4ORLA

Crystal structure of a duf4783 family protein (bacova_04304) from bacteroides ovatus atcc 8483 at 1.40 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
GQEIPAGVITAFKRGSSQELSKYMGDKVNLVFQGRSTNVDKQKATAAMQEFFTKNKVSGFNVNHQGKRDESSFVIGTLATTNGNFRVNCFLKKVQNQYLIHQIRIDKINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_04304) from Bacteroides ovatus ATCC 8483 at 1.40 A resolution
rcsb
source organism Bacteroides ovatus
total genus 33
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4orlA00
1GY7A 3FSDA 4OVMA 3DM8A 3I0YA 4HM1B 3KSPA 5BVBA 4RZMA 2HMKB 1O7GB 3MHEA 5IG3A 3JUMA 4HM7B 2BNGA 1UUVB 5D82A 1Q42A 4FCMA 2XRXB 4XBXA 4HM8B 2Z76A 3SEDA 4HM4B 3S5CA 1STDA 2HMOB 5IG4A 5DRVA 3GZBA 1NU3A 2IMJA 3B4PA 4LGQA 1NWWA 4XBYA 1VZZA 3MG2A 1OF5B 2UX0A 3BB9A 5STDA 1ZX2A 3BLZA 3GRDA 3NV0A 4LMIA 1ZO2A 3EN1B 2R4IA 3MG1A 3IPTA 1ISKA 1OGZA 3EBTA 2PZVA 4WYKA 1JN5B 1O7NB 1QJGA 5AIHA 3NHXA 3KKGA 3B4OA 1O7PB 2RFRA 1TUHA 2GXFA 1S5AA 3F7SA 1ASKA 1O7HB 6STDA 2YFJB 1AR0A 4GB5A 5CF1A 7STDA 3UJMA 3EBYA 3D9RA 2XR8B 1JKGA 4U13A 1NDOB 4R9LA 4WP5A 4OUQA 4CDLA 4L8OA 5CXOA 3B7CA 3OWUA 3OV4A 2HMNB 3FF0A 5KP3A 3OXAA 3FF2A 5AEWB 2QIYA 3CPOA 2CKFB 5AIFA 1W6YA 1GYBA 4KVHA 1O7WB 3NXJA 4HM3B 3DUKA 4XDVA 4FCJA 3WMDA 2F86B 3STDA 2INXA 1OHSA 2K54A 5HGRA 2YFIB 3H51A 5KP4A 1OPYA 1Q40B 4N3VA 3DMCA 5CK6A 4HVNA 3HK4A 3MYTA 4H3UA 1W02A 1BUQA 2HMMB 4HZBB 5AI1A 2QGUA 5JPUA 5IG0A 3LYGA 3CNMA 1EG9B 4PEJA 3MKIA 3H3HA 1K41A 4LEHA 5IENA 2BMRB 3CNXA 3OWSA 3F40A 3EF8A 2Z77A 2OWPA 3G0KA 4J8TA 8CHOA 3OWYA 4Q53A 3DXOA 3MSOA 1JB2A 1Z1SA 3F9SA 2GEYA 3JUNA 4ORLA 2Z7AA 3ROBA 3FH1A 3T8NA 3EHCA 1JB5A 2HMLB 4HM0B 2B24B 3NBRA 3NM2A 3FLJA 1W00A 1CQSA 1C7HA 3M8CA 1E3RA 4K1UA 4R1KA 3DZLA 3G16A 2RGQA 1O7MB 5AEUB 5EVHA 3RGAA 5AIGA 1JB4A 1QMAA 5FW5A 1UUWB 5D81A 2W2CA 4XB5A 2GEXA 3JUPA 3EC9A 4HKVB 2B1XB 4R9KA 2BMOB 3E99A 2YFLB 1OH0A 1IDPA 3ER7A 3K0ZA 3GWRA 3NV0B 3GZXB 1E3VA 5DREA 3FKAA 4L7KA 1U5OA 1GS3A 1JN5A 4WYKB 2GBXB 3T8UA 1GY6A 3JUOA 3F8HA 5IERA 4XM4A 5KP1A 3KZTA 4XBTA 1DMNA 4HJLB 5BXQA 3JUQA 2F99A 3VGNA 3UNLA 4IIAA 3SOAA 3EQQB 1WQLB 2HMJB 4K1VA 3ECFA 4J9AA 2BMQB 5IEOA 3SOYA 3A76A 5IG5A 4STDA 3GZRA 1TP6A 1JKGB 2STDA 1E97A 3EX9A 3MG3A 4HM2B 1DMMA 4MJDA 2CHCA 5D83A 3KE7A 3F8XA 3F7XA 4HM6B 3B8LA 1HKXA 1GY5A 1OCVA 3FGYA 5IEPA 2JQ5A 1OGXA 2RCDA 2F98A 5TGNA 4WWUC 2A15A 2XSHB 2I9WA 3EJVA 3K7CA 3FZWA 3Q90A 3EN8A 3NUVA 1OUNA 1W01A 3OX9A 1EA2A 1Q40A 5IF6A 4HZ9B 5CF2A 3CU3A 5CLKA 1ULIB 1OHOA 4L8PA 4I4KA 4X2HA 4XDWA 2XSOB 5AIIA 5G2GA 3HZPA 5JPPA 4X2OA 1OF5A 1A2KA 1SJWA 3F14A 1ULJB 3HX8A 1DMQA 3VSYA 3GZYB 3LZAA 2GBWB 3G8ZA 1OHPA 4HM5B 3RGRA
chains in the Genus database with same CATH superfamily
2CW9A 2ZHXB 1GY7A 1YVSA 3FSDA 4OVMA 3S27A 3AMOB 3DM8A 3N9HA 1YNVX 1V58A 3I0YA 3KSPA 1B20A 4HM1B 5BVBA 3CCU3 4RZMA 2RBIA 1W7CA 2XEPA 2HMKB 1K9M4 3G713 2CFWA 5BU4A 1RGCA 1O7GB 3MHEA 4N6MA 5IG3A 3URPA 1RGAA 1GOVA 3JUMA 4HM7B 2BNGA 1LQMB 2CWUA 1CYUA 1RKYA 1I2EA 3LH4A 3Q1CA 1TRQA 1FYSA 2C10A 5I97A 4HOHA 1VQ53 1VQ63 1DYUA 1UUVB 1VQL3 2V1LA 1AVLA 1SPUA 1V57A 1BNJA 2ZA4A 3KN4A 1G02A 3U1WA 5D82A 5JBSA 1Q42A 1BNFA 3CCL3 1FW7A 4FCMA 2XRXB 2KCDA 1HYFA 4XBXA 3QK9A 4EBGA 1JNQA 3WR2A 1FUSA 4HM8B 2WGQA 2RSXA 2Z76A 1FGTA 3CME3 3SEDA 1YGWA 3PGBA 1A2VA 1SIIA 3LTCA 3ZFZA 3NQYA 4HM4B 1STDA 3S5CA 2HMOB 2OTL3 2J8XB 1YJ93 5IG4A 1IV9A 1JZOA 4CPKA 5DRVA 1BRKA 3GZBA 1NU3A 2IMJA 3S28A 4EV2A 1VQ43 2O3OA 1YJN3 3AHSA 1VQQA 1T3BA 1B2UA 1SARA 1X1WA 3B4PA 4LGQA 1VQK3 1EQKA 1NWWA 1FGRA 4XBYA 4OK0A 4O2HA 1C54A 1VZZA 2CFKA 2JDIH 3MG2A 1OF5B 1TTOA 1US1A 2UX0A 3BB9A 1KSIA 5STDA 1GMQA 1FGOA 1B21A 4K90B 1K8A4 1F8NA 1ZX2A 1YJW3 2OOVC 4ZM8A 2QEX3 1GD4A 3BLZA 4AKZA 3GRDA 2O9UX 2W03A 3NV0A 1RN7A 3K9MC 1BSCA 2OQEA 4LMIA 1ZO2A 1KC84 1YI23 3EN1B 6RNTA 2R4IA 3MG1A 2MC8A 1RGKA 1I70A 3X42A 3IPTA 1ISKA 2P09A 1OGZA 1YIT3 3EBTA 2PZVA 4MMXB 4WYKA 1GSPA 1NNVA 1JN5B 2CWVA 1U8CB 4LYLB 3DGOA 3EB8A 1M1K4 3BIRA 1FZUA 2GU3A 2XFTA 4IPBA 1BU4A 3CCM3 1O7NB 1QJGA 5AIHA 3KIIA 2ML5A 3NHXA 3AHWA 5ELUA 2E2UA 3KKGA 3LTDA 2FGTA 3B4OA 3DH2A 3SYUA 1O7PB 2RFRA 1TUHA 2ZL8A 2GU1A 3X40A 2K0MA 4JF8A 3DGYA 2GXFA 5AYRB 1VQM3 4RNYA 3PCSA 5HOHA 2P38A 1ROAA 3BNCA 1RLSA 1VQO3 1Q864 3S29A 1RNTA 1S5AA 3F7SA 1ASKA 1O7HB 1PY3A 4O3VA 6STDA 1Q7Y4 3UL6A 2YFJB 1AR0A 4BU4A 4GB5A 1PFPA 2CIUA 1K734 5CF1A 3SX1A 1BSAA 1RGFA 2F4YA 4R80A 4RBNA 7STDA 1FGMA 1MGWA 3UJMA 4GL6A 1LNHA 4HBRA 3EBYA 2H0IA 1MGRA 4FMCA 3D5IA 2AAEA 1BGSA 5GSPA 3D9RA 1RCKA 4BTYA 1T2IA 4GHOA 2XR8B 5M18A 1JKGA 4U13A 1NDOB 4R9LA 4JRFA 1N8R4 4WP5A 1BRIA 3X3ZA 1LNIA 1W2ZA 3L0RA 3DY5A 1V74A 3Q2PA 4OUQA 4RNZA 2CX1A 3JVCA 4CDLA 2CX0A 1A67A 2KRTA 1X1XA 4L8OA 5CXOA 1CYVA 3B7CA 3OWUA 3OV4A 5ELJA 3WA2X 4BL2A 2HMNB 3FF0A 5KP3A 1TFKA 4KFDA 1K28A 2Y74A 3DGLA 3BNEA 1RSNA 1X1YA 3MPHA 1BNIA 3FF2A 2BT3A 2WOFA 3OXAA 3IJEB 5G1LA 3A5EA 4EC6A 1NJI4 1JZDA 3LOYA 5AEWB 1W6GA 1OACA 3SXXA 3WOEB 2IA7A 2QIYA 3AGOA 1L5GB 3CPW2 2CFLA 3CPOA 3CD63 5BIRA 2CKFB 3X41A 1IVUA 3PXMA 2W56A 3LMLA 5AIFA 1W6YA 4EXRA 3CC43 1GYBA 2K3DA 4KVHA 2CG1A 1O7WB 4J5GA 3CC23 3NXJA 4HM3B 3DUKA 4XDVA 1WMNA 3GSPA 1LXEA 2OOVA 1JV2B 4FCJA 2W9QA 3WMDA 2F86B 3STDA 3G4S3 2INXA 3KFQC 1OHSA 2W9PA 2XGLA 1I3IA 1N8QA 1RRHA 1RN1A 2K54A 1EEJA 1BRHA 1UGIA 2P05A 3Q3FA 4WHAA 3RNTA 2Z6BA 1BOXA 5HGRA 2CFGA 7GSPA 2YFIB 3H51A 3S67A 4G1MB 5KP4A 1MWRA 2P0XA 1OPYA 1Q40B 4N3VA 2BO9B 3T0UA 3DMCA 3NBBA 1UI7A 5CK6A 5EEOA 4HVNA 2IY2A 5IW9A 1M9GA 3O8YA 2QA43 1VQ83 1LOYA 3FCSB 3HK4A 3MYTA 4H3UA 1W02A 1BUQA 1BNGA 2LYXA 4TX4A 1M1XB 2HMMB 4HZBB 3FG1A 3J7Yd 1WNHA 1BUJA 5AI1A 2QGUA 5JPUA 5IG0A 1BRGA 3LYGA 3CNMA 3CCS3 1JBTA 2UUGC 1PYLA 4J5KA 1FGQA 1RHLA 1KD14 3D4AA 1W4NA 1BSDA 4CCVA 1EG9B 4PEJA 1MOLA 3MKIA 1IT8A 1I2GA 3N8BA 3H3HA 1K41A 4LEHA 5IENA 1W2B2 2BMRB 3CNXA 1YVBI 1Q9EA 3OWSA 2Y73A 3F40A 5AYSC 1BSEA 1UDII 3EF8A 3D5GA 3IMAB 1T2HA 1LVNA 3HIIA 4FR9A 1TIJA 3WA3A 2Z77A 3G6E3 4QWTA 3X3XA 3QRDA 1BNEA 1JBSA 1UCIA 3X3YA 2OWPA 2KF5A 3PS8A 3G0KA 1DVCA 4J8TA 8CHOA 4I5QA 2SARA 3PYJA 1RRLA 3OWYA 4Q53A 3UB1A 1M904 3DXOA 3MSOA 1IK3A 1AY7A 1JB2A 1JRQA 4BIRA 1Z1SA 1IU7A 3AMOA 2F56A 3F9SA 2GEYA 1TFOA 5G1KA 3UL5A 2C4BA 5M19A 3JUNA 1QALA 1VQ73 1R4YA 4ORLA 6GSPA 2Z7AA 3ROBA 1LOVA 1GD3A 4O02B 2AADA 3FH1A 3T8NA 2D1WA 2F5WA 1A2PA 4FMBA 1UCKA 1MWTA 3EHCA 1JB5A 1STFI 2KAAA 3CCE3 2HMLB 1GOUA 4HM0B 2B24B 3NBRA 3NM2A 3FLJA 2RNTA 3CCV3 1BANA 1GOYA 1W00A 1CQSA 1LOXA 2E2TA 1IQXA 1C7HA 3M8CA 1E3RA 1FUWA 1Q814 2F5MA 4K1UA 1ZGXA 3NM7A 4R1KA 2CWTA 3OW22 4H61A 3WHOA 1Q7HA 3DZLA 3G16A 1YIJ3 1J2BA 1CEWI 1TJDA 2RGQA 1O7MB 3VF1A 3DGNA 4K61A 1RTUA 5AEUB 1PU4A 1AQZA 5EVHA 3RGAA 5AIGA 1JB4A 1QMAA 2KF4A 4BL3A 2R41A 1DE3A 3FG4A 4EW5A 1QAFA 1GMPA 2SBLA 1TRPA 1UUWB 5FW5A 5D81A 5A0OB 3WODG 2OTJ3 2W2CA 4XB5A 1YHQ3 2BIRA 1B2XA 3GAXA 4N6UA 4NREA 1N5PA 2GEXA 2L1SA 3JUPA 2KF3A 3WDGB 3EC9A 4AEQA 4HKVB 3BNBA 4R4KA 2B1XB 2BHMA 3WOFB 2ML6A 3KCHA 2BMOB 4MEIA 4R9KA 3E99A 1DETA 1BNSA 1WMOA 2YFLB 1I0VA 2XF3A 1RGEA 3ZG5A 4FMAA 2CC3A 1OH0A 2W6JH 1IDPA 3ER7A 1I8VA 2OQEC 3SVAA 1I2FA 1WTHA 2WGOA 3N54B 4N6TA 3CC73 3CCR3 2WO0A 4BTXA 1BRSA 5LC6A 1UI8A 2C11A 3I563 3K0ZA 3GWRA 1MWUA 3NV0B 3GZXB 4AKYA 1BNRA 1E3VA 1BAOA 5DREA 1W5ZA 4MMZB 2IYJA 1SIHA 2WOHA 1CH0A 1KWIA 3FKAA 1QVG2 1W6CA 2MF7A 7RNTA 1LQGC 1AVKA 1U5OA 4L7KA 3PZWA 1IYYA 1GS3A 2CG0A 1JN5A 2YX9A 4WYKB 3CMA3 1UW1A 1VQN3 1MWSA 4RNTA 1BIRA 1FA3A 3MWZA 3LXUX 1D6ZA 1SQWA 4LSOA 2GSPA 3EE1A 8RNTA 2GBXB 1UUGB 1GY6A 3T8UA 1UCLA 3JUOA 3F8HA 2D42A 3ZG0A 5IERA 1QVF2 3K63A 1ZS7A 4N6NB 4XM4A 1NB5I 1B2SA 1G0TA 3LTBA 5KP1A 4N6V0 2OCTA 1NB3I 3KZTA 2FNQA 4XBTA 1DMNA 4HJLB 5BXQA 3JUQA 2F99A 3VGNA 3UNLA 4IIAA 1IVXA 3I553 1AV4A 3SOAA 1BSBA 3LT8A 3CCJ3 1JBRA 3EQQB 3BNDA 1BVIA 3AGNA 1WQLB 2HMJB 4K1VA 1D6UA 2KF6A 1D6YA 1ROVA 1B2ZA 3ECFA 1EKMA 4FMDA 4J9AA 4BTWA 2BMQB 3LTAA 1RJOA 5IEOA 3A76A 3SOYA 4HM5B 5RNTA 5IG5A 3HI7A 4STDA 3GZRA 1TP6A 1JKGB 2STDA 1E97A 3FG3A 1IT7A 4N6OB 4EYCA 3EX9A 3MG3A 1FUTA 2KXGA 4HM2B 4KFFA 1DMMA 1T5YA 2CHCA 4GSPA 4MJDA 4IT7A 5D83A 1I0XA 1B2MA 1MNLA 4DKIA 2HOHA 3KE7A 2UGIA 3F8XA 1A90A 1X1UA 4FCZA 4CJNA 2M7OA 2IUKA 3F7XA 4HM6B 3B8LA 1HKXA 1YGEA 1IVVA 3NBJA 1B3SA 1GY5A 1RMSA 1N9EA 2L4VA 4WFOA 1OCVA 9RNTA 3FGYA 1RNBA 5IEPA 2JQ5A 1OGXA 2RCDA 2CK3H 1IVWA 2F98A 4NHFA 3V92A 1IQYA 1RDSA 4MMYB 4N6LA 2W56B 4WWUC 5TGNA 1LRAA 2A15A 4EV5A 5LC7A 2XSHB 2I9WA 2H0HA 1NO3A 3EJVA 1HU9A 1BRJA 3V99A 2XFSA 3K7CA 2P0MA 1LOWA 3FZWA 3V98A 3Q90A 1BRNL 3EN8A 3NUVA 4KT3B 1EUIC 5EQLA 1OUNA 1W01A 2Q07A 3LT9A 1RGGA 3OX9A 2CFDA 1B27A 4HAAA 1KQS2 1EA2A 4LZIA 1VQP3 1RGLA 2XGNA 1Q40A 1R4CA 4NPBA 3BU4A 1IV7A 5IF6A 4HZ9B 5FGOA 5CF2A 1S723 3CU3A 2XH9A 4O8SA 1WMPA 1IQ8A 5CLKA 1ULIB 2ZDJA 2E2VA 1OHOA 1I3FA 3NX0A 1GMRA 4I4KA 4L8PA 3CXC2 4X2HA 4XDWA 2W04A 2PNCA 2XSOB 5AIIA 1JJ22 4KFEA 3HIGA 1HZ1A 5G2GA 1TU5A 3HZPA 1Q824 5JPPA 3PCRA 4ILFA 3DGMA 1N5HA 4HYZA 3SLUA 1UCJA 3CCQ3 1G96A 4X2OA 1QAKA 2IUJA 3NQZA 1OF5A 2LQVA 1A2KA 1Y4KA 2CH9A 1SJWA 3F14A 1RN4A 2W0QA 3K5TA 1ULJB 3U97A 1N9JA 2BU4A 3TDGA 3HX8A 1DMQA 3VSYA 1UGHI 3D79A 1VQ93 2FXTA 3GZYB 3ALAA 3LZAA 2H0GA 5M1AA 3D3LA 2GBWB 1DVDA 3RDEA 3HOHA 3G8ZA 4KZ1A 1OHPA 1RCLA 3KSED 3RGRA 1RGHA
chains in the Genus database with same CATH topology
2CW9A 1GY7A 3FSDA 4OVMA 3S27A 3AMOB 3DM8A 3N9HA 3I0YA 4HM1B 3KSPA 5BVBA 3CCU3 4RZMA 1K9M4 1W7CA 2XEPA 2HMKB 3G713 2CFWA 1O7GB 3MHEA 4N6MA 5IG3A 3JUMA 4HM7B 2BNGA 2CWUA 1CYUA 1RKYA 3LH4A 3Q1CA 5I97A 2C10A 1VQ53 1VQ63 1DYUA 1UUVB 1VQL3 2V1LA 1AVLA 1SPUA 3KN4A 3U1WA 5D82A 5JBSA 1Q42A 3CCL3 4FCMA 2XRXB 2KCDA 4XBXA 3QK9A 4EBGA 1JNQA 4HM8B 2WGQA 2RSXA 2Z76A 1FGTA 3CME3 3SEDA 3PGBA 1A2VA 1SIIA 3LTCA 3NQYA 4HM4B 1STDA 3S5CA 2HMOB 2OTL3 1YJ93 5IG4A 1IV9A 5DRVA 3GZBA 1NU3A 2IMJA 3S28A 4EV2A 2O3OA 1YJN3 3B4PA 4LGQA 1VQK3 1EQKA 1NWWA 1FGRA 4XBYA 4OK0A 4O2HA 1VZZA 2CFKA 2JDIH 3MG2A 1OF5B 1US1A 2UX0A 3BB9A 1KSIA 5STDA 1FGOA 4K90B 1K8A4 1F8NA 1ZX2A 1YJW3 2OOVC 4ZM8A 2QEX3 1GD4A 3BLZA 4AKZA 3GRDA 2O9UX 2W03A 3NV0A 1RN7A 3K9MC 2OQEA 4LMIA 1ZO2A 1KC84 1YI23 3EN1B 2R4IA 3MG1A 2MC8A 3X42A 3IPTA 1ISKA 2P09A 1OGZA 1YIT3 3EBTA 2PZVA 4MMXB 4WYKA 2CWVA 1JN5B 1U8CB 3DGOA 3EB8A 1M1K4 2XFTA 2GU3A 4IPBA 3CCM3 1O7NB 1QJGA 5AIHA 3KIIA 2ML5A 3NHXA 5ELUA 2E2UA 3KKGA 3LTDA 2FGTA 3B4OA 1O7PB 2RFRA 1TUHA 2ZL8A 2GU1A 3X40A 2K0MA 4JF8A 2GXFA 5AYRB 1VQM3 4RNYA 3PCSA 2P38A 1ROAA 3BNCA 1VQO3 1Q864 3S29A 1S5AA 3F7SA 1ASKA 1O7HB 6STDA 4O3VA 1Q7Y4 3UL6A 2YFJB 1AR0A 4GB5A 2CIUA 1PFPA 1K734 5CF1A 3SX1A 4R80A 4RBNA 7STDA 1FGMA 3UJMA 4GL6A 1LNHA 4HBRA 3EBYA 4FMCA 3D9RA 4BTYA 2XR8B 1JKGA 4U13A 1NDOB 4R9LA 4JRFA 1N8R4 4WP5A 3X3ZA 1W2ZA 3L0RA 3DY5A 1V74A 3Q2PA 4OUQA 4RNZA 3JVCA 4CDLA 1A67A 2KRTA 4L8OA 5CXOA 1CYVA 3B7CA 3OWUA 3OV4A 5ELJA 3WA2X 2HMNB 3FF0A 5KP3A 1TFKA 4KFDA 1K28A 2Y74A 3DGLA 3BNEA 3MPHA 1VQ43 3OXAA 3FF2A 2BT3A 2WOFA 3IJEB 4EC6A 1NJI4 3LOYA 5AEWB 1W6GA 1OACA 3SXXA 3WOEB 2IA7A 2QIYA 1L5GB 3CPW2 2CFLA 3CPOA 3CD63 2CKFB 3X41A 1IVUA 3PXMA 2W56A 3LMLA 5AIFA 1W6YA 4EXRA 3CC43 1GYBA 4KVHA 2CG1A 1O7WB 3CC23 3NXJA 4HM3B 3DUKA 4XDVA 1WMNA 1LXEA 2OOVA 1JV2B 4FCJA 2W9QA 3WMDA 2F86B 3STDA 3G4S3 2INXA 3KFQC 1OHSA 2W9PA 2XGLA 1N8QA 1RRHA 2K54A 2P05A 4WHAA 2Z6BA 5HGRA 2CFGA 2YFIB 3H51A 3S67A 4G1MB 5KP4A 2P0XA 1OPYA 1Q40B 4N3VA 2BO9B 3T0UA 3DMCA 3NBBA 1UI7A 5CK6A 5EEOA 4HVNA 5IW9A 1M9GA 3O8YA 2QA43 1VQ83 3FCSB 3HK4A 3MYTA 4H3UA 1W02A 1BUQA 2LYXA 4TX4A 1M1XB 2HMMB 4HZBB 3FG1A 3J7Yd 1WNHA 5AI1A 2QGUA 5JPUA 5IG0A 3LYGA 3CNMA 3CCS3 1FGQA 1KD14 1W4NA 4CCVA 1EG9B 4PEJA 1MOLA 3MKIA 1IT8A 3N8BA 3H3HA 1K41A 4LEHA 5IENA 1W2B2 2BMRB 3CNXA 1YVBI 3OWSA 2Y73A 3F40A 5AYSC 3EF8A 3IMAB 1LVNA 3HIIA 4FR9A 1TIJA 3WA3A 2Z77A 3G6E3 4QWTA 3X3XA 3QRDA 3X3YA 2OWPA 3PS8A 3G0KA 1DVCA 4J8TA 8CHOA 3PYJA 1RRLA 3OWYA 4Q53A 3UB1A 1M904 3DXOA 3MSOA 1IK3A 1JB2A 1JRQA 1Z1SA 1IU7A 3AMOA 3F9SA 2GEYA 1TFOA 3UL5A 1VQ73 3JUNA 1QALA 4ORLA 2Z7AA 3ROBA 1GD3A 4O02B 3FH1A 3T8NA 2D1WA 4FMBA 3EHCA 1JB5A 1STFI 3CCE3 2HMLB 4HM0B 2B24B 3NBRA 3NM2A 3FLJA 3CCV3 1W00A 1CQSA 1LOXA 2E2TA 1IQXA 1C7HA 3M8CA 1E3RA 1FUWA 1Q814 4K1UA 3NM7A 4R1KA 2CWTA 3OW22 4H61A 3DZLA 3G16A 1YIJ3 1J2BA 1CEWI 2RGQA 1O7MB 3VF1A 3DGNA 4K61A 5AEUB 1PU4A 5EVHA 3RGAA 5AIGA 1JB4A 1QMAA 3FG4A 1QAFA 2SBLA 5FW5A 1UUWB 5A0OB 5D81A 3WODG 2OTJ3 2W2CA 4XB5A 1YHQ3 3GAXA 4N6UA 4NREA 1N5PA 2GEXA 3JUPA 3WDGB 3EC9A 4AEQA 4HKVB 3BNBA 4R4KA 2B1XB 2BHMA 3WOFB 2ML6A 4R9KA 2BMOB 4MEIA 3E99A 1WMOA 2YFLB 2XF3A 4FMAA 2CC3A 1OH0A 2W6JH 1IDPA 3ER7A 2OQEC 3SVAA 1WTHA 2WGOA 3N54B 4N6TA 3CC73 3CCR3 2WO0A 4BTXA 5LC6A 1UI8A 2C11A 3I563 3K0ZA 3GWRA 3NV0B 3GZXB 4AKYA 1E3VA 5DREA 1W5ZA 4MMZB 1SIHA 2WOHA 1KWIA 3FKAA 1QVG2 1W6CA 2MF7A 4L7KA 1AVKA 1U5OA 3PZWA 1GS3A 2CG0A 1JN5A 2YX9A 4WYKB 3CMA3 1UW1A 1VQN3 1FA3A 3MWZA 3LXUX 1D6ZA 1SQWA 4LSOA 3EE1A 2GBXB 3T8UA 1GY6A 3JUOA 3F8HA 2D42A 5IERA 1QVF2 3K63A 4N6NB 4XM4A 1NB5I 3LTBA 5KP1A 4N6V0 2OCTA 1NB3I 3KZTA 2FNQA 4XBTA 1DMNA 4HJLB 5BXQA 3JUQA 2F99A 3VGNA 3UNLA 4IIAA 1IVXA 3I553 1AV4A 3SOAA 3LT8A 3CCJ3 3EQQB 3BNDA 1WQLB 2HMJB 4K1VA 1D6UA 1D6YA 1ROVA 4FMDA 3ECFA 1EKMA 4J9AA 4BTWA 2BMQB 5IEOA 1RJOA 3SOYA 3A76A 4HM5B 5IG5A 3HI7A 4STDA 3GZRA 1TP6A 1JKGB 2STDA 1E97A 3FG3A 1IT7A 4N6OB 4EYCA 3EX9A 3MG3A 2KXGA 4HM2B 4KFFA 1DMMA 1T5YA 2CHCA 4MJDA 4IT7A 5D83A 1MNLA 3KE7A 3F8XA 1A90A 4FCZA 2M7OA 2IUKA 3F7XA 4HM6B 3B8LA 1HKXA 1YGEA 1IVVA 3NBJA 1GY5A 1N9EA 2L4VA 4WFOA 1OCVA 3FGYA 5IEPA 2JQ5A 1OGXA 2RCDA 2CK3H 1IVWA 2F98A 4NHFA 3V92A 1IQYA 4MMYB 4N6LA 2W56B 4WWUC 5TGNA 2A15A 4EV5A 5LC7A 2XSHB 2I9WA 1NO3A 3EJVA 1HU9A 3V99A 2XFSA 3K7CA 2P0MA 3FZWA 3V98A 3Q90A 3EN8A 3NUVA 5EQLA 1OUNA 1W01A 2Q07A 3LT9A 3OX9A 2CFDA 1KQS2 1EA2A 4LZIA 1VQP3 2XGNA 1Q40A 1R4CA 1IV7A 5IF6A 4HZ9B 5FGOA 5CF2A 1S723 3CU3A 2XH9A 4O8SA 1WMPA 1IQ8A 5CLKA 1ULIB 2ZDJA 2E2VA 1OHOA 3NX0A 4L8PA 4I4KA 3CXC2 4X2HA 4XDWA 2W04A 2PNCA 2XSOB 5AIIA 1JJ22 4KFEA 3HIGA 1TU5A 5G2GA 3HZPA 1Q824 5JPPA 3PCRA 3DGMA 1N5HA 4HYZA 3SLUA 3CCQ3 1G96A 4X2OA 1QAKA 2IUJA 3NQZA 1OF5A 2LQVA 1A2KA 1Y4KA 2CH9A 1SJWA 3F14A 2W0QA 3K5TA 1ULJB 3U97A 1N9JA 3TDGA 3HX8A 1DMQA 3VSYA 1VQ93 2FXTA 3GZYB 3ALAA 3LZAA 3D3LA 2GBWB 1DVDA 3RDEA 3G8ZA 4KZ1A 1OHPA 3LTAA 3KSED 3RGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GY7 A;  3FSD A;  4OVM A;  3DM8 A;  3I0Y A;  4HM1 B;  3KSP A;  5BVB A;  4RZM A;  2HMK B;  1O7G B;  3MHE A;  5IG3 A;  3JUM A;  4HM7 B;  2BNG A;  1UUV B;  5D82 A;  1Q42 A;  4FCM A;  2XRX B;  4XBX A;  4HM8 B;  2Z76 A;  3SED A;  4HM4 B;  3S5C A;  1STD A;  2HMO B;  5IG4 A;  5DRV A;  3GZB A;  1NU3 A;  2IMJ A;  3B4P A;  4LGQ A;  1NWW A;  4XBY A;  1VZZ A;  3MG2 A;  1OF5 B;  2UX0 A;  3BB9 A;  5STD A;  1ZX2 A;  3BLZ A;  3GRD A;  3NV0 A;  4LMI A;  1ZO2 A;  3EN1 B;  2R4I A;  3MG1 A;  3IPT A;  1ISK A;  1OGZ A;  3EBT A;  2PZV A;  4WYK A;  1JN5 B;  1O7N B;  1QJG A;  5AIH A;  3NHX A;  3KKG A;  3B4O A;  1O7P B;  2RFR A;  1TUH A;  2GXF A;  1S5A A;  3F7S A;  1ASK A;  1O7H B;  6STD A;  2YFJ B;  1AR0 A;  4GB5 A;  5CF1 A;  7STD A;  3UJM A;  3EBY A;  3D9R A;  2XR8 B;  1JKG A;  4U13 A;  1NDO B;  4R9L A;  4WP5 A;  4OUQ A;  4CDL A;  4L8O A;  5CXO A;  3B7C A;  3OWU A;  3OV4 A;  2HMN B;  3FF0 A;  5KP3 A;  3OXA A;  3FF2 A;  5AEW B;  2QIY A;  3CPO A;  2CKF B;  5AIF A;  1W6Y A;  1GYB A;  4KVH A;  1O7W B;  3NXJ A;  4HM3 B;  3DUK A;  4XDV A;  4FCJ A;  3WMD A;  2F86 B;  3STD A;  2INX A;  1OHS A;  2K54 A;  5HGR A;  2YFI B;  3H51 A;  5KP4 A;  1OPY A;  1Q40 B;  4N3V A;  3DMC A;  5CK6 A;  4HVN A;  3HK4 A;  3MYT A;  4H3U A;  1W02 A;  1BUQ A;  2HMM B;  4HZB B;  5AI1 A;  2QGU A;  5JPU A;  5IG0 A;  3LYG A;  3CNM A;  1EG9 B;  4PEJ A;  3MKI A;  3H3H A;  1K41 A;  4LEH A;  5IEN A;  2BMR B;  3CNX A;  3OWS A;  3F40 A;  3EF8 A;  2Z77 A;  2OWP A;  3G0K A;  4J8T A;  8CHO A;  3OWY A;  4Q53 A;  3DXO A;  3MSO A;  1JB2 A;  1Z1S A;  3F9S A;  2GEY A;  3JUN A;  4ORL A;  2Z7A A;  3ROB A;  3FH1 A;  3T8N A;  3EHC A;  1JB5 A;  2HML B;  4HM0 B;  2B24 B;  3NBR A;  3NM2 A;  3FLJ A;  1W00 A;  1CQS A;  1C7H A;  3M8C A;  1E3R A;  4K1U A;  4R1K A;  3DZL A;  3G16 A;  2RGQ A;  1O7M B;  5AEU B;  5EVH A;  3RGA A;  5AIG A;  1JB4 A;  1QMA A;  5FW5 A;  1UUW B;  5D81 A;  2W2C A;  4XB5 A;  2GEX A;  3JUP A;  3EC9 A;  4HKV B;  2B1X B;  4R9K A;  2BMO B;  3E99 A;  2YFL B;  1OH0 A;  1IDP A;  3ER7 A;  3K0Z A;  3GWR A;  3NV0 B;  3GZX B;  1E3V A;  5DRE A;  3FKA A;  4L7K A;  1U5O A;  1GS3 A;  1JN5 A;  4WYK B;  2GBX B;  3T8U A;  1GY6 A;  3JUO A;  3F8H A;  5IER A;  4XM4 A;  5KP1 A;  3KZT A;  4XBT A;  1DMN A;  4HJL B;  5BXQ A;  3JUQ A;  2F99 A;  3VGN A;  3UNL A;  4IIA A;  3SOA A;  3EQQ B;  1WQL B;  2HMJ B;  4K1V A;  3ECF A;  4J9A A;  2BMQ B;  5IEO A;  3SOY A;  3A76 A;  5IG5 A;  4STD A;  3GZR A;  1TP6 A;  1JKG B;  2STD A;  1E97 A;  3EX9 A;  3MG3 A;  4HM2 B;  1DMM A;  4MJD A;  2CHC A;  5D83 A;  3KE7 A;  3F8X A;  3F7X A;  4HM6 B;  3B8L A;  1HKX A;  1GY5 A;  1OCV A;  3FGY A;  5IEP A;  2JQ5 A;  1OGX A;  2RCD A;  2F98 A;  5TGN A;  4WWU C;  2A15 A;  2XSH B;  2I9W A;  3EJV A;  3K7C A;  3FZW A;  3Q90 A;  3EN8 A;  3NUV A;  1OUN A;  1W01 A;  3OX9 A;  1EA2 A;  1Q40 A;  5IF6 A;  4HZ9 B;  5CF2 A;  3CU3 A;  5CLK A;  1ULI B;  1OHO A;  4L8P A;  4I4K A;  4X2H A;  4XDW A;  2XSO B;  5AII A;  5G2G A;  3HZP A;  5JPP A;  4X2O A;  1OF5 A;  1A2K A;  1SJW A;  3F14 A;  1ULJ B;  3HX8 A;  1DMQ A;  3VSY A;  3GZY B;  3LZA A;  2GBW B;  3G8Z A;  1OHP A;  4HM5 B;  3RGR A; 
#chains in the Genus database with same CATH topology
 2CW9 A;  2ZHX B;  1GY7 A;  1YVS A;  3FSD A;  4OVM A;  3S27 A;  3AMO B;  3DM8 A;  3N9H A;  1YNV X;  1V58 A;  3I0Y A;  3KSP A;  1B20 A;  4HM1 B;  5BVB A;  3CCU 3;  4RZM A;  2RBI A;  1W7C A;  2XEP A;  2HMK B;  1K9M 4;  3G71 3;  2CFW A;  5BU4 A;  1RGC A;  1O7G B;  3MHE A;  4N6M A;  5IG3 A;  3URP A;  1RGA A;  1GOV A;  3JUM A;  4HM7 B;  2BNG A;  1LQM B;  2CWU A;  1CYU A;  1RKY A;  1I2E A;  3LH4 A;  3Q1C A;  1TRQ A;  1FYS A;  2C10 A;  5I97 A;  4HOH A;  1VQ5 3;  1VQ6 3;  1DYU A;  1UUV B;  1VQL 3;  2V1L A;  1AVL A;  1SPU A;  1V57 A;  1BNJ A;  2ZA4 A;  3KN4 A;  1G02 A;  3U1W A;  5D82 A;  5JBS A;  1Q42 A;  1BNF A;  3CCL 3;  1FW7 A;  4FCM A;  2XRX B;  2KCD A;  1HYF A;  4XBX A;  3QK9 A;  4EBG A;  1JNQ A;  3WR2 A;  1FUS A;  4HM8 B;  2WGQ A;  2RSX A;  2Z76 A;  1FGT A;  3CME 3;  3SED A;  1YGW A;  3PGB A;  1A2V A;  1SII A;  3LTC A;  3ZFZ A;  3NQY A;  4HM4 B;  1STD A;  3S5C A;  2HMO B;  2OTL 3;  2J8X B;  1YJ9 3;  5IG4 A;  1IV9 A;  1JZO A;  4CPK A;  5DRV A;  1BRK A;  3GZB A;  1NU3 A;  2IMJ A;  3S28 A;  4EV2 A;  1VQ4 3;  2O3O A;  1YJN 3;  3AHS A;  1VQQ A;  1T3B A;  1B2U A;  1SAR A;  1X1W A;  3B4P A;  4LGQ A;  1VQK 3;  1EQK A;  1NWW A;  1FGR A;  4XBY A;  4OK0 A;  4O2H A;  1C54 A;  1VZZ A;  2CFK A;  2JDI H;  3MG2 A;  1OF5 B;  1TTO A;  1US1 A;  2UX0 A;  3BB9 A;  1KSI A;  5STD A;  1GMQ A;  1FGO A;  1B21 A;  4K90 B;  1K8A 4;  1F8N A;  1ZX2 A;  1YJW 3;  2OOV C;  4ZM8 A;  2QEX 3;  1GD4 A;  3BLZ A;  4AKZ A;  3GRD A;  2O9U X;  2W03 A;  3NV0 A;  1RN7 A;  3K9M C;  1BSC A;  2OQE A;  4LMI A;  1ZO2 A;  1KC8 4;  1YI2 3;  3EN1 B;  6RNT A;  2R4I A;  3MG1 A;  2MC8 A;  1RGK A;  1I70 A;  3X42 A;  3IPT A;  1ISK A;  2P09 A;  1OGZ A;  1YIT 3;  3EBT A;  2PZV A;  4MMX B;  4WYK A;  1GSP A;  1NNV A;  1JN5 B;  2CWV A;  1U8C B;  4LYL B;  3DGO A;  3EB8 A;  1M1K 4;  3BIR A;  1FZU A;  2GU3 A;  2XFT A;  4IPB A;  1BU4 A;  3CCM 3;  1O7N B;  1QJG A;  5AIH A;  3KII A;  2ML5 A;  3NHX A;  3AHW A;  5ELU A;  2E2U A;  3KKG A;  3LTD A;  2FGT A;  3B4O A;  3DH2 A;  3SYU A;  1O7P B;  2RFR A;  1TUH A;  2ZL8 A;  2GU1 A;  3X40 A;  2K0M A;  4JF8 A;  3DGY A;  2GXF A;  5AYR B;  1VQM 3;  4RNY A;  3PCS A;  5HOH A;  2P38 A;  1ROA A;  3BNC A;  1RLS A;  1VQO 3;  1Q86 4;  3S29 A;  1RNT A;  1S5A A;  3F7S A;  1ASK A;  1O7H B;  1PY3 A;  4O3V A;  6STD A;  1Q7Y 4;  3UL6 A;  2YFJ B;  1AR0 A;  4BU4 A;  4GB5 A;  1PFP A;  2CIU A;  1K73 4;  5CF1 A;  3SX1 A;  1BSA A;  1RGF A;  2F4Y A;  4R80 A;  4RBN A;  7STD A;  1FGM A;  1MGW A;  3UJM A;  4GL6 A;  1LNH A;  4HBR A;  3EBY A;  2H0I A;  1MGR A;  4FMC A;  3D5I A;  2AAE A;  1BGS A;  5GSP A;  3D9R A;  1RCK A;  4BTY A;  1T2I A;  4GHO A;  2XR8 B;  5M18 A;  1JKG A;  4U13 A;  1NDO B;  4R9L A;  4JRF A;  1N8R 4;  4WP5 A;  1BRI A;  3X3Z A;  1LNI A;  1W2Z A;  3L0R A;  3DY5 A;  1V74 A;  3Q2P A;  4OUQ A;  4RNZ A;  2CX1 A;  3JVC A;  4CDL A;  2CX0 A;  1A67 A;  2KRT A;  1X1X A;  4L8O A;  5CXO A;  1CYV A;  3B7C A;  3OWU A;  3OV4 A;  5ELJ A;  3WA2 X;  4BL2 A;  2HMN B;  3FF0 A;  5KP3 A;  1TFK A;  4KFD A;  1K28 A;  2Y74 A;  3DGL A;  3BNE A;  1RSN A;  1X1Y A;  3MPH A;  1BNI A;  3FF2 A;  2BT3 A;  2WOF A;  3OXA A;  3IJE B;  5G1L A;  3A5E A;  4EC6 A;  1NJI 4;  1JZD A;  3LOY A;  5AEW B;  1W6G A;  1OAC A;  3SXX A;  3WOE B;  2IA7 A;  2QIY A;  3AGO A;  1L5G B;  3CPW 2;  2CFL A;  3CPO A;  3CD6 3;  5BIR A;  2CKF B;  3X41 A;  1IVU A;  3PXM A;  2W56 A;  3LML A;  5AIF A;  1W6Y A;  4EXR A;  3CC4 3;  1GYB A;  2K3D A;  4KVH A;  2CG1 A;  1O7W B;  4J5G A;  3CC2 3;  3NXJ A;  4HM3 B;  3DUK A;  4XDV A;  1WMN A;  3GSP A;  1LXE A;  2OOV A;  1JV2 B;  4FCJ A;  2W9Q A;  3WMD A;  2F86 B;  3STD A;  3G4S 3;  2INX A;  3KFQ C;  1OHS A;  2W9P A;  2XGL A;  1I3I A;  1N8Q A;  1RRH A;  1RN1 A;  2K54 A;  1EEJ A;  1BRH A;  1UGI A;  2P05 A;  3Q3F A;  4WHA A;  3RNT A;  2Z6B A;  1BOX A;  5HGR A;  2CFG A;  7GSP A;  2YFI B;  3H51 A;  3S67 A;  4G1M B;  5KP4 A;  1MWR A;  2P0X A;  1OPY A;  1Q40 B;  4N3V A;  2BO9 B;  3T0U A;  3DMC A;  3NBB A;  1UI7 A;  5CK6 A;  5EEO A;  4HVN A;  2IY2 A;  5IW9 A;  1M9G A;  3O8Y A;  2QA4 3;  1VQ8 3;  1LOY A;  3FCS B;  3HK4 A;  3MYT A;  4H3U A;  1W02 A;  1BUQ A;  1BNG A;  2LYX A;  4TX4 A;  1M1X B;  2HMM B;  4HZB B;  3FG1 A;  3J7Y d;  1WNH A;  1BUJ A;  5AI1 A;  2QGU A;  5JPU A;  5IG0 A;  1BRG A;  3LYG A;  3CNM A;  3CCS 3;  1JBT A;  2UUG C;  1PYL A;  4J5K A;  1FGQ A;  1RHL A;  1KD1 4;  3D4A A;  1W4N A;  1BSD A;  4CCV A;  1EG9 B;  4PEJ A;  1MOL A;  3MKI A;  1IT8 A;  1I2G A;  3N8B A;  3H3H A;  1K41 A;  4LEH A;  5IEN A;  1W2B 2;  2BMR B;  3CNX A;  1YVB I;  1Q9E A;  3OWS A;  2Y73 A;  3F40 A;  5AYS C;  1BSE A;  1UDI I;  3EF8 A;  3D5G A;  3IMA B;  1T2H A;  1LVN A;  3HII A;  4FR9 A;  1TIJ A;  3WA3 A;  2Z77 A;  3G6E 3;  4QWT A;  3X3X A;  3QRD A;  1BNE A;  1JBS A;  1UCI A;  3X3Y A;  2OWP A;  2KF5 A;  3PS8 A;  3G0K A;  1DVC A;  4J8T A;  8CHO A;  4I5Q A;  2SAR A;  3PYJ A;  1RRL A;  3OWY A;  4Q53 A;  3UB1 A;  1M90 4;  3DXO A;  3MSO A;  1IK3 A;  1AY7 A;  1JB2 A;  1JRQ A;  4BIR A;  1Z1S A;  1IU7 A;  3AMO A;  2F56 A;  3F9S A;  2GEY A;  1TFO A;  5G1K A;  3UL5 A;  2C4B A;  5M19 A;  3JUN A;  1QAL A;  1VQ7 3;  1R4Y A;  4ORL A;  6GSP A;  2Z7A A;  3ROB A;  1LOV A;  1GD3 A;  4O02 B;  2AAD A;  3FH1 A;  3T8N A;  2D1W A;  2F5W A;  1A2P A;  4FMB A;  1UCK A;  1MWT A;  3EHC A;  1JB5 A;  1STF I;  2KAA A;  3CCE 3;  2HML B;  1GOU A;  4HM0 B;  2B24 B;  3NBR A;  3NM2 A;  3FLJ A;  2RNT A;  3CCV 3;  1BAN A;  1GOY A;  1W00 A;  1CQS A;  1LOX A;  2E2T A;  1IQX A;  1C7H A;  3M8C A;  1E3R A;  1FUW A;  1Q81 4;  2F5M A;  4K1U A;  1ZGX A;  3NM7 A;  4R1K A;  2CWT A;  3OW2 2;  4H61 A;  3WHO A;  1Q7H A;  3DZL A;  3G16 A;  1YIJ 3;  1J2B A;  1CEW I;  1TJD A;  2RGQ A;  1O7M B;  3VF1 A;  3DGN A;  4K61 A;  1RTU A;  5AEU B;  1PU4 A;  1AQZ A;  5EVH A;  3RGA A;  5AIG A;  1JB4 A;  1QMA A;  2KF4 A;  4BL3 A;  2R41 A;  1DE3 A;  3FG4 A;  4EW5 A;  1QAF A;  1GMP A;  2SBL A;  1TRP A;  1UUW B;  5FW5 A;  5D81 A;  5A0O B;  3WOD G;  2OTJ 3;  2W2C A;  4XB5 A;  1YHQ 3;  2BIR A;  1B2X A;  3GAX A;  4N6U A;  4NRE A;  1N5P A;  2GEX A;  2L1S A;  3JUP A;  2KF3 A;  3WDG B;  3EC9 A;  4AEQ A;  4HKV B;  3BNB A;  4R4K A;  2B1X B;  2BHM A;  3WOF B;  2ML6 A;  3KCH A;  2BMO B;  4MEI A;  4R9K A;  3E99 A;  1DET A;  1BNS A;  1WMO A;  2YFL B;  1I0V A;  2XF3 A;  1RGE A;  3ZG5 A;  4FMA A;  2CC3 A;  1OH0 A;  2W6J H;  1IDP A;  3ER7 A;  1I8V A;  2OQE C;  3SVA A;  1I2F A;  1WTH A;  2WGO A;  3N54 B;  4N6T A;  3CC7 3;  3CCR 3;  2WO0 A;  4BTX A;  1BRS A;  5LC6 A;  1UI8 A;  2C11 A;  3I56 3;  3K0Z A;  3GWR A;  1MWU A;  3NV0 B;  3GZX B;  4AKY A;  1BNR A;  1E3V A;  1BAO A;  5DRE A;  1W5Z A;  4MMZ B;  2IYJ A;  1SIH A;  2WOH A;  1CH0 A;  1KWI A;  3FKA A;  1QVG 2;  1W6C A;  2MF7 A;  7RNT A;  1LQG C;  1AVK A;  1U5O A;  4L7K A;  3PZW A;  1IYY A;  1GS3 A;  2CG0 A;  1JN5 A;  2YX9 A;  4WYK B;  3CMA 3;  1UW1 A;  1VQN 3;  1MWS A;  4RNT A;  1BIR A;  1FA3 A;  3MWZ A;  3LXU X;  1D6Z A;  1SQW A;  4LSO A;  2GSP A;  3EE1 A;  8RNT A;  2GBX B;  1UUG B;  1GY6 A;  3T8U A;  1UCL A;  3JUO A;  3F8H A;  2D42 A;  3ZG0 A;  5IER A;  1QVF 2;  3K63 A;  1ZS7 A;  4N6N B;  4XM4 A;  1NB5 I;  1B2S A;  1G0T A;  3LTB A;  5KP1 A;  4N6V 0;  2OCT A;  1NB3 I;  3KZT A;  2FNQ A;  4XBT A;  1DMN A;  4HJL B;  5BXQ A;  3JUQ A;  2F99 A;  3VGN A;  3UNL A;  4IIA A;  1IVX A;  3I55 3;  1AV4 A;  3SOA A;  1BSB A;  3LT8 A;  3CCJ 3;  1JBR A;  3EQQ B;  3BND A;  1BVI A;  3AGN A;  1WQL B;  2HMJ B;  4K1V A;  1D6U A;  2KF6 A;  1D6Y A;  1ROV A;  1B2Z A;  3ECF A;  1EKM A;  4FMD A;  4J9A A;  4BTW A;  2BMQ B;  3LTA A;  1RJO A;  5IEO A;  3A76 A;  3SOY A;  4HM5 B;  5RNT A;  5IG5 A;  3HI7 A;  4STD A;  3GZR A;  1TP6 A;  1JKG B;  2STD A;  1E97 A;  3FG3 A;  1IT7 A;  4N6O B;  4EYC A;  3EX9 A;  3MG3 A;  1FUT A;  2KXG A;  4HM2 B;  4KFF A;  1DMM A;  1T5Y A;  2CHC A;  4GSP A;  4MJD A;  4IT7 A;  5D83 A;  1I0X A;  1B2M A;  1MNL A;  4DKI A;  2HOH A;  3KE7 A;  2UGI A;  3F8X A;  1A90 A;  1X1U A;  4FCZ A;  4CJN A;  2M7O A;  2IUK A;  3F7X A;  4HM6 B;  3B8L A;  1HKX A;  1YGE A;  1IVV A;  3NBJ A;  1B3S A;  1GY5 A;  1RMS A;  1N9E A;  2L4V A;  4WFO A;  1OCV A;  9RNT A;  3FGY A;  1RNB A;  5IEP A;  2JQ5 A;  1OGX A;  2RCD A;  2CK3 H;  1IVW A;  2F98 A;  4NHF A;  3V92 A;  1IQY A;  1RDS A;  4MMY B;  4N6L A;  2W56 B;  4WWU C;  5TGN A;  1LRA A;  2A15 A;  4EV5 A;  5LC7 A;  2XSH B;  2I9W A;  2H0H A;  1NO3 A;  3EJV A;  1HU9 A;  1BRJ A;  3V99 A;  2XFS A;  3K7C A;  2P0M A;  1LOW A;  3FZW A;  3V98 A;  3Q90 A;  1BRN L;  3EN8 A;  3NUV A;  4KT3 B;  1EUI C;  5EQL A;  1OUN A;  1W01 A;  2Q07 A;  3LT9 A;  1RGG A;  3OX9 A;  2CFD A;  1B27 A;  4HAA A;  1KQS 2;  1EA2 A;  4LZI A;  1VQP 3;  1RGL A;  2XGN A;  1Q40 A;  1R4C A;  4NPB A;  3BU4 A;  1IV7 A;  5IF6 A;  4HZ9 B;  5FGO A;  5CF2 A;  1S72 3;  3CU3 A;  2XH9 A;  4O8S A;  1WMP A;  1IQ8 A;  5CLK A;  1ULI B;  2ZDJ A;  2E2V A;  1OHO A;  1I3F A;  3NX0 A;  1GMR A;  4I4K A;  4L8P A;  3CXC 2;  4X2H A;  4XDW A;  2W04 A;  2PNC A;  2XSO B;  5AII A;  1JJ2 2;  4KFE A;  3HIG A;  1HZ1 A;  5G2G A;  1TU5 A;  3HZP A;  1Q82 4;  5JPP A;  3PCR A;  4ILF A;  3DGM A;  1N5H A;  4HYZ A;  3SLU A;  1UCJ A;  3CCQ 3;  1G96 A;  4X2O A;  1QAK A;  2IUJ A;  3NQZ A;  1OF5 A;  2LQV A;  1A2K A;  1Y4K A;  2CH9 A;  1SJW A;  3F14 A;  1RN4 A;  2W0Q A;  3K5T A;  1ULJ B;  3U97 A;  1N9J A;  2BU4 A;  3TDG A;  3HX8 A;  1DMQ A;  3VSY A;  1UGH I;  3D79 A;  1VQ9 3;  2FXT A;  3GZY B;  3ALA A;  3LZA A;  2H0G A;  5M1A A;  3D3L A;  2GBW B;  1DVD A;  3RDE A;  3HOH A;  3G8Z A;  4KZ1 A;  1OHP A;  1RCL A;  3KSE D;  3RGR A;  1RGH A; 
#chains in the Genus database with same CATH homology
 2CW9 A;  1GY7 A;  3FSD A;  4OVM A;  3S27 A;  3AMO B;  3DM8 A;  3N9H A;  3I0Y A;  4HM1 B;  3KSP A;  5BVB A;  3CCU 3;  4RZM A;  1K9M 4;  1W7C A;  2XEP A;  2HMK B;  3G71 3;  2CFW A;  1O7G B;  3MHE A;  4N6M A;  5IG3 A;  3JUM A;  4HM7 B;  2BNG A;  2CWU A;  1CYU A;  1RKY A;  3LH4 A;  3Q1C A;  5I97 A;  2C10 A;  1VQ5 3;  1VQ6 3;  1DYU A;  1UUV B;  1VQL 3;  2V1L A;  1AVL A;  1SPU A;  3KN4 A;  3U1W A;  5D82 A;  5JBS A;  1Q42 A;  3CCL 3;  4FCM A;  2XRX B;  2KCD A;  4XBX A;  3QK9 A;  4EBG A;  1JNQ A;  4HM8 B;  2WGQ A;  2RSX A;  2Z76 A;  1FGT A;  3CME 3;  3SED A;  3PGB A;  1A2V A;  1SII A;  3LTC A;  3NQY A;  4HM4 B;  1STD A;  3S5C A;  2HMO B;  2OTL 3;  1YJ9 3;  5IG4 A;  1IV9 A;  5DRV A;  3GZB A;  1NU3 A;  2IMJ A;  3S28 A;  4EV2 A;  2O3O A;  1YJN 3;  3B4P A;  4LGQ A;  1VQK 3;  1EQK A;  1NWW A;  1FGR A;  4XBY A;  4OK0 A;  4O2H A;  1VZZ A;  2CFK A;  2JDI H;  3MG2 A;  1OF5 B;  1US1 A;  2UX0 A;  3BB9 A;  1KSI A;  5STD A;  1FGO A;  4K90 B;  1K8A 4;  1F8N A;  1ZX2 A;  1YJW 3;  2OOV C;  4ZM8 A;  2QEX 3;  1GD4 A;  3BLZ A;  4AKZ A;  3GRD A;  2O9U X;  2W03 A;  3NV0 A;  1RN7 A;  3K9M C;  2OQE A;  4LMI A;  1ZO2 A;  1KC8 4;  1YI2 3;  3EN1 B;  2R4I A;  3MG1 A;  2MC8 A;  3X42 A;  3IPT A;  1ISK A;  2P09 A;  1OGZ A;  1YIT 3;  3EBT A;  2PZV A;  4MMX B;  4WYK A;  2CWV A;  1JN5 B;  1U8C B;  3DGO A;  3EB8 A;  1M1K 4;  2XFT A;  2GU3 A;  4IPB A;  3CCM 3;  1O7N B;  1QJG A;  5AIH A;  3KII A;  2ML5 A;  3NHX A;  5ELU A;  2E2U A;  3KKG A;  3LTD A;  2FGT A;  3B4O A;  1O7P B;  2RFR A;  1TUH A;  2ZL8 A;  2GU1 A;  3X40 A;  2K0M A;  4JF8 A;  2GXF A;  5AYR B;  1VQM 3;  4RNY A;  3PCS A;  2P38 A;  1ROA A;  3BNC A;  1VQO 3;  1Q86 4;  3S29 A;  1S5A A;  3F7S A;  1ASK A;  1O7H B;  6STD A;  4O3V A;  1Q7Y 4;  3UL6 A;  2YFJ B;  1AR0 A;  4GB5 A;  2CIU A;  1PFP A;  1K73 4;  5CF1 A;  3SX1 A;  4R80 A;  4RBN A;  7STD A;  1FGM A;  3UJM A;  4GL6 A;  1LNH A;  4HBR A;  3EBY A;  4FMC A;  3D9R A;  4BTY A;  2XR8 B;  1JKG A;  4U13 A;  1NDO B;  4R9L A;  4JRF A;  1N8R 4;  4WP5 A;  3X3Z A;  1W2Z A;  3L0R A;  3DY5 A;  1V74 A;  3Q2P A;  4OUQ A;  4RNZ A;  3JVC A;  4CDL A;  1A67 A;  2KRT A;  4L8O A;  5CXO A;  1CYV A;  3B7C A;  3OWU A;  3OV4 A;  5ELJ A;  3WA2 X;  2HMN B;  3FF0 A;  5KP3 A;  1TFK A;  4KFD A;  1K28 A;  2Y74 A;  3DGL A;  3BNE A;  3MPH A;  1VQ4 3;  3OXA A;  3FF2 A;  2BT3 A;  2WOF A;  3IJE B;  4EC6 A;  1NJI 4;  3LOY A;  5AEW B;  1W6G A;  1OAC A;  3SXX A;  3WOE B;  2IA7 A;  2QIY A;  1L5G B;  3CPW 2;  2CFL A;  3CPO A;  3CD6 3;  2CKF B;  3X41 A;  1IVU A;  3PXM A;  2W56 A;  3LML A;  5AIF A;  1W6Y A;  4EXR A;  3CC4 3;  1GYB A;  4KVH A;  2CG1 A;  1O7W B;  3CC2 3;  3NXJ A;  4HM3 B;  3DUK A;  4XDV A;  1WMN A;  1LXE A;  2OOV A;  1JV2 B;  4FCJ A;  2W9Q A;  3WMD A;  2F86 B;  3STD A;  3G4S 3;  2INX A;  3KFQ C;  1OHS A;  2W9P A;  2XGL A;  1N8Q A;  1RRH A;  2K54 A;  2P05 A;  4WHA A;  2Z6B A;  5HGR A;  2CFG A;  2YFI B;  3H51 A;  3S67 A;  4G1M B;  5KP4 A;  2P0X A;  1OPY A;  1Q40 B;  4N3V A;  2BO9 B;  3T0U A;  3DMC A;  3NBB A;  1UI7 A;  5CK6 A;  5EEO A;  4HVN A;  5IW9 A;  1M9G A;  3O8Y A;  2QA4 3;  1VQ8 3;  3FCS B;  3HK4 A;  3MYT A;  4H3U A;  1W02 A;  1BUQ A;  2LYX A;  4TX4 A;  1M1X B;  2HMM B;  4HZB B;  3FG1 A;  3J7Y d;  1WNH A;  5AI1 A;  2QGU A;  5JPU A;  5IG0 A;  3LYG A;  3CNM A;  3CCS 3;  1FGQ A;  1KD1 4;  1W4N A;  4CCV A;  1EG9 B;  4PEJ A;  1MOL A;  3MKI A;  1IT8 A;  3N8B A;  3H3H A;  1K41 A;  4LEH A;  5IEN A;  1W2B 2;  2BMR B;  3CNX A;  1YVB I;  3OWS A;  2Y73 A;  3F40 A;  5AYS C;  3EF8 A;  3IMA B;  1LVN A;  3HII A;  4FR9 A;  1TIJ A;  3WA3 A;  2Z77 A;  3G6E 3;  4QWT A;  3X3X A;  3QRD A;  3X3Y A;  2OWP A;  3PS8 A;  3G0K A;  1DVC A;  4J8T A;  8CHO A;  3PYJ A;  1RRL A;  3OWY A;  4Q53 A;  3UB1 A;  1M90 4;  3DXO A;  3MSO A;  1IK3 A;  1JB2 A;  1JRQ A;  1Z1S A;  1IU7 A;  3AMO A;  3F9S A;  2GEY A;  1TFO A;  3UL5 A;  1VQ7 3;  3JUN A;  1QAL A;  4ORL A;  2Z7A A;  3ROB A;  1GD3 A;  4O02 B;  3FH1 A;  3T8N A;  2D1W A;  4FMB A;  3EHC A;  1JB5 A;  1STF I;  3CCE 3;  2HML B;  4HM0 B;  2B24 B;  3NBR A;  3NM2 A;  3FLJ A;  3CCV 3;  1W00 A;  1CQS A;  1LOX A;  2E2T A;  1IQX A;  1C7H A;  3M8C A;  1E3R A;  1FUW A;  1Q81 4;  4K1U A;  3NM7 A;  4R1K A;  2CWT A;  3OW2 2;  4H61 A;  3DZL A;  3G16 A;  1YIJ 3;  1J2B A;  1CEW I;  2RGQ A;  1O7M B;  3VF1 A;  3DGN A;  4K61 A;  5AEU B;  1PU4 A;  5EVH A;  3RGA A;  5AIG A;  1JB4 A;  1QMA A;  3FG4 A;  1QAF A;  2SBL A;  5FW5 A;  1UUW B;  5A0O B;  5D81 A;  3WOD G;  2OTJ 3;  2W2C A;  4XB5 A;  1YHQ 3;  3GAX A;  4N6U A;  4NRE A;  1N5P A;  2GEX A;  3JUP A;  3WDG B;  3EC9 A;  4AEQ A;  4HKV B;  3BNB A;  4R4K A;  2B1X B;  2BHM A;  3WOF B;  2ML6 A;  4R9K A;  2BMO B;  4MEI A;  3E99 A;  1WMO A;  2YFL B;  2XF3 A;  4FMA A;  2CC3 A;  1OH0 A;  2W6J H;  1IDP A;  3ER7 A;  2OQE C;  3SVA A;  1WTH A;  2WGO A;  3N54 B;  4N6T A;  3CC7 3;  3CCR 3;  2WO0 A;  4BTX A;  5LC6 A;  1UI8 A;  2C11 A;  3I56 3;  3K0Z A;  3GWR A;  3NV0 B;  3GZX B;  4AKY A;  1E3V A;  5DRE A;  1W5Z A;  4MMZ B;  1SIH A;  2WOH A;  1KWI A;  3FKA A;  1QVG 2;  1W6C A;  2MF7 A;  4L7K A;  1AVK A;  1U5O A;  3PZW A;  1GS3 A;  2CG0 A;  1JN5 A;  2YX9 A;  4WYK B;  3CMA 3;  1UW1 A;  1VQN 3;  1FA3 A;  3MWZ A;  3LXU X;  1D6Z A;  1SQW A;  4LSO A;  3EE1 A;  2GBX B;  3T8U A;  1GY6 A;  3JUO A;  3F8H A;  2D42 A;  5IER A;  1QVF 2;  3K63 A;  4N6N B;  4XM4 A;  1NB5 I;  3LTB A;  5KP1 A;  4N6V 0;  2OCT A;  1NB3 I;  3KZT A;  2FNQ A;  4XBT A;  1DMN A;  4HJL B;  5BXQ A;  3JUQ A;  2F99 A;  3VGN A;  3UNL A;  4IIA A;  1IVX A;  3I55 3;  1AV4 A;  3SOA A;  3LT8 A;  3CCJ 3;  3EQQ B;  3BND A;  1WQL B;  2HMJ B;  4K1V A;  1D6U A;  1D6Y A;  1ROV A;  4FMD A;  3ECF A;  1EKM A;  4J9A A;  4BTW A;  2BMQ B;  5IEO A;  1RJO A;  3SOY A;  3A76 A;  4HM5 B;  5IG5 A;  3HI7 A;  4STD A;  3GZR A;  1TP6 A;  1JKG B;  2STD A;  1E97 A;  3FG3 A;  1IT7 A;  4N6O B;  4EYC A;  3EX9 A;  3MG3 A;  2KXG A;  4HM2 B;  4KFF A;  1DMM A;  1T5Y A;  2CHC A;  4MJD A;  4IT7 A;  5D83 A;  1MNL A;  3KE7 A;  3F8X A;  1A90 A;  4FCZ A;  2M7O A;  2IUK A;  3F7X A;  4HM6 B;  3B8L A;  1HKX A;  1YGE A;  1IVV A;  3NBJ A;  1GY5 A;  1N9E A;  2L4V A;  4WFO A;  1OCV A;  3FGY A;  5IEP A;  2JQ5 A;  1OGX A;  2RCD A;  2CK3 H;  1IVW A;  2F98 A;  4NHF A;  3V92 A;  1IQY A;  4MMY B;  4N6L A;  2W56 B;  4WWU C;  5TGN A;  2A15 A;  4EV5 A;  5LC7 A;  2XSH B;  2I9W A;  1NO3 A;  3EJV A;  1HU9 A;  3V99 A;  2XFS A;  3K7C A;  2P0M A;  3FZW A;  3V98 A;  3Q90 A;  3EN8 A;  3NUV A;  5EQL A;  1OUN A;  1W01 A;  2Q07 A;  3LT9 A;  3OX9 A;  2CFD A;  1KQS 2;  1EA2 A;  4LZI A;  1VQP 3;  2XGN A;  1Q40 A;  1R4C A;  1IV7 A;  5IF6 A;  4HZ9 B;  5FGO A;  5CF2 A;  1S72 3;  3CU3 A;  2XH9 A;  4O8S A;  1WMP A;  1IQ8 A;  5CLK A;  1ULI B;  2ZDJ A;  2E2V A;  1OHO A;  3NX0 A;  4L8P A;  4I4K A;  3CXC 2;  4X2H A;  4XDW A;  2W04 A;  2PNC A;  2XSO B;  5AII A;  1JJ2 2;  4KFE A;  3HIG A;  1TU5 A;  5G2G A;  3HZP A;  1Q82 4;  5JPP A;  3PCR A;  3DGM A;  1N5H A;  4HYZ A;  3SLU A;  3CCQ 3;  1G96 A;  4X2O A;  1QAK A;  2IUJ A;  3NQZ A;  1OF5 A;  2LQV A;  1A2K A;  1Y4K A;  2CH9 A;  1SJW A;  3F14 A;  2W0Q A;  3K5T A;  1ULJ B;  3U97 A;  1N9J A;  3TDG A;  3HX8 A;  1DMQ A;  3VSY A;  1VQ9 3;  2FXT A;  3GZY B;  3ALA A;  3LZA A;  3D3L A;  2GBW B;  1DVD A;  3RDE A;  3G8Z A;  4KZ1 A;  1OHP A;  3LTA A;  3KSE D;  3RGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...