q9EA 1EA2A 3CPOA 2UGIA 1IK3A 2CFGA 2XFSA 1FGRA 1YGWA 3L0RA 1VQP3 1LOYA 6RNTA 1GOVA 2RNTA 3ER7A 1DMQA 1UUGB 3Q1CA 3Q90A 2OOVA 1BNJA 2OTL3 1OGZA 3NV0A 3MG3A 3BB9A 1DETA 2H0IA 1M1K4 1Q42A 5I97A 3X3YA 4IIAA 2XR8B 3DY5A 4MJDA 2IUJA 4AKZA 5CXOA 1TFKA 1RGHA 1FUTA 3FCSB 1LRAA 3CXC2 4MEIA 1JB5A 5CK6A 2QGUA 2XEPA 1BSBA 1RGAA 5LC7A 3GZXB 1BNFA 4EC6A 2B24B 1US1A 3NHXA 4LMIA 4OVMA 3V98A 3QRDA 2O9UX 3EF8A 1Q814 3F8XA 3PCSA 1JZDA 1AVKA 3FF0A 3DUKA 2W2CA 1BU4A 1I70A 1TIJA 3S27A 1MWTA 3T8NA 3JVCA 4BL2A 1PU4A 1VQ43 4ILFA 1E3RA 1VQ53 2SARA 1JBRA 4XM4A 4K90B 2AADA 3MYTA 1BNEA 1R4YA 3FZWA 3N54B 3G6E3 1UGHI 3LT8A 3AMOA 3FLJA 4RNTA 3X41A 3DGMA 3MWZA 2CH9A 3KIIA 1IVUA 2AAEA 3S5CA 1GY6A 1OGXA 2P05A 3KN4A 1BRHA 1UCIA 4XDVA 2KXGA 5ELJA 1GSPA 3WDGB 3S29A 1YJN3 1IQYA 3EQQB 2D1WA 1FW7A 1WMNA 4GL6A 1GY7A 3K63A 4AEQA 1B20A 5JBSA 1IDPA 3AGOA 4L8OA 3X40A 1BOXA 1PY3A 1RGGA 3CCL3 2P0MA 2Z77A 1U5OA 4WWUC 2IMJA 1YVBI 1AQZA 1JJ22 4LYLB 5HGRA 3LT9A 4KZ1A 4H3UA 3NV0B 4AKYA 2GU3A 1M904 4BU4A 4MMYB 3LXUX 2HMLB 2STDA 1B3SA 7GSPA 1N8QA 1VQ63 3LTBA 4FCZA 3AHWA 3EBYA 3BU4A 5FW5A 5KP1A 1A2KA 1I0VA 1LOVA 1W7CA 1VQO3 1FGMA 2HMJB 1STDA 1BRGA 3EHCA 4BTWA 4K61A 1G0TA 1HKXA 2BIRA 1GMPA 2GSPA 1UDII 2KCDA 2XF3A 3HZPA 3LTCA 4MMZB 4N6V0 4KFEA 1S723 1ASKA 1LOXA 2BMRB 1BRKA 1QJGA 2RGQA 1RN7A 1RSNA 4HZ9B 1FGOA 3N8BA 2K0MA 2D42A 4N6UA 1LNIA 2P38A 3GAXA 1B21A 2OQEA 3BNDA 2ZHXB 4RBNA 3SYUA 1JBTA 4HM8B 3X3XA 2ML6A 5CLKA 3D3LA 1GY5A 2HOHA 4EW5A 1FGQA 7STDA 1JB2A 2CFWA 1V58A 1FYSA 1CQSA 2KF5A 3OV4A 4FMAA 5G2GA 3PZWA 3RGRA 5KP3A 3WR2A 1VQK3 1JV2B 3DGLA 3OWUA 1SQWA 3SXXA 1JKGB 3WMDA 2QIYA 4O8SA 1TP6A 2MF7A 2XSOB 1UW1A 4R1KA 5IW9A 2IUKA 4NPBA 5IF6A 2W9PA 3F7XA 4JRFA 1JNQA 1RJOA 2BT3A 4ORLA 5G1KA 4CPKA 4HM4B 1VZZA 3PXMA 4DKIA 1O7HB 1N5HA 3WHOA 3Q3FA 3CCE3 1EG9B 4WFOA 5G1LA 1KD14 4BL3A 3NUVA 1VQ93 1JZOA 2Z6BA 5IG5A 1NDOB 2H0GA 1OUNA 3A76A 1OHSA 5EEOA 4FR9A 2XH9A 1TU5A 3LTDA 4RNZA 2IA7A 3G4S3 3V99A 3ROBA 3GZYB 1O7MB 3NQYA 1HU9A 1OHPA 1G02A 1N9JA 2GXFA 2CFKA 3K7CA 5IG3A 1ZX2A 3MPHA 1T2IA 4EXRA 1Z1SA 1ZGXA 2CIUA 4I5QA 4O02B 4Q53A 1UI7A 3X3ZA 5BXQA 3Q2PA 3FG4A 4J9AA 3VGNA 3HX8A 3CCJ3 1W2ZA 1EKMA 2OOVC 1GOUA 1O7PB 1RGFA 1RGKA 1STFI 4EYCA 1MWRA 3JUOA 3HIGA 2W56A 4BTXA 3GSPA 5DRVA 5AYSC 3JUPA 1BAOA 1VQM3 3HK4A 1V57A 4J5KA 3LYGA 3CCQ3 1BRNL 1JN5A 2OCTA 3EN1B 1BIRA 1E3VA 1QAFA 1NB3I 1D6ZA 5M19A 2GEYA 1ZO2A 1YNVX 3CD63 2XGLA 2Y74A 1X1UA 4HM1B 2ZL8A 3S67A 1Q864 2CC3A 1VQL3 1WNHA 1NB5I 2F56A 2RSXA 1UCLA 3WOFB 4IT7A 4PEJA 4WP5A 1IYYA 1BSCA 2Z76A 2V1LA 1I2FA 2WGOA 3I563 1BUJA 1W5ZA 4TX4A 3V92A 2CKFB 1UUVB 1A2VA 3BLZA 4FCJA 2IYJA 2OTJ3 4HM2B 2I9WA 5BU4A 1ROVA 1CH0A 2CFLA 1RHLA 2F86B 5STDA 3FH1A 9RNTA 5HOHA 3LTAA 3B4OA 5JPUA 5EVHA 4GHOA 1SPUA 3BNBA 3GWRA 5GSPA 1RMSA 1OF5B 4N6NB 1IVWA 1GD4A 3FGYA 3DM8A 8CHOA 5ELUA 1VQ83 3T0UA 1NO3A 4WYKA 1SIIA 1GMQA 1GD3A 3BIRA 2KF4A 3PYJA 4CDLA 3TDGA 1OCVA 4QWTA 2JDIH 3H3HA 3STDA 4RZMA 3GRDA 3B4PA 5RNTA 2E2TA 1YI23 3UNLA 4X2HA 2K3DA 2HMMB 1BNSA 5LC6A 4K1UA 2CG1A 3SOAA 3CCR3 1DE3A 1SIHA 3DGYA 3DGOA 2R4IA 2B1XB 4HM6B 1GS3A 2A15A 1TRQA 2BO9B 2YFLB 3CNMA 4FMDA 2ML5A 4HM7B 4N6LA 4WHAA 1Q40B 2BMQB 3BNEA 1S5AA 1B2UA 2C10A 2SBLA 1O7NB 2O3OA 5AEUB 1FUWA 1BRJA 1TJDA 4X2OA 4HM0B 1NWWA 2M7OA 3LZAA 3KZTA 2CWVA 4R4KA 5D82A 1IQXA 2K54A 3DGNA 5DREA 3RNTA 3NQZA 3I553 4HAAA 1SJWA 4CJNA 1EUIC 4N6TA 2BNGA 3MG1A 1LQGC 4IPBA 4R9KA 3AHSA 3CC23 1YJ93 1BSAA 2H0HA 3S28A 1RTUA 4J8TA 3DH2A 1T2HA 3JUMA 1T5YA 1RCKA 2P0XA 1JKGA 2PNCA 4L8PA 2FNQA 3ALAA 4LGQA 5CF2A 5IEOA 1RN4A 4R80A 1Q40A 3CME3 3JUQA 2CWUA 2OWPA 1BUQA 1I3IA 2GBXB 3CU3A 3F7SA 1DYUA 2R41A 2XGNA 4HVNA 1Q824 1TRPA 2BHMA 3VF1A 2WOHA 4K1VA 1W6CA 1MWUA 5AIHA 3ZG0A 5IG4A 2WO0A 3EX9A 3OWYA 1PYLA 4FMCA 2RBIA 1Q7HA 1BNGA 2Y73A 1CYVA 1N9EA 2KF6A 3K9MC 2MC8A 3CCS3 2JQ5A 5BVBA 6STDA 5KP4A 3DMCA 2XFTA 1JB4A 1W02A 1RLSA 4KT3B 5IENA 4O3VA 1AV4A 1R4CA 1W01A 2UX0A 4L7KA 5AIIA 1RGLA 4O2HA 3LH4A 2CX1A 2C4BA 1K41A 2BMOB 1IVXA 3FSDA 1W4NA 2QEX3 3CMA3 1C54A 3JUNA 1UCKA 1ZS7A 1T3BA 2W9QA 1IV9A 1RRHA 3KFQC 3F8HA 3KKGA 4HZBB 1B2ZA 5D81A 2UUGC 3HIIA 4LSOA 3CC73 1QVF2 1KSIA 3PGBA 4XDWA 1BSEA 3G713 3E99A 3EBTA 1X1WA 1WMPA 3N9HA 5AEWB 2L4VA 3D9RA 1N5PA 2YFIB 2RFRA 3ECFA 1OACA 3D5GA 3LOYA 1MNLA 4HBRA 1GMRA 3VSYA 6GSPA 2W0QA 1IV7A 1D6YA 1MGWA 2BU4A 1CEWI 1YJW3 3SOYA 1RDSA 2CW9A 2QA43 1UUWB 1FZUA 4KFDA 1BGSA 1RNBA 3F14A 3GZBA 3DXOA 2CK3H 3CCM3 1DVDA 1FUSA 1BSDA 3G8ZA 4KFFA 3SX1A 3J7Yd 2KF3A 2GU1A 4EV5A 1YGEA 2W56B 1DMMA 1VQQA 3DZLA 4GB5A 3EJVA 3GZRA 3ZFZA 1LNHA 1BVIA 1UGIA 2OQEC 3URPA 3CNXA 1D6UA 1JRQA 3LMLA 3EE1A 2Q07A 1C7HA 1OPYA 1WTHA 1Y4KA 2WOFA 1B2XA 1A67A 1HZ1A 3NBRA 5D83A 3WA3A 1K8A4 3MKIA 3RDEA 5IERA 2RCDA 2FGTA 4GSPA 4WYKB 3FG3A 1A90A 4LEHA 3CPW2 2W6JH 4RNYA 1I3FA 1QALA 1KQS2 1MGRA 3PS8A 5IEPA 4I4KA 4BTYA 4HM3B 3OW22 1I8VA 1YIT3 8RNTA 3UL5A 1AR0A 1LOWA 3F40A 2F5MA 1G96A 1I2EA 1WMOA 4XBTA 1W6YA 1QAKA 2LQVA 1MWSA 3B8LA 4LZIA 1VQN3 3UJMA 3IMAB 5AIGA 5EQLA 4OUQA 4OK0A 3ZG5A 3CC43 1GOYA 1IU7A 3UL6A 2IY2A 3A5EA 3MHEA 4JF8A 1YVSA 3KCHA 3NBBA 1W00A 3X42A 1RRLA 2PZVA 3NM2A 3SLUA 3D4AA 1W2B2 2F99A 1JBSA 4G1MB 4HYZA 4HJLB 3SEDA 1OHOA 2XRXB 2ZDJA 3I0YA 1HYFA 4R9LA 1IQ8A 1B2SA 1B27A 2HMOB 4EBGA 3OWSA 2YX9A 4KVHA 1BNIA 1K9M4 1PFPA 1ROAA 3WODG 1I2GA 1ISKA 3UB1A 1RNTA 2XSHB 1N8R4 3U97A 1EQKA 5FGOA 1M9GA 4STDA 4HKVB 5M1AA 2WGQA 3NX0A 1ULJB 2CG0A 4N6MA 5AYRB 3NXJA 3K0ZA 1WQLB 3K5TA 5AI1A 1DMNA 1O7WB 2HMKB 4NHFA 1X1YA 1ULIB 5BIRA 3WOEB 2E2UA 3OX9A 1IVVA 4XB5A 1NNVA 1AVLA 1O7GB 3WA2X 3H51A 4N6OB 1IT8A 4ZM8A 4U13A 4XBYA 4NREA 2F98A 1VQ73 2J8XB 3O8YA 1AY7A 2CFDA 5IG0A 3QK9A 3PCRA 2CHCA 2KRTA 2YFJB 1TFOA 3BNCA 3M8CA 1DVCA 2F4YA 1I0XA 3EC9A 5AIFA 1FGTA 4H61A 3T8UA 5A0OB 1EEJA 1K28A 1LXEA 1LVNA 1V74A 2ZA4A 3AGNA 1JN5B 1TTOA 3D79A 4J5GA 2P09A 3HI7A 1W6GA 3MG2A 2F5WA 1YIJ3 1MOLA 5CF1A 1Q7Y4 1B2MA 5JPPA 2W04A 3AMOB 1U8CB 3EN8A 3G16A
chains in the Genus database with same CATH topology
1NJI4 3IPTA 3OXAA 3MSOA 3U1WA 1KWIA 3SVAA 4EV2A 1CYUA 3EB8A 2C11A 1TUHA 1UI8A 2HMNB 2INXA 1NU3A 2CWTA 4FMBA 4MMXB 1J2BA 5TGNA 2Z7AA 1OH0A 3RGAA 4XBXA 1IT7A 1F8NA 2GBWB 2LYXA 3B7CA 3KSED 4HM5B 1YHQ3 4CCVA 1QVG2 1RKYA 3FKAA 1QMAA 1GYBA 1E97A 3IJEB 4ORLA 4FCMA 2W03A 3CCV3 3FF2A 3KSPA 3G0KA 1FA3A 1KC84 2E2VA 3NBJA 1M1XB 1OF5A 3NM7A 2GEXA 1L5GB 2FXTA 4N3VA 3KE7A 3CCU3 3F9SA 3FG1A 1K734 1EA2A 3CPOA 1IK3A 2CFGA 2XFSA 1FGRA 3L0RA 1VQP3 3ER7A 1DMQA 3Q1CA 3Q90A 2OOVA 2OTL3 1OGZA 3NV0A 3MG3A 3BB9A 1M1K4 1Q42A 5I97A 3X3YA 4IIAA 2XR8B 3DY5A 4MJDA 2IUJA 4AKZA 5CXOA 1TFKA 3FCSB 3CXC2 4MEIA 1JB5A 5CK6A 2QGUA 2XEPA 5LC7A 3GZXB 4EC6A 2B24B 1US1A 3NHXA 4LMIA 4OVMA 3V98A 3QRDA 2O9UX 3EF8A 1Q814 3F8XA 3PCSA 3FF0A 1AVKA 3WA3A 3DUKA 2W2CA 1TIJA 3T8NA 3S27A 1YIJ3 1PU4A 3JVCA 1E3RA 1VQ53 4XM4A 4K90B 3MYTA 3FZWA 3N54B 3G6E3 3LT8A 3X41A 3AMOA 3FLJA 3DGMA 3MWZA 2CH9A 3KIIA 1IVUA 3S5CA 1GY6A 1OGXA 2P05A 3KN4A 4XDVA 2KXGA 5ELJA 3WDGB 3S29A 1YJN3 1IQYA 3EQQB 2D1WA 1WMNA 4GL6A 1GY7A 3K63A 4AEQA 5JBSA 1IDPA 4L8OA 3X40A 3CCL3 2P0MA 2Z77A 1U5OA 4WWUC 2IMJA 1YVBI 1JJ22 4AKYA 5HGRA 3LT9A 4KZ1A 4H3UA 3NV0B 2GU3A 1M904 4MMYB 3LXUX 2HMLB 2STDA 1N8QA 1VQ63 3LTBA 4FCZA 3EBYA 5FW5A 5KP1A 1A2KA 1W7CA 1VQO3 1FGMA 2HMJB 1STDA 3EHCA 4BTWA 4K61A 1HKXA 2XF3A 2KCDA 3LTCA 3HZPA 4MMZB 4N6V0 4KFEA 1S723 1ASKA 1LOXA 2BMRB 1QJGA 2RGQA 1RN7A 4HZ9B 1FGOA 3N8BA 2K0MA 2D42A 4N6UA 2P38A 3GAXA 2OQEA 3BNDA 4RBNA 4HM8B 3X3XA 2ML6A 5CLKA 3D3LA 1GY5A 1FGQA 7STDA 1JB2A 2CFWA 4FMAA 1CQSA 3OV4A 5G2GA 3PZWA 3RGRA 5KP3A 1VQK3 1JV2B 3DGLA 3OWUA 1SQWA 3SXXA 1JKGB 3WMDA 2QIYA 4O8SA 1TP6A 2MF7A 2XSOB 1UW1A 4R1KA 5IW9A 2IUKA 5IF6A 2W9PA 3F7XA 4JRFA 1JNQA 1RJOA 2BT3A 4HM4B 1VZZA 3PXMA 1KD14 1O7HB 1N5HA 3CCE3 1EG9B 4WFOA 3NUVA 1VQ93 2Z6BA 5IG5A 1NDOB 1OUNA 3A76A 1OHSA 5EEOA 4FR9A 2XH9A 1TU5A 3LTDA 4RNZA 2IA7A 3G4S3 3V99A 3ROBA 3GZYB 1O7MB 3NQYA 1HU9A 1OHPA 1N9JA 2GXFA 2CFKA 3K7CA 5IG3A 1ZX2A 3MPHA 4EXRA 1Z1SA 2CIUA 4O02B 4Q53A 1UI7A 3X3ZA 5BXQA 3Q2PA 3FG4A 4J9AA 3VGNA 3HX8A 3CCJ3 1W2ZA 1EKMA 2OOVC 1O7PB 1STFI 4EYCA 3JUOA 3HIGA 2W56A 4BTXA 5DRVA 5AYSC 3JUPA 1VQM3 3HK4A 3CCQ3 3LYGA 1JN5A 2OCTA 3EN1B 1E3VA 1QAFA 1NB3I 1D6ZA 2GEYA 1ZO2A 3CD63 2XGLA 2Y74A 4HM1B 2ZL8A 3S67A 1Q864 2CC3A 1VQL3 1WNHA 1NB5I 2RSXA 3WOFB 4IT7A 4PEJA 4WP5A 2Z76A 2V1LA 2WGOA 3I563 1W5ZA 4TX4A 3V92A 2CKFB 1UUVB 1A2VA 3BLZA 4FCJA 2OTJ3 4HM2B 2I9WA 1VQ43 1ROVA 5STDA 2CFLA 2F86B 3FH1A 3LTAA 3B4OA 5JPUA 5EVHA 1SPUA 3BNBA 3GWRA 1OF5B 4N6NB 1IVWA 1GD4A 3FGYA 3DM8A 8CHOA 5ELUA 1VQ83 3T0UA 1NO3A 4WYKA 1SIIA 1GD3A 4CDLA 3PYJA 3TDGA 1OCVA 4QWTA 2JDIH 3H3HA 3STDA 4RZMA 3GRDA 3B4PA 2E2TA 1YI23 3UNLA 4X2HA 2HMMB 5LC6A 4K1UA 2CG1A 3SOAA 3CCR3 1SIHA 3DGOA 2R4IA 2B1XB 4HM6B 1GS3A 2A15A 3CNMA 2BO9B 2YFLB 4FMDA 4HM7B 2ML5A 4N6LA 4WHAA 1Q40B 2BMQB 3BNEA 1S5AA 2C10A 2SBLA 1O7NB 2O3OA 5AEUB 1FUWA 4X2OA 4HM0B 1NWWA 2M7OA 3LZAA 3KZTA 2CWVA 4R4KA 5D82A 1IQXA 2K54A 3DGNA 5DREA 3NQZA 3I553 1SJWA 4N6TA 2BNGA 3MG1A 4R9KA 4IPBA 3CC23 1YJ93 3S28A 4J8TA 3JUMA 1T5YA 2P0XA 1JKGA 2PNCA 4L8PA 2FNQA 3ALAA 4LGQA 5CF2A 5IEOA 4R80A 1Q40A 3CME3 3JUQA 2CWUA 2OWPA 1BUQA 3CU3A 2GBXB 3F7SA 4HVNA 1DYUA 2XGNA 1Q824 2BHMA 3VF1A 2WOHA 4K1VA 1W6CA 5AIHA 5IG4A 2WO0A 3EX9A 3OWYA 4FMCA 2Y73A 1CYVA 1N9EA 3K9MC 2MC8A 3CCS3 2JQ5A 5BVBA 6STDA 5KP4A 3DMCA 2XFTA 1JB4A 1W02A 5IENA 4O3VA 1AV4A 1R4CA 1W01A 2UX0A 4L7KA 5AIIA 4O2HA 3LH4A 1K41A 3CMA3 2BMOB 1IVXA 3FSDA 1W4NA 2QEX3 3JUNA 2W9QA 3KFQC 1IV9A 1RRHA 3KKGA 3F8HA 4HZBB 5D81A 3HIIA 4LSOA 3CC73 1QVF2 1KSIA 3PGBA 4XDWA 3G713 3E99A 3EBTA 3N9HA 1WMPA 5AEWB 2L4VA 3D9RA 1N5PA 2YFIB 2RFRA 3ECFA 1OACA 3LOYA 1MNLA 4HBRA 3VSYA 2W0QA 1IV7A 1D6YA 1CEWI 1YJW3 3SOYA 2CW9A 2QA43 1UUWB 4KFDA 3F14A 3GZBA 3DXOA 2CK3H 3CCM3 1DVDA 4KFFA 3G8ZA 3SX1A 3J7Yd 2GU1A 4EV5A 1YGEA 2W56B 1DMMA 3DZLA 4GB5A 3EJVA 3GZRA 1LNHA 2OQEC 3CNXA 1D6UA 1JRQA 3LMLA 3EE1A 2Q07A 1C7HA 1OPYA 1WTHA 1Y4KA 2WOFA 1A67A 3NBRA 5D83A 1K8A4 3MKIA 3RDEA 5IERA 2RCDA 2FGTA 4WYKB 3FG3A 1A90A 4LEHA 3CPW2 2W6JH 4RNYA 1QALA 1KQS2 3PS8A 5IEPA 4I4KA 4BTYA 4HM3B 3OW22 1YIT3 3UL5A 1AR0A 3F40A 1G96A 1WMOA 4XBTA 1W6YA 1QAKA 2LQVA 4LZIA 3B8LA 1VQN3 3UJMA 3IMAB 5AIGA 5EQLA 4OUQA 4OK0A 3CC43 1IU7A 3UL6A 3MHEA 4JF8A 3NBBA 1W00A 3X42A 1RRLA 2PZVA 3NM2A 3SLUA 1W2B2 2F99A 4G1MB 4HYZA 4HJLB 3SEDA 1OHOA 2XRXB 2ZDJA 3I0YA 4R9LA 1IQ8A 2HMOB 4EBGA 3OWSA 2YX9A 4KVHA 1K9M4 1PFPA 1ROAA 3WODG 1ISKA 3UB1A 2XSHB 1N8R4 3U97A 1EQKA 5FGOA 1M9GA 4STDA 4HKVB 2WGQA 3NX0A 1ULJB 2CG0A 4N6MA 5AYRB 3NXJA 3K0ZA 1WQLB 3K5TA 5AI1A 1DMNA 1O7WB 2HMKB 4NHFA 1ULIB 3WOEB 2E2UA 3OX9A 1IVVA 4XB5A 1AVLA 1O7GB 3WA2X 3H51A 4N6OB 1IT8A 4ZM8A 4U13A 4XBYA 4NREA 2F98A 1VQ73 3O8YA 2CFDA 5IG0A 3QK9A 3PCRA 2CHCA 2KRTA 2YFJB 1TFOA 3BNCA 3M8CA 1DVCA 3EC9A 3T8UA 5AIFA 1FGTA 4H61A 5A0OB 1K28A 1LXEA 1LVNA 1V74A 1JN5B 2P09A 3HI7A 1W6GA 3MG2A 1Q7Y4 1MOLA 5CF1A 5JPPA 2W04A 3AMOB 1U8CB 3EN8A 3G16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G8Z A;  3IPT A;  1HKX A;  3OXA A;  3FGY A;  3MSO A;  3DM8 A;  8CHO A;  3HZP A;  4WYK A;  5D83 A;  2HMN B;  1TUH A;  1DMM A;  1ASK A;  2INX A;  3DZL A;  1NU3 A;  2BMR B;  1QJG A;  2RGQ A;  1OCV A;  3EJV A;  3GZR A;  4GB5 A;  3H3H A;  4HZ9 B;  4RZM A;  3GRD A;  3STD A;  3B4P A;  5TGN A;  2Z7A A;  1OH0 A;  3RGA A;  3CNX A;  4CDL A;  4XBX A;  2GBW B;  3UNL A;  4X2H A;  2HMM B;  3B7C A;  1C7H A;  1OPY A;  4HM5 B;  4HM8 B;  4K1U A;  3SOA A;  5CLK A;  1GY5 A;  2R4I A;  2B1X B;  3FKA A;  1GS3 A;  3NBR A;  2A15 A;  3CNM A;  1QMA A;  2YFL B;  4HM6 B;  3MKI A;  1JB2 A;  1GYB A;  1E97 A;  4HM7 B;  1Q40 B;  2BMQ B;  2RCD A;  1S5A A;  4FCM A;  4ORL A;  4WYK B;  3FF2 A;  3KSP A;  1CQS A;  1O7N B;  3G0K A;  3OV4 A;  4LEH A;  5G2G A;  4X2O A;  3RGR A;  5AEU B;  4HM0 B;  1NWW A;  5KP3 A;  3LZA A;  3KZT A;  1OF5 A;  3OWU A;  2GEX A;  1JKG B;  4I4K A;  3WMD A;  5IEP A;  2QIY A;  4N3V A;  1TP6 A;  2XSO B;  3KE7 A;  4HM3 B;  4R1K A;  5D82 A;  2K54 A;  3F9S A;  5DRE A;  5IF6 A;  1EA2 A;  3CPO A;  1AR0 A;  3F7X A;  3F40 A;  1SJW A;  4HM4 B;  4XBT A;  1VZZ A;  1W6Y A;  2BNG A;  1O7H B;  3MG1 A;  4R9K A;  1EG9 B;  3B8L A;  3ER7 A;  1DMQ A;  3NUV A;  3UJM A;  3Q90 A;  4J8T A;  3JUM A;  5AIG A;  1OGZ A;  3NV0 A;  3MG3 A;  3BB9 A;  4OUQ A;  5IG5 A;  1NDO B;  1OUN A;  1JKG A;  1Q42 A;  3A76 A;  1OHS A;  3MHE A;  4IIA A;  2XR8 B;  4MJD A;  4L8P A;  5CXO A;  4LGQ A;  1W00 A;  5CF2 A;  2PZV A;  3NM2 A;  5IEO A;  2F99 A;  3GZY B;  1O7M B;  3ROB A;  3SED A;  1Q40 A;  4HJL B;  1JB5 A;  1OHO A;  2XRX B;  3JUQ A;  2OWP A;  5CK6 A;  2QGU A;  1OHP A;  1BUQ A;  2GXF A;  2GBX B;  3CU3 A;  3F7S A;  3I0Y A;  3K7C A;  3GZX B;  4HVN A;  4R9L A;  7STD A;  2HMO B;  2B24 B;  5IG3 A;  3NHX A;  1ZX2 A;  4LMI A;  4OVM A;  4K1V A;  1Z1S A;  3OWS A;  5AIH A;  3EF8 A;  4Q53 A;  4KVH A;  3F8X A;  5IG4 A;  3EX9 A;  3OWY A;  3FF0 A;  3DUK A;  2W2C A;  3T8N A;  5BXQ A;  4J9A A;  3VGN A;  1ISK A;  3HX8 A;  2XSH B;  1E3R A;  2JQ5 A;  5BVB A;  6STD A;  4XM4 A;  5KP4 A;  1O7P B;  3MYT A;  5IER A;  3DMC A;  3FZW A;  4STD A;  1JB4 A;  4HKV B;  1W02 A;  3FLJ A;  3JUO A;  5IEN A;  1ULJ B;  5DRV A;  3NXJ A;  3JUP A;  3K0Z A;  1WQL B;  1W01 A;  2UX0 A;  3HK4 A;  1GY6 A;  1DMN A;  5AI1 A;  4L7K A;  1OGX A;  3LYG A;  3S5C A;  1JN5 A;  1O7W B;  3EN1 B;  2HMK B;  5AII A;  1E3V A;  4XDV A;  1K41 A;  1ULI B;  2BMO B;  3FSD A;  3OX9 A;  4XB5 A;  2GEY A;  1ZO2 A;  3JUN A;  3EQQ B;  1O7G B;  4HZB B;  3H51 A;  1GY7 A;  3KKG A;  3F8H A;  1IDP A;  5D81 A;  4L8O A;  4U13 A;  4XBY A;  2Z77 A;  4HM1 B;  1U5O A;  2F98 A;  4XDW A;  3E99 A;  3EBT A;  2IMJ A;  4WWU C;  3EN8 A;  5HGR A;  5IG0 A;  5AEW B;  4H3U A;  3NV0 B;  3D9R A;  4PEJ A;  4WP5 A;  2CHC A;  2YFI B;  2RFR A;  2YFJ B;  2Z76 A;  3ECF A;  2HML B;  3M8C A;  2STD A;  3VSY A;  3EC9 A;  3T8U A;  5AIF A;  3EBY A;  2CKF B;  1UUV B;  3BLZ A;  4FCJ A;  3SOY A;  5FW5 A;  1JN5 B;  4HM2 B;  2I9W A;  1UUW B;  5KP1 A;  1A2K A;  5STD A;  2F86 B;  3MG2 A;  3FH1 A;  5CF1 A;  3B4O A;  5JPU A;  5EVH A;  5JPP A;  3F14 A;  3GZB A;  3DXO A;  3GWR A;  2HMJ B;  1OF5 B;  1STD A;  3EHC A;  3G16 A; 
#chains in the Genus database with same CATH topology
 1NJI 4;  3IPT A;  3OXA A;  3MSO A;  3U1W A;  1BAN A;  1KWI A;  3SVA A;  4EV2 A;  1CYU A;  2L1S A;  2KAA A;  3EB8 A;  2C11 A;  1TUH A;  1UI8 A;  2HMN B;  2INX A;  1NU3 A;  1RN1 A;  2CWT A;  4FMB A;  5M18 A;  4MMX B;  1J2B A;  5TGN A;  4BIR A;  2Z7A A;  1OH0 A;  3RGA A;  4XBX A;  1IT7 A;  1F8N A;  2GBW B;  4HOH A;  2LYX A;  3B7C A;  3KSE D;  4HM5 B;  1YHQ 3;  4CCV A;  1QVG 2;  1RKY A;  3FKA A;  7RNT A;  1QMA A;  1A2P A;  1GYB A;  1E97 A;  1BRI A;  1BNR A;  1UCJ A;  3IJE B;  1RCL A;  1LQM B;  2W03 A;  3FF2 A;  3KSP A;  4FCM A;  2CX0 A;  3G0K A;  3CCV 3;  3D5I A;  1BRS A;  1X1X A;  1FA3 A;  1KC8 4;  3HOH A;  2E2V A;  3NBJ A;  1M1X B;  1OF5 A;  1SAR A;  2GEX A;  3NM7 A;  1L5G B;  1RGE A;  2FXT A;  4N3V A;  3KE7 A;  1RGC A;  3CCU 3;  3F9S A;  3FG1 A;  1K73 4;  1Q9E A;  1EA2 A;  3CPO A;  2UGI A;  1IK3 A;  2CFG A;  2XFS A;  1FGR A;  1YGW A;  3L0R A;  1VQP 3;  1LOY A;  6RNT A;  1GOV A;  2RNT A;  3ER7 A;  1DMQ A;  1UUG B;  3Q1C A;  3Q90 A;  2OOV A;  1BNJ A;  2OTL 3;  1OGZ A;  3NV0 A;  3MG3 A;  3BB9 A;  1DET A;  2H0I A;  1M1K 4;  1Q42 A;  5I97 A;  3X3Y A;  4IIA A;  2XR8 B;  3DY5 A;  4MJD A;  2IUJ A;  4AKZ A;  5CXO A;  1TFK A;  1RGH A;  1FUT A;  3FCS B;  1LRA A;  3CXC 2;  4MEI A;  1JB5 A;  5CK6 A;  2QGU A;  2XEP A;  1BSB A;  1RGA A;  5LC7 A;  3GZX B;  1BNF A;  4EC6 A;  2B24 B;  1US1 A;  3NHX A;  4LMI A;  4OVM A;  3V98 A;  3QRD A;  2O9U X;  3EF8 A;  1Q81 4;  3F8X A;  3PCS A;  1JZD A;  1AVK A;  3FF0 A;  3DUK A;  2W2C A;  1BU4 A;  1I70 A;  1TIJ A;  3S27 A;  1MWT A;  3T8N A;  3JVC A;  4BL2 A;  1PU4 A;  1VQ4 3;  4ILF A;  1E3R A;  1VQ5 3;  2SAR A;  1JBR A;  4XM4 A;  4K90 B;  2AAD A;  3MYT A;  1BNE A;  1R4Y A;  3FZW A;  3N54 B;  3G6E 3;  1UGH I;  3LT8 A;  3AMO A;  3FLJ A;  4RNT A;  3X41 A;  3DGM A;  3MWZ A;  2CH9 A;  3KII A;  1IVU A;  2AAE A;  3S5C A;  1GY6 A;  1OGX A;  2P05 A;  3KN4 A;  1BRH A;  1UCI A;  4XDV A;  2KXG A;  5ELJ A;  1GSP A;  3WDG B;  3S29 A;  1YJN 3;  1IQY A;  3EQQ B;  2D1W A;  1FW7 A;  1WMN A;  4GL6 A;  1GY7 A;  3K63 A;  4AEQ A;  1B20 A;  5JBS A;  1IDP A;  3AGO A;  4L8O A;  3X40 A;  1BOX A;  1PY3 A;  1RGG A;  3CCL 3;  2P0M A;  2Z77 A;  1U5O A;  4WWU C;  2IMJ A;  1YVB I;  1AQZ A;  1JJ2 2;  4LYL B;  5HGR A;  3LT9 A;  4KZ1 A;  4H3U A;  3NV0 B;  4AKY A;  2GU3 A;  1M90 4;  4BU4 A;  4MMY B;  3LXU X;  2HML B;  2STD A;  1B3S A;  7GSP A;  1N8Q A;  1VQ6 3;  3LTB A;  4FCZ A;  3AHW A;  3EBY A;  3BU4 A;  5FW5 A;  5KP1 A;  1A2K A;  1I0V A;  1LOV A;  1W7C A;  1VQO 3;  1FGM A;  2HMJ B;  1STD A;  1BRG A;  3EHC A;  4BTW A;  4K61 A;  1G0T A;  1HKX A;  2BIR A;  1GMP A;  2GSP A;  1UDI I;  2KCD A;  2XF3 A;  3HZP A;  3LTC A;  4MMZ B;  4N6V 0;  4KFE A;  1S72 3;  1ASK A;  1LOX A;  2BMR B;  1BRK A;  1QJG A;  2RGQ A;  1RN7 A;  1RSN A;  4HZ9 B;  1FGO A;  3N8B A;  2K0M A;  2D42 A;  4N6U A;  1LNI A;  2P38 A;  3GAX A;  1B21 A;  2OQE A;  3BND A;  2ZHX B;  4RBN A;  3SYU A;  1JBT A;  4HM8 B;  3X3X A;  2ML6 A;  5CLK A;  3D3L A;  1GY5 A;  2HOH A;  4EW5 A;  1FGQ A;  7STD A;  1JB2 A;  2CFW A;  1V58 A;  1FYS A;  1CQS A;  2KF5 A;  3OV4 A;  4FMA A;  5G2G A;  3PZW A;  3RGR A;  5KP3 A;  3WR2 A;  1VQK 3;  1JV2 B;  3DGL A;  3OWU A;  1SQW A;  3SXX A;  1JKG B;  3WMD A;  2QIY A;  4O8S A;  1TP6 A;  2MF7 A;  2XSO B;  1UW1 A;  4R1K A;  5IW9 A;  2IUK A;  4NPB A;  5IF6 A;  2W9P A;  3F7X A;  4JRF A;  1JNQ A;  1RJO A;  2BT3 A;  4ORL A;  5G1K A;  4CPK A;  4HM4 B;  1VZZ A;  3PXM A;  4DKI A;  1O7H B;  1N5H A;  3WHO A;  3Q3F A;  3CCE 3;  1EG9 B;  4WFO A;  5G1L A;  1KD1 4;  4BL3 A;  3NUV A;  1VQ9 3;  1JZO A;  2Z6B A;  5IG5 A;  1NDO B;  2H0G A;  1OUN A;  3A76 A;  1OHS A;  5EEO A;  4FR9 A;  2XH9 A;  1TU5 A;  3LTD A;  4RNZ A;  2IA7 A;  3G4S 3;  3V99 A;  3ROB A;  3GZY B;  1O7M B;  3NQY A;  1HU9 A;  1OHP A;  1G02 A;  1N9J A;  2GXF A;  2CFK A;  3K7C A;  5IG3 A;  1ZX2 A;  3MPH A;  1T2I A;  4EXR A;  1Z1S A;  1ZGX A;  2CIU A;  4I5Q A;  4O02 B;  4Q53 A;  1UI7 A;  3X3Z A;  5BXQ A;  3Q2P A;  3FG4 A;  4J9A A;  3VGN A;  3HX8 A;  3CCJ 3;  1W2Z A;  1EKM A;  2OOV C;  1GOU A;  1O7P B;  1RGF A;  1RGK A;  1STF I;  4EYC A;  1MWR A;  3JUO A;  3HIG A;  2W56 A;  4BTX A;  3GSP A;  5DRV A;  5AYS C;  3JUP A;  1BAO A;  1VQM 3;  3HK4 A;  1V57 A;  4J5K A;  3LYG A;  3CCQ 3;  1BRN L;  1JN5 A;  2OCT A;  3EN1 B;  1BIR A;  1E3V A;  1QAF A;  1NB3 I;  1D6Z A;  5M19 A;  2GEY A;  1ZO2 A;  1YNV X;  3CD6 3;  2XGL A;  2Y74 A;  1X1U A;  4HM1 B;  2ZL8 A;  3S67 A;  1Q86 4;  2CC3 A;  1VQL 3;  1WNH A;  1NB5 I;  2F56 A;  2RSX A;  1UCL A;  3WOF B;  4IT7 A;  4PEJ A;  4WP5 A;  1IYY A;  1BSC A;  2Z76 A;  2V1L A;  1I2F A;  2WGO A;  3I56 3;  1BUJ A;  1W5Z A;  4TX4 A;  3V92 A;  2CKF B;  1UUV B;  1A2V A;  3BLZ A;  4FCJ A;  2IYJ A;  2OTJ 3;  4HM2 B;  2I9W A;  5BU4 A;  1ROV A;  1CH0 A;  2CFL A;  1RHL A;  2F86 B;  5STD A;  3FH1 A;  9RNT A;  5HOH A;  3LTA A;  3B4O A;  5JPU A;  5EVH A;  4GHO A;  1SPU A;  3BNB A;  3GWR A;  5GSP A;  1RMS A;  1OF5 B;  4N6N B;  1IVW A;  1GD4 A;  3FGY A;  3DM8 A;  8CHO A;  5ELU A;  1VQ8 3;  3T0U A;  1NO3 A;  4WYK A;  1SII A;  1GMQ A;  1GD3 A;  3BIR A;  2KF4 A;  3PYJ A;  4CDL A;  3TDG A;  1OCV A;  4QWT A;  2JDI H;  3H3H A;  3STD A;  4RZM A;  3GRD A;  3B4P A;  5RNT A;  2E2T A;  1YI2 3;  3UNL A;  4X2H A;  2K3D A;  2HMM B;  1BNS A;  5LC6 A;  4K1U A;  2CG1 A;  3SOA A;  3CCR 3;  1DE3 A;  1SIH A;  3DGY A;  3DGO A;  2R4I A;  2B1X B;  4HM6 B;  1GS3 A;  2A15 A;  1TRQ A;  2BO9 B;  2YFL B;  3CNM A;  4FMD A;  2ML5 A;  4HM7 B;  4N6L A;  4WHA A;  1Q40 B;  2BMQ B;  3BNE A;  1S5A A;  1B2U A;  2C10 A;  2SBL A;  1O7N B;  2O3O A;  5AEU B;  1FUW A;  1BRJ A;  1TJD A;  4X2O A;  4HM0 B;  1NWW A;  2M7O A;  3LZA A;  3KZT A;  2CWV A;  4R4K A;  5D82 A;  1IQX A;  2K54 A;  3DGN A;  5DRE A;  3RNT A;  3NQZ A;  3I55 3;  4HAA A;  1SJW A;  4CJN A;  1EUI C;  4N6T A;  2BNG A;  3MG1 A;  1LQG C;  4IPB A;  4R9K A;  3AHS A;  3CC2 3;  1YJ9 3;  1BSA A;  2H0H A;  3S28 A;  1RTU A;  4J8T A;  3DH2 A;  1T2H A;  3JUM A;  1T5Y A;  1RCK A;  2P0X A;  1JKG A;  2PNC A;  4L8P A;  2FNQ A;  3ALA A;  4LGQ A;  5CF2 A;  5IEO A;  1RN4 A;  4R80 A;  1Q40 A;  3CME 3;  3JUQ A;  2CWU A;  2OWP A;  1BUQ A;  1I3I A;  2GBX B;  3CU3 A;  3F7S A;  1DYU A;  2R41 A;  2XGN A;  4HVN A;  1Q82 4;  1TRP A;  2BHM A;  3VF1 A;  2WOH A;  4K1V A;  1W6C A;  1MWU A;  5AIH A;  3ZG0 A;  5IG4 A;  2WO0 A;  3EX9 A;  3OWY A;  1PYL A;  4FMC A;  2RBI A;  1Q7H A;  1BNG A;  2Y73 A;  1CYV A;  1N9E A;  2KF6 A;  3K9M C;  2MC8 A;  3CCS 3;  2JQ5 A;  5BVB A;  6STD A;  5KP4 A;  3DMC A;  2XFT A;  1JB4 A;  1W02 A;  1RLS A;  4KT3 B;  5IEN A;  4O3V A;  1AV4 A;  1R4C A;  1W01 A;  2UX0 A;  4L7K A;  5AII A;  1RGL A;  4O2H A;  3LH4 A;  2CX1 A;  2C4B A;  1K41 A;  2BMO B;  1IVX A;  3FSD A;  1W4N A;  2QEX 3;  3CMA 3;  1C54 A;  3JUN A;  1UCK A;  1ZS7 A;  1T3B A;  2W9Q A;  1IV9 A;  1RRH A;  3KFQ C;  3F8H A;  3KKG A;  4HZB B;  1B2Z A;  5D81 A;  2UUG C;  3HII A;  4LSO A;  3CC7 3;  1QVF 2;  1KSI A;  3PGB A;  4XDW A;  1BSE A;  3G71 3;  3E99 A;  3EBT A;  1X1W A;  1WMP A;  3N9H A;  5AEW B;  2L4V A;  3D9R A;  1N5P A;  2YFI B;  2RFR A;  3ECF A;  1OAC A;  3D5G A;  3LOY A;  1MNL A;  4HBR A;  1GMR A;  3VSY A;  6GSP A;  2W0Q A;  1IV7 A;  1D6Y A;  1MGW A;  2BU4 A;  1CEW I;  1YJW 3;  3SOY A;  1RDS A;  2CW9 A;  2QA4 3;  1UUW B;  1FZU A;  4KFD A;  1BGS A;  1RNB A;  3F14 A;  3GZB A;  3DXO A;  2CK3 H;  3CCM 3;  1DVD A;  1FUS A;  1BSD A;  3G8Z A;  4KFF A;  3SX1 A;  3J7Y d;  2KF3 A;  2GU1 A;  4EV5 A;  1YGE A;  2W56 B;  1DMM A;  1VQQ A;  3DZL A;  4GB5 A;  3EJV A;  3GZR A;  3ZFZ A;  1LNH A;  1BVI A;  1UGI A;  2OQE C;  3URP A;  3CNX A;  1D6U A;  1JRQ A;  3LML A;  3EE1 A;  2Q07 A;  1C7H A;  1OPY A;  1WTH A;  1Y4K A;  2WOF A;  1B2X A;  1A67 A;  1HZ1 A;  3NBR A;  5D83 A;  3WA3 A;  1K8A 4;  3MKI A;  3RDE A;  5IER A;  2RCD A;  2FGT A;  4GSP A;  4WYK B;  3FG3 A;  1A90 A;  4LEH A;  3CPW 2;  2W6J H;  4RNY A;  1I3F A;  1QAL A;  1KQS 2;  1MGR A;  3PS8 A;  5IEP A;  4I4K A;  4BTY A;  4HM3 B;  3OW2 2;  1I8V A;  1YIT 3;  8RNT A;  3UL5 A;  1AR0 A;  1LOW A;  3F40 A;  2F5M A;  1G96 A;  1I2E A;  1WMO A;  4XBT A;  1W6Y A;  1QAK A;  2LQV A;  1MWS A;  3B8L A;  4LZI A;  1VQN 3;  3UJM A;  3IMA B;  5AIG A;  5EQL A;  4OUQ A;  4OK0 A;  3ZG5 A;  3CC4 3;  1GOY A;  1IU7 A;  3UL6 A;  2IY2 A;  3A5E A;  3MHE A;  4JF8 A;  1YVS A;  3KCH A;  3NBB A;  1W00 A;  3X42 A;  1RRL A;  2PZV A;  3NM2 A;  3SLU A;  3D4A A;  1W2B 2;  2F99 A;  1JBS A;  4G1M B;  4HYZ A;  4HJL B;  3SED A;  1OHO A;  2XRX B;  2ZDJ A;  3I0Y A;  1HYF A;  4R9L A;  1IQ8 A;  1B2S A;  1B27 A;  2HMO B;  4EBG A;  3OWS A;  2YX9 A;  4KVH A;  1BNI A;  1K9M 4;  1PFP A;  1ROA A;  3WOD G;  1I2G A;  1ISK A;  3UB1 A;  1RNT A;  2XSH B;  1N8R 4;  3U97 A;  1EQK A;  5FGO A;  1M9G A;  4STD A;  4HKV B;  5M1A A;  2WGQ A;  3NX0 A;  1ULJ B;  2CG0 A;  4N6M A;  5AYR B;  3NXJ A;  3K0Z A;  1WQL B;  3K5T A;  5AI1 A;  1DMN A;  1O7W B;  2HMK B;  4NHF A;  1X1Y A;  1ULI B;  5BIR A;  3WOE B;  2E2U A;  3OX9 A;  1IVV A;  4XB5 A;  1NNV A;  1AVL A;  1O7G B;  3WA2 X;  3H51 A;  4N6O B;  1IT8 A;  4ZM8 A;  4U13 A;  4XBY A;  4NRE A;  2F98 A;  1VQ7 3;  2J8X B;  3O8Y A;  1AY7 A;  2CFD A;  5IG0 A;  3QK9 A;  3PCR A;  2CHC A;  2KRT A;  2YFJ B;  1TFO A;  3BNC A;  3M8C A;  1DVC A;  2F4Y A;  1I0X A;  3EC9 A;  5AIF A;  1FGT A;  4H61 A;  3T8U A;  5A0O B;  1EEJ A;  1K28 A;  1LXE A;  1LVN A;  1V74 A;  2ZA4 A;  3AGN A;  1JN5 B;  1TTO A;  3D79 A;  4J5G A;  2P09 A;  3HI7 A;  1W6G A;  3MG2 A;  2F5W A;  1YIJ 3;  1MOL A;  5CF1 A;  1Q7Y 4;  1B2M A;  5JPP A;  2W04 A;  3AMO B;  1U8C B;  3EN8 A;  3G16 A; 
#chains in the Genus database with same CATH homology
 1NJI 4;  3IPT A;  3OXA A;  3MSO A;  3U1W A;  1KWI A;  3SVA A;  4EV2 A;  1CYU A;  3EB8 A;  2C11 A;  1TUH A;  1UI8 A;  2HMN B;  2INX A;  1NU3 A;  2CWT A;  4FMB A;  4MMX B;  1J2B A;  5TGN A;  2Z7A A;  1OH0 A;  3RGA A;  4XBX A;  1IT7 A;  1F8N A;  2GBW B;  2LYX A;  3B7C A;  3KSE D;  4HM5 B;  1YHQ 3;  4CCV A;  1QVG 2;  1RKY A;  3FKA A;  1QMA A;  1GYB A;  1E97 A;  3IJE B;  4ORL A;  4FCM A;  2W03 A;  3CCV 3;  3FF2 A;  3KSP A;  3G0K A;  1FA3 A;  1KC8 4;  2E2V A;  3NBJ A;  1M1X B;  1OF5 A;  3NM7 A;  2GEX A;  1L5G B;  2FXT A;  4N3V A;  3KE7 A;  3CCU 3;  3F9S A;  3FG1 A;  1K73 4;  1EA2 A;  3CPO A;  1IK3 A;  2CFG A;  2XFS A;  1FGR A;  3L0R A;  1VQP 3;  3ER7 A;  1DMQ A;  3Q1C A;  3Q90 A;  2OOV A;  2OTL 3;  1OGZ A;  3NV0 A;  3MG3 A;  3BB9 A;  1M1K 4;  1Q42 A;  5I97 A;  3X3Y A;  4IIA A;  2XR8 B;  3DY5 A;  4MJD A;  2IUJ A;  4AKZ A;  5CXO A;  1TFK A;  3FCS B;  3CXC 2;  4MEI A;  1JB5 A;  5CK6 A;  2QGU A;  2XEP A;  5LC7 A;  3GZX B;  4EC6 A;  2B24 B;  1US1 A;  3NHX A;  4LMI A;  4OVM A;  3V98 A;  3QRD A;  2O9U X;  3EF8 A;  1Q81 4;  3F8X A;  3PCS A;  3FF0 A;  1AVK A;  3WA3 A;  3DUK A;  2W2C A;  1TIJ A;  3T8N A;  3S27 A;  1YIJ 3;  1PU4 A;  3JVC A;  1E3R A;  1VQ5 3;  4XM4 A;  4K90 B;  3MYT A;  3FZW A;  3N54 B;  3G6E 3;  3LT8 A;  3X41 A;  3AMO A;  3FLJ A;  3DGM A;  3MWZ A;  2CH9 A;  3KII A;  1IVU A;  3S5C A;  1GY6 A;  1OGX A;  2P05 A;  3KN4 A;  4XDV A;  2KXG A;  5ELJ A;  3WDG B;  3S29 A;  1YJN 3;  1IQY A;  3EQQ B;  2D1W A;  1WMN A;  4GL6 A;  1GY7 A;  3K63 A;  4AEQ A;  5JBS A;  1IDP A;  4L8O A;  3X40 A;  3CCL 3;  2P0M A;  2Z77 A;  1U5O A;  4WWU C;  2IMJ A;  1YVB I;  1JJ2 2;  4AKY A;  5HGR A;  3LT9 A;  4KZ1 A;  4H3U A;  3NV0 B;  2GU3 A;  1M90 4;  4MMY B;  3LXU X;  2HML B;  2STD A;  1N8Q A;  1VQ6 3;  3LTB A;  4FCZ A;  3EBY A;  5FW5 A;  5KP1 A;  1A2K A;  1W7C A;  1VQO 3;  1FGM A;  2HMJ B;  1STD A;  3EHC A;  4BTW A;  4K61 A;  1HKX A;  2XF3 A;  2KCD A;  3LTC A;  3HZP A;  4MMZ B;  4N6V 0;  4KFE A;  1S72 3;  1ASK A;  1LOX A;  2BMR B;  1QJG A;  2RGQ A;  1RN7 A;  4HZ9 B;  1FGO A;  3N8B A;  2K0M A;  2D42 A;  4N6U A;  2P38 A;  3GAX A;  2OQE A;  3BND A;  4RBN A;  4HM8 B;  3X3X A;  2ML6 A;  5CLK A;  3D3L A;  1GY5 A;  1FGQ A;  7STD A;  1JB2 A;  2CFW A;  4FMA A;  1CQS A;  3OV4 A;  5G2G A;  3PZW A;  3RGR A;  5KP3 A;  1VQK 3;  1JV2 B;  3DGL A;  3OWU A;  1SQW A;  3SXX A;  1JKG B;  3WMD A;  2QIY A;  4O8S A;  1TP6 A;  2MF7 A;  2XSO B;  1UW1 A;  4R1K A;  5IW9 A;  2IUK A;  5IF6 A;  2W9P A;  3F7X A;  4JRF A;  1JNQ A;  1RJO A;  2BT3 A;  4HM4 B;  1VZZ A;  3PXM A;  1KD1 4;  1O7H B;  1N5H A;  3CCE 3;  1EG9 B;  4WFO A;  3NUV A;  1VQ9 3;  2Z6B A;  5IG5 A;  1NDO B;  1OUN A;  3A76 A;  1OHS A;  5EEO A;  4FR9 A;  2XH9 A;  1TU5 A;  3LTD A;  4RNZ A;  2IA7 A;  3G4S 3;  3V99 A;  3ROB A;  3GZY B;  1O7M B;  3NQY A;  1HU9 A;  1OHP A;  1N9J A;  2GXF A;  2CFK A;  3K7C A;  5IG3 A;  1ZX2 A;  3MPH A;  4EXR A;  1Z1S A;  2CIU A;  4O02 B;  4Q53 A;  1UI7 A;  3X3Z A;  5BXQ A;  3Q2P A;  3FG4 A;  4J9A A;  3VGN A;  3HX8 A;  3CCJ 3;  1W2Z A;  1EKM A;  2OOV C;  1O7P B;  1STF I;  4EYC A;  3JUO A;  3HIG A;  2W56 A;  4BTX A;  5DRV A;  5AYS C;  3JUP A;  1VQM 3;  3HK4 A;  3CCQ 3;  3LYG A;  1JN5 A;  2OCT A;  3EN1 B;  1E3V A;  1QAF A;  1NB3 I;  1D6Z A;  2GEY A;  1ZO2 A;  3CD6 3;  2XGL A;  2Y74 A;  4HM1 B;  2ZL8 A;  3S67 A;  1Q86 4;  2CC3 A;  1VQL 3;  1WNH A;  1NB5 I;  2RSX A;  3WOF B;  4IT7 A;  4PEJ A;  4WP5 A;  2Z76 A;  2V1L A;  2WGO A;  3I56 3;  1W5Z A;  4TX4 A;  3V92 A;  2CKF B;  1UUV B;  1A2V A;  3BLZ A;  4FCJ A;  2OTJ 3;  4HM2 B;  2I9W A;  1VQ4 3;  1ROV A;  5STD A;  2CFL A;  2F86 B;  3FH1 A;  3LTA A;  3B4O A;  5JPU A;  5EVH A;  1SPU A;  3BNB A;  3GWR A;  1OF5 B;  4N6N B;  1IVW A;  1GD4 A;  3FGY A;  3DM8 A;  8CHO A;  5ELU A;  1VQ8 3;  3T0U A;  1NO3 A;  4WYK A;  1SII A;  1GD3 A;  4CDL A;  3PYJ A;  3TDG A;  1OCV A;  4QWT A;  2JDI H;  3H3H A;  3STD A;  4RZM A;  3GRD A;  3B4P A;  2E2T A;  1YI2 3;  3UNL A;  4X2H A;  2HMM B;  5LC6 A;  4K1U A;  2CG1 A;  3SOA A;  3CCR 3;  1SIH A;  3DGO A;  2R4I A;  2B1X B;  4HM6 B;  1GS3 A;  2A15 A;  3CNM A;  2BO9 B;  2YFL B;  4FMD A;  4HM7 B;  2ML5 A;  4N6L A;  4WHA A;  1Q40 B;  2BMQ B;  3BNE A;  1S5A A;  2C10 A;  2SBL A;  1O7N B;  2O3O A;  5AEU B;  1FUW A;  4X2O A;  4HM0 B;  1NWW A;  2M7O A;  3LZA A;  3KZT A;  2CWV A;  4R4K A;  5D82 A;  1IQX A;  2K54 A;  3DGN A;  5DRE A;  3NQZ A;  3I55 3;  1SJW A;  4N6T A;  2BNG A;  3MG1 A;  4R9K A;  4IPB A;  3CC2 3;  1YJ9 3;  3S28 A;  4J8T A;  3JUM A;  1T5Y A;  2P0X A;  1JKG A;  2PNC A;  4L8P A;  2FNQ A;  3ALA A;  4LGQ A;  5CF2 A;  5IEO A;  4R80 A;  1Q40 A;  3CME 3;  3JUQ A;  2CWU A;  2OWP A;  1BUQ A;  3CU3 A;  2GBX B;  3F7S A;  4HVN A;  1DYU A;  2XGN A;  1Q82 4;  2BHM A;  3VF1 A;  2WOH A;  4K1V A;  1W6C A;  5AIH A;  5IG4 A;  2WO0 A;  3EX9 A;  3OWY A;  4FMC A;  2Y73 A;  1CYV A;  1N9E A;  3K9M C;  2MC8 A;  3CCS 3;  2JQ5 A;  5BVB A;  6STD A;  5KP4 A;  3DMC A;  2XFT A;  1JB4 A;  1W02 A;  5IEN A;  4O3V A;  1AV4 A;  1R4C A;  1W01 A;  2UX0 A;  4L7K A;  5AII A;  4O2H A;  3LH4 A;  1K41 A;  3CMA 3;  2BMO B;  1IVX A;  3FSD A;  1W4N A;  2QEX 3;  3JUN A;  2W9Q A;  3KFQ C;  1IV9 A;  1RRH A;  3KKG A;  3F8H A;  4HZB B;  5D81 A;  3HII A;  4LSO A;  3CC7 3;  1QVF 2;  1KSI A;  3PGB A;  4XDW A;  3G71 3;  3E99 A;  3EBT A;  3N9H A;  1WMP A;  5AEW B;  2L4V A;  3D9R A;  1N5P A;  2YFI B;  2RFR A;  3ECF A;  1OAC A;  3LOY A;  1MNL A;  4HBR A;  3VSY A;  2W0Q A;  1IV7 A;  1D6Y A;  1CEW I;  1YJW 3;  3SOY A;  2CW9 A;  2QA4 3;  1UUW B;  4KFD A;  3F14 A;  3GZB A;  3DXO A;  2CK3 H;  3CCM 3;  1DVD A;  4KFF A;  3G8Z A;  3SX1 A;  3J7Y d;  2GU1 A;  4EV5 A;  1YGE A;  2W56 B;  1DMM A;  3DZL A;  4GB5 A;  3EJV A;  3GZR A;  1LNH A;  2OQE C;  3CNX A;  1D6U A;  1JRQ A;  3LML A;  3EE1 A;  2Q07 A;  1C7H A;  1OPY A;  1WTH A;  1Y4K A;  2WOF A;  1A67 A;  3NBR A;  5D83 A;  1K8A 4;  3MKI A;  3RDE A;  5IER A;  2RCD A;  2FGT A;  4WYK B;  3FG3 A;  1A90 A;  4LEH A;  3CPW 2;  2W6J H;  4RNY A;  1QAL A;  1KQS 2;  3PS8 A;  5IEP A;  4I4K A;  4BTY A;  4HM3 B;  3OW2 2;  1YIT 3;  3UL5 A;  1AR0 A;  3F40 A;  1G96 A;  1WMO A;  4XBT A;  1W6Y A;  1QAK A;  2LQV A;  4LZI A;  3B8L A;  1VQN 3;  3UJM A;  3IMA B;  5AIG A;  5EQL A;  4OUQ A;  4OK0 A;  3CC4 3;  1IU7 A;  3UL6 A;  3MHE A;  4JF8 A;  3NBB A;  1W00 A;  3X42 A;  1RRL A;  2PZV A;  3NM2 A;  3SLU A;  1W2B 2;  2F99 A;  4G1M B;  4HYZ A;  4HJL B;  3SED A;  1OHO A;  2XRX B;  2ZDJ A;  3I0Y A;  4R9L A;  1IQ8 A;  2HMO B;  4EBG A;  3OWS A;  2YX9 A;  4KVH A;  1K9M 4;  1PFP A;  1ROA A;  3WOD G;  1ISK A;  3UB1 A;  2XSH B;  1N8R 4;  3U97 A;  1EQK A;  5FGO A;  1M9G A;  4STD A;  4HKV B;  2WGQ A;  3NX0 A;  1ULJ B;  2CG0 A;  4N6M A;  5AYR B;  3NXJ A;  3K0Z A;  1WQL B;  3K5T A;  5AI1 A;  1DMN A;  1O7W B;  2HMK B;  4NHF A;  1ULI B;  3WOE B;  2E2U A;  3OX9 A;  1IVV A;  4XB5 A;  1AVL A;  1O7G B;  3WA2 X;  3H51 A;  4N6O B;  1IT8 A;  4ZM8 A;  4U13 A;  4XBY A;  4NRE A;  2F98 A;  1VQ7 3;  3O8Y A;  2CFD A;  5IG0 A;  3QK9 A;  3PCR A;  2CHC A;  2KRT A;  2YFJ B;  1TFO A;  3BNC A;  3M8C A;  1DVC A;  3EC9 A;  3T8U A;  5AIF A;  1FGT A;  4H61 A;  5A0O B;  1K28 A;  1LXE A;  1LVN A;  1V74 A;  1JN5 B;  2P09 A;  3HI7 A;  1W6G A;  3MG2 A;  1Q7Y 4;  1MOL A;  5CF1 A;  5JPP A;  2W04 A;  3AMO B;  1U8C B;  3EN8 A;  3G16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...