3BIRA

Disecting histidine interactions in ribonuclease t1 by asn and gln substitutions
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITNTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Dissecting histidine interactions of ribonuclease T1 with asparagine and glutamine replacements: analysis of double mutant cycles at one position.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endonuclease
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3birA00
1RGKA 1BAOA 1GMQA 1UCKA 1R4YA 1BRSA 5RNTA 1LOYA 2F5MA 1IYYA 1RMSA 2KAAA 1RN1A 1Q9EA 3BU4A 7GSPA 1RSNA 1BNSA 1RGGA 4BU4A 3WHOA 1B2UA 1MGRA 3KCHA 3HOHA 3GSPA 1B2ZA 1FUTA 1GOVA 4GSPA 1RTUA 8RNTA 1JBSA 1X1UA 1C54A 1I0VA 1JBRA 1BU4A 3DH2A 3URPA 1GMPA 6GSPA 3D5IA 1BRHA 1B2MA 1BOXA 3BIRA 1GOYA 4GHOA 4J5KA 5BIRA 1RGCA 1BNGA 1RGEA 1I2FA 3AHWA 1RDSA 1BRIA 1X1XA 1BUJA 2AAEA 1I2GA 1RN4A 4RNTA 5GSPA 1MGWA 1B3SA 1FZUA 1DETA 1YNVX 1UCLA 1RLSA 3D4AA 1G02A 4HAAA 2GSPA 1BNJA 3AHSA 1RNBA 3Q3FA 1B2XA 1LRAA 1LOVA 3DGYA 1AQZA 1T2HA 1GMRA 2RBIA 1I3IA 1BNIA 2F56A 1BVIA 1HYFA 1I3FA 1GOUA 3D5GA 1ZGXA 1BANA 2BIRA 2F4YA 2RNTA 1RNTA 3AGOA 5BU4A 1BNEA 1B21A 1I0XA 2KF3A 1BRNL 1LOWA 1BGSA 1TTOA 2KF5A 1RCKA 3WR2A 1PYLA 1A2PA 1YGWA 2F5WA 2KF4A 1BSAA 1SARA 1X1WA 1FUSA 9RNTA 2SARA 1GSPA 1BSCA 2C4BA 1UCIA 1DE3A 1AY7A 6RNTA 7RNTA 1JBTA 1BSDA 1RGLA 1B27A 1B20A 2KF6A 1BRGA 1X1YA 3SYUA 1UCJA 1BSBA 1T2IA 1PY3A 1I2EA 1BNFA 1CH0A 1I70A 1YVSA 1BSEA 2HOHA 3A5EA 4BIRA 1LNIA 2BU4A 1I8VA 1RGFA 1FYSA 1RHLA 2AADA 1FW7A 1BIRA 2ZA4A 1TRQA 1RCLA 4HOHA 1TRPA 3RNTA 3AGNA 1RGHA 5HOHA 1HZ1A 1B2SA 1RGAA 1BNRA 4J5GA 1BRKA 1BRJA
chains in the Genus database with same CATH superfamily
1RGKA 1BAOA 1UCKA 1YIT3 3O8YA 1DYUA 4LZIA 2H0IA 3EF8A 2KAAA 4WFOA 3BU4A 7GSPA 1Z1SA 1O7HB 4TX4A 3DGMA 3WHOA 2F98A 2CFLA 1AR0A 1MGRA 1E3RA 1IT8A 3KCHA 2OTL3 3N54B 3OWYA 3OV4A 3V99A 1CYUA 2BMOB 1QVG2 4BTWA 2W0QA 1X1UA 2IA7A 3EC9A 1LNHA 3GZXB 1CEWI 3DH2A 5D82A 1IQXA 3URPA 1JN5B 1NNVA 1QMAA 1BRHA 2L1SA 3D5IA 5BIRA 5I97A 1MNLA 4WWUC 1RGCA 1BNGA 2Y74A 3AHWA 1OF5A 3CNXA 4XBXA 1X1XA 1UGHI 2HMMB 4HM2B 4XBYA 2IMJA 3BNDA 4RNTA 4X2HA 5GSPA 3T8UA 3I553 2XFTA 1L5GB 1RJOA 2QIYA 2Z6BA 4NREA 4HAAA 3FF2A 2OOVC 1GD4A 3WA3A 1JJ22 3AHSA 1U8CB 1KD14 4N6V0 1LOVA 5HGRA 1SJWA 2ML6A 5IG0A 2CKFB 3RGRA 3CCR3 1T2HA 3MPHA 5M19A 4STDA 3NQZA 3QRDA 3ZG0A 1BVIA 1ZO2A 2ML5A 3D5GA 3HIIA 3LT8A 2F4YA 5ELUA 2RNTA 5JPPA 2K54A 1Q814 1VQN3 1D6UA 2P09A 2M7OA 3BLZA 3D3LA 2XGNA 2XRXB 3KIIA 3LXUX 4JF8A 1OH0A 1TTOA 1WQLB 1HU9A 3STDA 1YHQ3 4H3UA 1JZOA 3FH1A 3WR2A 3GZYB 3F9SA 1STDA 4ILFA 4RBNA 3HIGA 4HYZA 1YGWA 4MJDA 5DRVA 4EBGA 3MHEA 2STDA 1KWIA 3EHCA 2CFGA 3SVAA 1VQP3 1UW1A 3EJVA 3HX8A 3MG1A 1DE3A 2D1WA 2J8XB 6RNTA 7RNTA 1ASKA 3Q90A 4XM4A 1FGTA 3BNBA 2YFJB 2KF6A 4IIAA 1BRGA 1GY7A 1X1YA 1Y4KA 2IUKA 1M9GA 4HBRA 2XR8B 1KC84 5LC6A 1G0TA 3IJEB 2CH9A 2HOHA 2W9PA 3LTCA 4BIRA 1E3VA 3DGNA 4J9AA 1A90A 5JPUA 1RGFA 1US1A 4FMBA 1FYSA 1RHLA 3DXOA 4KFDA 8CHOA 1FUWA 1N5PA 2CIUA 2BMQB 4FMCA 3WOEB 2ZDJA 4WP5A 1GYBA 3F40A 2KCDA 3OWUA 1JKGB 4RNYA 2CWVA 1PFPA 2LQVA 2WOFA 3E99A 1LQGC 1O7PB 3NBJA 2LYXA 1HZ1A 2JDIH 5EQLA 1W6CA 2E2UA 3LTAA 1Q7HA 2O9UX 3VF1A 4J5GA 3X42A 4CJNA 1YNVX 4HM6B 4HZBB 4XDWA 3GRDA 3KSED 1JRQA 3CPOA 3FLJA 3V98A 4OVMA 4LGQA 2F5MA 2W9QA 5AEWB 4AEQA 1ZS7A 1RN1A 3EBYA 1K28A 4R80A 4BTYA 1BNSA 2JQ5A 3NUVA 4O8SA 4BU4A 1Q40A 1B2UA 1NWWA 2MC8A 1FGRA 1YJW3 3HOHA 1N8R4 4N6TA 1B2ZA 3CCS3 2C10A 1GOVA 3AMOA 1ROAA 1IVUA 3QK9A 3CPW2 5KP4A 2BMRB 4N6MA 3FKAA 1C54A 1I0VA 2UGIA 3K9MC 1BU4A 1V58A 4N6LA 1YJN3 3H51A 1AVLA 1UI8A 1I2FA 1NB3I 3T8NA 1RDSA 1YJ93 1BRIA 5G1KA 2A15A 2AAEA 3LMLA 1QJGA 2IY2A 2XSHB 2IUJA 1D6YA 3NHXA 1Q864 1B3SA 4WYKA 1TP6A 3S28A 2B24B 1DETA 1UCLA 1TJDA 1G02A 4MEIA 5AEUB 3GZBA 3OW22 2RSXA 4HZ9B 3DMCA 1LRAA 1LQMB 5CF1A 3CCM3 2W56A 1K41A 1WNHA 3CCL3 1RRLA 1BNIA 2HMOB 4K90B 1RRHA 4LMIA 3SEDA 3UJMA 3D9RA 2YFIB 2UUGC 4K61A 1W00A 2BIRA 1W6YA 2BT3A 4HJLB 1M904 4I5QA 4EYCA 3FF0A 3DGLA 1W2B2 1B21A 3F7SA 4FCJA 4O2HA 4U13A 1UUVB 1VQL3 1BGSA 5IEPA 1K734 4HM0B 4K1VA 3WODG 1RCKA 4IT7A 5BXQA 1NU3A 1PYLA 3F8XA 3Q2PA 1A2PA 2FXTA 1SIHA 1TFOA 1IVVA 1D6ZA 1SARA 3MSOA 3VGNA 2HMKB 3PXMA 4R9LA 1VZZA 4MMZB 1HKXA 1GSPA 2C4BA 5EEOA 1OHOA 1SQWA 2XSOB 1JBTA 1BSDA 1YGEA 1B27A 1B20A 1QALA 2GEXA 3F7XA 3NV0A 3KFQC 3MYTA 3WA2X 3CME3 2CX1A 1O7GB 1UCJA 5D83A 3JVCA 1CQSA 1BNFA 1YVSA 3A5EA 1BSEA 4G1MB 3HK4A 1JB4A 1MWRA 4HM4B 1CYVA 1Q42A 1UI7A 2SBLA 4BL3A 1VQK3 3SOAA 3MG3A 2AADA 4KVHA 5D81A 1O7WB 2P0MA 1M1XB 2ZA4A 1G96A 1EEJA 3NX0A 3OXAA 2ZL8A 3B7CA 2Y73A 1FGOA 3DY5A 3F14A 4HOHA 3EN1B 4MMYB 3V92A 3CCE3 3RNTA 1Q824 1OHPA 3SXXA 3UL6A 4RZMA 4CCVA 2W2CA 1A2KA 1RGHA 1B2SA 3U1WA 3GZRA 3S27A 1BNRA 1BRKA 4L7KA 3M8CA 1O7NB 1NDOB 1BRJA 4HM8B 5STDA 1GMQA 2I9WA 1BRSA 3ER7A 2Z7AA 3LTBA 5RNTA 1LOYA 1N9JA 1FGMA 2UX0A 1QAKA 2CHCA 3ECFA 4IPBA 3EX9A 1N8QA 3GWRA 4N6NB 1YIJ3 1KQS2 1MWTA 1NO3A 3I563 2RGQA 2YX9A 3NM7A 4KFFA 1N9EA 5IEOA 3RGAA 2OOVA 1VQM3 4KFEA 2CFWA 2W04A 1RKYA 1UUGB 1VQQA 1N5HA 3LT9A 4XDVA 1M1K4 2Z76A 4GSPA 3BNCA 1K8A4 1C7HA 4HM1B 1RTUA 8RNTA 3MKIA 3MG2A 3FG1A 3SX1A 1W4NA 4LSOA 3ZG5A 4HM5B 5IG4A 1KSIA 1JBRA 2QGUA 1OCVA 1R4CA 1GMPA 1SIIA 6STDA 2QA43 1BOXA 4GHOA 1GOYA 4J5KA 3EN8A 2OTJ3 4CPKA 1RGEA 1IT7A 4I4KA 1ULJB 2WO0A 2R41A 4L8OA 1I2GA 1RN4A 3KZTA 3S29A 1JNQA 2GBXB 1DMMA 1FZUA 1ZX2A 3WDGB 1RLSA 5EVHA 2GSPA 3RDEA 1AVKA 1QVF2 1BNJA 3DZLA 4MMXB 3UB1A 1RNBA 1WMOA 3F8HA 1VQ43 1OF5B 3CU3A 4J8TA 1IU7A 4AKYA 4OUQA 1VQ83 1GMRA 2RFRA 1I3IA 3ROBA 3T0UA 3CC73 2F56A 1ISKA 2FNQA 2PZVA 3CCU3 1IQYA 5AIGA 1IQ8A 2P38A 1S723 5CLKA 4EV2A 3KKGA 1BNEA 2P0XA 3NXJA 4WHAA 1PU4A 3L0RA 1BRNL 3Q1CA 2ZHXB 3EB8A 1AV4A 4EC6A 3G0KA 1LVNA 2F86B 3K5TA 1MWUA 1E97A 1UUWB 1T3BA 1SPUA 2BHMA 2KXGA 2F5WA 2KF4A 1BSAA 5AYSC 3IPTA 3PS8A 4OK0A 1VQ73 9RNTA 4HVNA 1A2VA 1F8NA 5KP3A 2SARA 4LEHA 4X2OA 3B4OA 1DVDA 1VQ53 1JZDA 2CG0A 1UCIA 3X3ZA 1AY7A 4DKIA 3LZAA 1TU5A 1JB2A 2BO9B 2OQEA 3LH4A 1RGLA 4O02B 1TFKA 2HMJB 4QWTA 3K0ZA 1JKGA 1VQ93 2KRTA 1BSBA 1T2IA 2CX0A 2W03A 4R4KA 3A76A 4GL6A 4BL2A 1I70A 1EKMA 3NM2A 4RNZA 3OX9A 3N8BA 3LOYA 1FW7A 1FA3A 1BIRA 3MWZA 1DMQA 3U97A 1J2BA 1OPYA 2K3DA 2O3OA 2YFLB 2CK3H 4JRFA 1RCLA 4Q53A 2CG1A 3X3YA 4CDLA 5CF2A 3CC43 2HMNB 1WMNA 1YI23 3B4PA 3NQYA 3AGNA 5CK6A 2H0GA 1YVBI 4ZM8A 3DGOA 3WOFB 5HOHA 3JUMA 2Q07A 1IVWA 1V57A 2INXA 1RGAA 3DUKA 1OHSA 3BNEA 3CXC2 4AKZA 3BB9A 2CWUA 3LYGA 4HM7B 3CD63 1R4YA 1W2ZA 1Q7Y4 2P05A 4FR9A 1LOXA 3JUNA 3S5CA 1VQO3 3FG4A 3FG3A 1RMSA 3GAXA 5G2GA 1NB5I 1IYYA 2OWPA 2R4IA 1Q9EA 3FSDA 4R9KA 5JBSA 3JUPA 5BVBA 4N6UA 1RSNA 2GEYA 2E2VA 3G713 4KT3B 1V74A 3KN4A 1RGGA 4LYLB 1NJI4 2Z77A 3K7CA 3SLUA 1RN7A 4PEJA 3GSPA 2FGTA 1W7CA 2CW9A 1FUTA 3FZWA 1T5YA 2XH9A 5IERA 3NBBA 1JBSA 3G8ZA 1EQKA 2V1LA 3JUQA 4EV5A 1W01A 1W6GA 2OCTA 3KE7A 6GSPA 1W02A 1EUIC 5AIFA 1B2MA 1Q40B 3BIRA 3KSPA 3TDGA 4XB5A 4FCMA 5M18A 3SOYA 1QAFA 3I0YA 1BUJA 2IYJA 3CCV3 3AMOB 2MF7A 2H0HA 1GS3A 1VQ63 1MGWA 1MWSA 1ULIB 2CFDA 2W6JH 4EW5A 3HI7A 3D4AA 4GB5A 5A0OB 1JN5A 1OGXA 1LXEA 1UDII 3FGYA 1IVXA 3H3HA 3K63A 2GXFA 5AI1A 3Q3FA 1B2XA 5AIHA 3JUOA 3DGYA 4NPBA 3CMA3 3PCSA 1AQZA 2GBWB 2RBIA 3FCSB 4XBTA 1GY5A 4NHFA 5ELJA 1HYFA 1I3FA 1OGZA 1GOUA 2XF3A 1GY6A 1WMPA 3X41A 1OUNA 3DM8A 4WYKB 1ZGXA 1BANA 1O7MB 5TGNA 3G4S3 4O3VA 1RNTA 5G1LA 3AGOA 3X3XA 1WTHA 3IMAB 2XFSA 5BU4A 1K9M4 5M1AA 4FMDA 2KF3A 1I0XA 5LC7A 1STFI 1IV9A 3NBRA 2PNCA 1LOWA 2W56B 3EE1A 5AIIA 2KF5A 2E2TA 2WGQA 2HMLB 4L8PA 1IK3A 1BUQA 5IG5A 1U5OA 3ZFZA 5DREA 1TIJA 3PZWA 1UGIA 3PCRA 3CC23 3G6E3 1S5AA 1X1WA 1FUSA 2GU1A 4K1UA 1IV7A 1DMNA 5FGOA 3J7Yd 5IG3A 4FCZA 1BSCA 4BTXA 4HM3B 1A67A 2F99A 2WOHA 7STDA 3OWSA 5IF6A 3VSYA 1FGQA 3G16A 2OQEC 2RCDA 3SYUA 2L4VA 4HKVB 3S67A 4KZ1A 2CFKA 1PY3A 1I2EA 1CH0A 1JV2B 1TUHA 1DVCA 3EQQB 1ROVA 1W5ZA 3D79A 1LNIA 1MOLA 2BU4A 3N9HA 4N6OB 5AYRB 3UL5A 1I8VA 3X40A 5IENA 1OACA 3ALAA 3HZPA 2B1XB 2K0MA 5FW5A 1IDPA 4R1KA 1TRQA 3EBTA 4EXRA 1EG9B 3NV0B 3CCJ3 5CXOA 2D42A 2CWTA 2XGLA 2GU3A 4FMAA 5KP1A 2C11A 1TRPA 4N3VA 1EA2A 2CC3A 3CCQ3 3WMDA 3CNMA 2BNGA 3UNLA 2QEX3 3PYJA 4ORLA 4H61A 1JB5A 3LTDA 1GD3A 2WGOA 3B8LA 3PGBA 2XEPA 5IW9A
chains in the Genus database with same CATH topology
1RGKA 1BAOA 1GMQA 1UCKA 1R4YA 1BRSA 5RNTA 1LOYA 2F5MA 1IYYA 1RMSA 2KAAA 1RN1A 1Q9EA 3BU4A 7GSPA 1RSNA 1BNSA 1RGGA 4BU4A 3WHOA 1B2UA 1MGRA 3KCHA 3HOHA 3GSPA 1B2ZA 1FUTA 1GOVA 4GSPA 1RTUA 8RNTA 1JBSA 1X1UA 1C54A 1I0VA 1JBRA 1BU4A 3DH2A 3URPA 1GMPA 6GSPA 3D5IA 1BRHA 1B2MA 1BOXA 3BIRA 1GOYA 4GHOA 4J5KA 5BIRA 1RGCA 1BNGA 1RGEA 1I2FA 3AHWA 1RDSA 1BRIA 1X1XA 1BUJA 2AAEA 1I2GA 1RN4A 4RNTA 5GSPA 1MGWA 1B3SA 1FZUA 1DETA 1YNVX 1UCLA 1RLSA 3D4AA 1G02A 4HAAA 2GSPA 1BNJA 3AHSA 1RNBA 3Q3FA 1B2XA 1LRAA 1LOVA 3DGYA 1AQZA 1T2HA 1GMRA 2RBIA 1I3IA 1BNIA 2F56A 1BVIA 1HYFA 1I3FA 1GOUA 3D5GA 1ZGXA 1BANA 2BIRA 2F4YA 2RNTA 1RNTA 3AGOA 5BU4A 1BNEA 1B21A 1I0XA 2KF3A 1BRNL 1LOWA 1BGSA 1TTOA 2KF5A 1RCKA 3WR2A 1PYLA 1A2PA 1YGWA 2F5WA 2KF4A 1BSAA 1SARA 1X1WA 1FUSA 9RNTA 2SARA 1GSPA 1BSCA 2C4BA 1UCIA 1DE3A 1AY7A 6RNTA 7RNTA 1JBTA 1BSDA 1RGLA 1B27A 1B20A 2KF6A 1BRGA 1X1YA 3SYUA 1UCJA 1BSBA 1T2IA 1PY3A 1I2EA 1BNFA 1CH0A 1I70A 1YVSA 1BSEA 2HOHA 3A5EA 4BIRA 1LNIA 2BU4A 1I8VA 1RGFA 1FYSA 1RHLA 2AADA 1FW7A 1BIRA 2ZA4A 1TRQA 1RCLA 4HOHA 1TRPA 3RNTA 3AGNA 1RGHA 5HOHA 1HZ1A 1B2SA 1RGAA 1BNRA 4J5GA 1BRKA 1BRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGK A;  1BAO A;  1GMQ A;  1UCK A;  1R4Y A;  1BRS A;  5RNT A;  1LOY A;  2F5M A;  1IYY A;  1RMS A;  2KAA A;  1RN1 A;  1Q9E A;  3BU4 A;  7GSP A;  1RSN A;  1BNS A;  1RGG A;  4BU4 A;  3WHO A;  1B2U A;  1MGR A;  3KCH A;  3HOH A;  3GSP A;  1B2Z A;  1FUT A;  1GOV A;  4GSP A;  1RTU A;  8RNT A;  1JBS A;  1X1U A;  1C54 A;  1I0V A;  1JBR A;  1BU4 A;  3DH2 A;  3URP A;  1GMP A;  6GSP A;  3D5I A;  1BRH A;  1B2M A;  1BOX A;  3BIR A;  1GOY A;  4GHO A;  4J5K A;  5BIR A;  1RGC A;  1BNG A;  1RGE A;  1I2F A;  3AHW A;  1RDS A;  1BRI A;  1X1X A;  1BUJ A;  2AAE A;  1I2G A;  1RN4 A;  4RNT A;  5GSP A;  1MGW A;  1B3S A;  1FZU A;  1DET A;  1YNV X;  1UCL A;  1RLS A;  3D4A A;  1G02 A;  4HAA A;  2GSP A;  1BNJ A;  3AHS A;  1RNB A;  3Q3F A;  1B2X A;  1LRA A;  1LOV A;  3DGY A;  1AQZ A;  1T2H A;  1GMR A;  2RBI A;  1I3I A;  1BNI A;  2F56 A;  1BVI A;  1HYF A;  1I3F A;  1GOU A;  3D5G A;  1ZGX A;  1BAN A;  2BIR A;  2F4Y A;  2RNT A;  1RNT A;  3AGO A;  5BU4 A;  1BNE A;  1B21 A;  1I0X A;  2KF3 A;  1BRN L;  1LOW A;  1BGS A;  1TTO A;  2KF5 A;  1RCK A;  3WR2 A;  1PYL A;  1A2P A;  1YGW A;  2F5W A;  2KF4 A;  1BSA A;  1SAR A;  1X1W A;  1FUS A;  9RNT A;  2SAR A;  1GSP A;  1BSC A;  2C4B A;  1UCI A;  1DE3 A;  1AY7 A;  6RNT A;  7RNT A;  1JBT A;  1BSD A;  1RGL A;  1B27 A;  1B20 A;  2KF6 A;  1BRG A;  1X1Y A;  3SYU A;  1UCJ A;  1BSB A;  1T2I A;  1PY3 A;  1I2E A;  1BNF A;  1CH0 A;  1I70 A;  1YVS A;  1BSE A;  2HOH A;  3A5E A;  4BIR A;  1LNI A;  2BU4 A;  1I8V A;  1RGF A;  1FYS A;  1RHL A;  2AAD A;  1FW7 A;  1BIR A;  2ZA4 A;  1TRQ A;  1RCL A;  4HOH A;  1TRP A;  3RNT A;  3AGN A;  1RGH A;  5HOH A;  1HZ1 A;  1B2S A;  1RGA A;  1BNR A;  4J5G A;  1BRK A;  1BRJ A; 
#chains in the Genus database with same CATH topology
 1RGK A;  1BAO A;  1UCK A;  1YIT 3;  3O8Y A;  1DYU A;  4LZI A;  2H0I A;  3EF8 A;  2KAA A;  4WFO A;  3BU4 A;  7GSP A;  1Z1S A;  1O7H B;  4TX4 A;  3DGM A;  3WHO A;  2F98 A;  2CFL A;  1AR0 A;  1MGR A;  1E3R A;  1IT8 A;  3KCH A;  2OTL 3;  3N54 B;  3OWY A;  3OV4 A;  3V99 A;  1CYU A;  2BMO B;  1QVG 2;  4BTW A;  2W0Q A;  1X1U A;  2IA7 A;  3EC9 A;  1LNH A;  3GZX B;  1CEW I;  3DH2 A;  5D82 A;  1IQX A;  3URP A;  1JN5 B;  1NNV A;  1QMA A;  1BRH A;  2L1S A;  3D5I A;  5BIR A;  5I97 A;  1MNL A;  4WWU C;  1RGC A;  1BNG A;  2Y74 A;  3AHW A;  1OF5 A;  3CNX A;  4XBX A;  1X1X A;  1UGH I;  2HMM B;  4HM2 B;  4XBY A;  2IMJ A;  3BND A;  4RNT A;  4X2H A;  5GSP A;  3T8U A;  3I55 3;  2XFT A;  1L5G B;  1RJO A;  2QIY A;  2Z6B A;  4NRE A;  4HAA A;  3FF2 A;  2OOV C;  1GD4 A;  3WA3 A;  1JJ2 2;  3AHS A;  1U8C B;  1KD1 4;  4N6V 0;  1LOV A;  5HGR A;  1SJW A;  2ML6 A;  5IG0 A;  2CKF B;  3RGR A;  3CCR 3;  1T2H A;  3MPH A;  5M19 A;  4STD A;  3NQZ A;  3QRD A;  3ZG0 A;  1BVI A;  1ZO2 A;  2ML5 A;  3D5G A;  3HII A;  3LT8 A;  2F4Y A;  5ELU A;  2RNT A;  5JPP A;  2K54 A;  1Q81 4;  1VQN 3;  1D6U A;  2P09 A;  2M7O A;  3BLZ A;  3D3L A;  2XGN A;  2XRX B;  3KII A;  3LXU X;  4JF8 A;  1OH0 A;  1TTO A;  1WQL B;  1HU9 A;  3STD A;  1YHQ 3;  4H3U A;  1JZO A;  3FH1 A;  3WR2 A;  3GZY B;  3F9S A;  1STD A;  4ILF A;  4RBN A;  3HIG A;  4HYZ A;  1YGW A;  4MJD A;  5DRV A;  4EBG A;  3MHE A;  2STD A;  1KWI A;  3EHC A;  2CFG A;  3SVA A;  1VQP 3;  1UW1 A;  3EJV A;  3HX8 A;  3MG1 A;  1DE3 A;  2D1W A;  2J8X B;  6RNT A;  7RNT A;  1ASK A;  3Q90 A;  4XM4 A;  1FGT A;  3BNB A;  2YFJ B;  2KF6 A;  4IIA A;  1BRG A;  1GY7 A;  1X1Y A;  1Y4K A;  2IUK A;  1M9G A;  4HBR A;  2XR8 B;  1KC8 4;  5LC6 A;  1G0T A;  3IJE B;  2CH9 A;  2HOH A;  2W9P A;  3LTC A;  4BIR A;  1E3V A;  3DGN A;  4J9A A;  1A90 A;  5JPU A;  1RGF A;  1US1 A;  4FMB A;  1FYS A;  1RHL A;  3DXO A;  4KFD A;  8CHO A;  1FUW A;  1N5P A;  2CIU A;  2BMQ B;  4FMC A;  3WOE B;  2ZDJ A;  4WP5 A;  1GYB A;  3F40 A;  2KCD A;  3OWU A;  1JKG B;  4RNY A;  2CWV A;  1PFP A;  2LQV A;  2WOF A;  3E99 A;  1LQG C;  1O7P B;  3NBJ A;  2LYX A;  1HZ1 A;  2JDI H;  5EQL A;  1W6C A;  2E2U A;  3LTA A;  1Q7H A;  2O9U X;  3VF1 A;  4J5G A;  3X42 A;  4CJN A;  1YNV X;  4HM6 B;  4HZB B;  4XDW A;  3GRD A;  3KSE D;  1JRQ A;  3CPO A;  3FLJ A;  3V98 A;  4OVM A;  4LGQ A;  2F5M A;  2W9Q A;  5AEW B;  4AEQ A;  1ZS7 A;  1RN1 A;  3EBY A;  1K28 A;  4R80 A;  4BTY A;  1BNS A;  2JQ5 A;  3NUV A;  4O8S A;  4BU4 A;  1Q40 A;  1B2U A;  1NWW A;  2MC8 A;  1FGR A;  1YJW 3;  3HOH A;  1N8R 4;  4N6T A;  1B2Z A;  3CCS 3;  2C10 A;  1GOV A;  3AMO A;  1ROA A;  1IVU A;  3QK9 A;  3CPW 2;  5KP4 A;  2BMR B;  4N6M A;  3FKA A;  1C54 A;  1I0V A;  2UGI A;  3K9M C;  1BU4 A;  1V58 A;  4N6L A;  1YJN 3;  3H51 A;  1AVL A;  1UI8 A;  1I2F A;  1NB3 I;  3T8N A;  1RDS A;  1YJ9 3;  1BRI A;  5G1K A;  2A15 A;  2AAE A;  3LML A;  1QJG A;  2IY2 A;  2XSH B;  2IUJ A;  1D6Y A;  3NHX A;  1Q86 4;  1B3S A;  4WYK A;  1TP6 A;  3S28 A;  2B24 B;  1DET A;  1UCL A;  1TJD A;  1G02 A;  4MEI A;  5AEU B;  3GZB A;  3OW2 2;  2RSX A;  4HZ9 B;  3DMC A;  1LRA A;  1LQM B;  5CF1 A;  3CCM 3;  2W56 A;  1K41 A;  1WNH A;  3CCL 3;  1RRL A;  1BNI A;  2HMO B;  4K90 B;  1RRH A;  4LMI A;  3SED A;  3UJM A;  3D9R A;  2YFI B;  2UUG C;  4K61 A;  1W00 A;  2BIR A;  1W6Y A;  2BT3 A;  4HJL B;  1M90 4;  4I5Q A;  4EYC A;  3FF0 A;  3DGL A;  1W2B 2;  1B21 A;  3F7S A;  4FCJ A;  4O2H A;  4U13 A;  1UUV B;  1VQL 3;  1BGS A;  5IEP A;  1K73 4;  4HM0 B;  4K1V A;  3WOD G;  1RCK A;  4IT7 A;  5BXQ A;  1NU3 A;  1PYL A;  3F8X A;  3Q2P A;  1A2P A;  2FXT A;  1SIH A;  1TFO A;  1IVV A;  1D6Z A;  1SAR A;  3MSO A;  3VGN A;  2HMK B;  3PXM A;  4R9L A;  1VZZ A;  4MMZ B;  1HKX A;  1GSP A;  2C4B A;  5EEO A;  1OHO A;  1SQW A;  2XSO B;  1JBT A;  1BSD A;  1YGE A;  1B27 A;  1B20 A;  1QAL A;  2GEX A;  3F7X A;  3NV0 A;  3KFQ C;  3MYT A;  3WA2 X;  3CME 3;  2CX1 A;  1O7G B;  1UCJ A;  5D83 A;  3JVC A;  1CQS A;  1BNF A;  1YVS A;  3A5E A;  1BSE A;  4G1M B;  3HK4 A;  1JB4 A;  1MWR A;  4HM4 B;  1CYV A;  1Q42 A;  1UI7 A;  2SBL A;  4BL3 A;  1VQK 3;  3SOA A;  3MG3 A;  2AAD A;  4KVH A;  5D81 A;  1O7W B;  2P0M A;  1M1X B;  2ZA4 A;  1G96 A;  1EEJ A;  3NX0 A;  3OXA A;  2ZL8 A;  3B7C A;  2Y73 A;  1FGO A;  3DY5 A;  3F14 A;  4HOH A;  3EN1 B;  4MMY B;  3V92 A;  3CCE 3;  3RNT A;  1Q82 4;  1OHP A;  3SXX A;  3UL6 A;  4RZM A;  4CCV A;  2W2C A;  1A2K A;  1RGH A;  1B2S A;  3U1W A;  3GZR A;  3S27 A;  1BNR A;  1BRK A;  4L7K A;  3M8C A;  1O7N B;  1NDO B;  1BRJ A;  4HM8 B;  5STD A;  1GMQ A;  2I9W A;  1BRS A;  3ER7 A;  2Z7A A;  3LTB A;  5RNT A;  1LOY A;  1N9J A;  1FGM A;  2UX0 A;  1QAK A;  2CHC A;  3ECF A;  4IPB A;  3EX9 A;  1N8Q A;  3GWR A;  4N6N B;  1YIJ 3;  1KQS 2;  1MWT A;  1NO3 A;  3I56 3;  2RGQ A;  2YX9 A;  3NM7 A;  4KFF A;  1N9E A;  5IEO A;  3RGA A;  2OOV A;  1VQM 3;  4KFE A;  2CFW A;  2W04 A;  1RKY A;  1UUG B;  1VQQ A;  1N5H A;  3LT9 A;  4XDV A;  1M1K 4;  2Z76 A;  4GSP A;  3BNC A;  1K8A 4;  1C7H A;  4HM1 B;  1RTU A;  8RNT A;  3MKI A;  3MG2 A;  3FG1 A;  3SX1 A;  1W4N A;  4LSO A;  3ZG5 A;  4HM5 B;  5IG4 A;  1KSI A;  1JBR A;  2QGU A;  1OCV A;  1R4C A;  1GMP A;  1SII A;  6STD A;  2QA4 3;  1BOX A;  4GHO A;  1GOY A;  4J5K A;  3EN8 A;  2OTJ 3;  4CPK A;  1RGE A;  1IT7 A;  4I4K A;  1ULJ B;  2WO0 A;  2R41 A;  4L8O A;  1I2G A;  1RN4 A;  3KZT A;  3S29 A;  1JNQ A;  2GBX B;  1DMM A;  1FZU A;  1ZX2 A;  3WDG B;  1RLS A;  5EVH A;  2GSP A;  3RDE A;  1AVK A;  1QVF 2;  1BNJ A;  3DZL A;  4MMX B;  3UB1 A;  1RNB A;  1WMO A;  3F8H A;  1VQ4 3;  1OF5 B;  3CU3 A;  4J8T A;  1IU7 A;  4AKY A;  4OUQ A;  1VQ8 3;  1GMR A;  2RFR A;  1I3I A;  3ROB A;  3T0U A;  3CC7 3;  2F56 A;  1ISK A;  2FNQ A;  2PZV A;  3CCU 3;  1IQY A;  5AIG A;  1IQ8 A;  2P38 A;  1S72 3;  5CLK A;  4EV2 A;  3KKG A;  1BNE A;  2P0X A;  3NXJ A;  4WHA A;  1PU4 A;  3L0R A;  1BRN L;  3Q1C A;  2ZHX B;  3EB8 A;  1AV4 A;  4EC6 A;  3G0K A;  1LVN A;  2F86 B;  3K5T A;  1MWU A;  1E97 A;  1UUW B;  1T3B A;  1SPU A;  2BHM A;  2KXG A;  2F5W A;  2KF4 A;  1BSA A;  5AYS C;  3IPT A;  3PS8 A;  4OK0 A;  1VQ7 3;  9RNT A;  4HVN A;  1A2V A;  1F8N A;  5KP3 A;  2SAR A;  4LEH A;  4X2O A;  3B4O A;  1DVD A;  1VQ5 3;  1JZD A;  2CG0 A;  1UCI A;  3X3Z A;  1AY7 A;  4DKI A;  3LZA A;  1TU5 A;  1JB2 A;  2BO9 B;  2OQE A;  3LH4 A;  1RGL A;  4O02 B;  1TFK A;  2HMJ B;  4QWT A;  3K0Z A;  1JKG A;  1VQ9 3;  2KRT A;  1BSB A;  1T2I A;  2CX0 A;  2W03 A;  4R4K A;  3A76 A;  4GL6 A;  4BL2 A;  1I70 A;  1EKM A;  3NM2 A;  4RNZ A;  3OX9 A;  3N8B A;  3LOY A;  1FW7 A;  1FA3 A;  1BIR A;  3MWZ A;  1DMQ A;  3U97 A;  1J2B A;  1OPY A;  2K3D A;  2O3O A;  2YFL B;  2CK3 H;  4JRF A;  1RCL A;  4Q53 A;  2CG1 A;  3X3Y A;  4CDL A;  5CF2 A;  3CC4 3;  2HMN B;  1WMN A;  1YI2 3;  3B4P A;  3NQY A;  3AGN A;  5CK6 A;  2H0G A;  1YVB I;  4ZM8 A;  3DGO A;  3WOF B;  5HOH A;  3JUM A;  2Q07 A;  1IVW A;  1V57 A;  2INX A;  1RGA A;  3DUK A;  1OHS A;  3BNE A;  3CXC 2;  4AKZ A;  3BB9 A;  2CWU A;  3LYG A;  4HM7 B;  3CD6 3;  1R4Y A;  1W2Z A;  1Q7Y 4;  2P05 A;  4FR9 A;  1LOX A;  3JUN A;  3S5C A;  1VQO 3;  3FG4 A;  3FG3 A;  1RMS A;  3GAX A;  5G2G A;  1NB5 I;  1IYY A;  2OWP A;  2R4I A;  1Q9E A;  3FSD A;  4R9K A;  5JBS A;  3JUP A;  5BVB A;  4N6U A;  1RSN A;  2GEY A;  2E2V A;  3G71 3;  4KT3 B;  1V74 A;  3KN4 A;  1RGG A;  4LYL B;  1NJI 4;  2Z77 A;  3K7C A;  3SLU A;  1RN7 A;  4PEJ A;  3GSP A;  2FGT A;  1W7C A;  2CW9 A;  1FUT A;  3FZW A;  1T5Y A;  2XH9 A;  5IER A;  3NBB A;  1JBS A;  3G8Z A;  1EQK A;  2V1L A;  3JUQ A;  4EV5 A;  1W01 A;  1W6G A;  2OCT A;  3KE7 A;  6GSP A;  1W02 A;  1EUI C;  5AIF A;  1B2M A;  1Q40 B;  3BIR A;  3KSP A;  3TDG A;  4XB5 A;  4FCM A;  5M18 A;  3SOY A;  1QAF A;  3I0Y A;  1BUJ A;  2IYJ A;  3CCV 3;  3AMO B;  2MF7 A;  2H0H A;  1GS3 A;  1VQ6 3;  1MGW A;  1MWS A;  1ULI B;  2CFD A;  2W6J H;  4EW5 A;  3HI7 A;  3D4A A;  4GB5 A;  5A0O B;  1JN5 A;  1OGX A;  1LXE A;  1UDI I;  3FGY A;  1IVX A;  3H3H A;  3K63 A;  2GXF A;  5AI1 A;  3Q3F A;  1B2X A;  5AIH A;  3JUO A;  3DGY A;  4NPB A;  3CMA 3;  3PCS A;  1AQZ A;  2GBW B;  2RBI A;  3FCS B;  4XBT A;  1GY5 A;  4NHF A;  5ELJ A;  1HYF A;  1I3F A;  1OGZ A;  1GOU A;  2XF3 A;  1GY6 A;  1WMP A;  3X41 A;  1OUN A;  3DM8 A;  4WYK B;  1ZGX A;  1BAN A;  1O7M B;  5TGN A;  3G4S 3;  4O3V A;  1RNT A;  5G1L A;  3AGO A;  3X3X A;  1WTH A;  3IMA B;  2XFS A;  5BU4 A;  1K9M 4;  5M1A A;  4FMD A;  2KF3 A;  1I0X A;  5LC7 A;  1STF I;  1IV9 A;  3NBR A;  2PNC A;  1LOW A;  2W56 B;  3EE1 A;  5AII A;  2KF5 A;  2E2T A;  2WGQ A;  2HML B;  4L8P A;  1IK3 A;  1BUQ A;  5IG5 A;  1U5O A;  3ZFZ A;  5DRE A;  1TIJ A;  3PZW A;  1UGI A;  3PCR A;  3CC2 3;  3G6E 3;  1S5A A;  1X1W A;  1FUS A;  2GU1 A;  4K1U A;  1IV7 A;  1DMN A;  5FGO A;  3J7Y d;  5IG3 A;  4FCZ A;  1BSC A;  4BTX A;  4HM3 B;  1A67 A;  2F99 A;  2WOH A;  7STD A;  3OWS A;  5IF6 A;  3VSY A;  1FGQ A;  3G16 A;  2OQE C;  2RCD A;  3SYU A;  2L4V A;  4HKV B;  3S67 A;  4KZ1 A;  2CFK A;  1PY3 A;  1I2E A;  1CH0 A;  1JV2 B;  1TUH A;  1DVC A;  3EQQ B;  1ROV A;  1W5Z A;  3D79 A;  1LNI A;  1MOL A;  2BU4 A;  3N9H A;  4N6O B;  5AYR B;  3UL5 A;  1I8V A;  3X40 A;  5IEN A;  1OAC A;  3ALA A;  3HZP A;  2B1X B;  2K0M A;  5FW5 A;  1IDP A;  4R1K A;  1TRQ A;  3EBT A;  4EXR A;  1EG9 B;  3NV0 B;  3CCJ 3;  5CXO A;  2D42 A;  2CWT A;  2XGL A;  2GU3 A;  4FMA A;  5KP1 A;  2C11 A;  1TRP A;  4N3V A;  1EA2 A;  2CC3 A;  3CCQ 3;  3WMD A;  3CNM A;  2BNG A;  3UNL A;  2QEX 3;  3PYJ A;  4ORL A;  4H61 A;  1JB5 A;  3LTD A;  1GD3 A;  2WGO A;  3B8L A;  3PGB A;  2XEP A;  5IW9 A; 
#chains in the Genus database with same CATH homology
 1RGK A;  1BAO A;  1GMQ A;  1UCK A;  1R4Y A;  1BRS A;  5RNT A;  1LOY A;  2F5M A;  1IYY A;  1RMS A;  2KAA A;  1RN1 A;  1Q9E A;  3BU4 A;  7GSP A;  1RSN A;  1BNS A;  1RGG A;  4BU4 A;  3WHO A;  1B2U A;  1MGR A;  3KCH A;  3HOH A;  3GSP A;  1B2Z A;  1FUT A;  1GOV A;  4GSP A;  1RTU A;  8RNT A;  1JBS A;  1X1U A;  1C54 A;  1I0V A;  1JBR A;  1BU4 A;  3DH2 A;  3URP A;  1GMP A;  6GSP A;  3D5I A;  1BRH A;  1B2M A;  1BOX A;  3BIR A;  1GOY A;  4GHO A;  4J5K A;  5BIR A;  1RGC A;  1BNG A;  1RGE A;  1I2F A;  3AHW A;  1RDS A;  1BRI A;  1X1X A;  1BUJ A;  2AAE A;  1I2G A;  1RN4 A;  4RNT A;  5GSP A;  1MGW A;  1B3S A;  1FZU A;  1DET A;  1YNV X;  1UCL A;  1RLS A;  3D4A A;  1G02 A;  4HAA A;  2GSP A;  1BNJ A;  3AHS A;  1RNB A;  3Q3F A;  1B2X A;  1LRA A;  1LOV A;  3DGY A;  1AQZ A;  1T2H A;  1GMR A;  2RBI A;  1I3I A;  1BNI A;  2F56 A;  1BVI A;  1HYF A;  1I3F A;  1GOU A;  3D5G A;  1ZGX A;  1BAN A;  2BIR A;  2F4Y A;  2RNT A;  1RNT A;  3AGO A;  5BU4 A;  1BNE A;  1B21 A;  1I0X A;  2KF3 A;  1BRN L;  1LOW A;  1BGS A;  1TTO A;  2KF5 A;  1RCK A;  3WR2 A;  1PYL A;  1A2P A;  1YGW A;  2F5W A;  2KF4 A;  1BSA A;  1SAR A;  1X1W A;  1FUS A;  9RNT A;  2SAR A;  1GSP A;  1BSC A;  2C4B A;  1UCI A;  1DE3 A;  1AY7 A;  6RNT A;  7RNT A;  1JBT A;  1BSD A;  1RGL A;  1B27 A;  1B20 A;  2KF6 A;  1BRG A;  1X1Y A;  3SYU A;  1UCJ A;  1BSB A;  1T2I A;  1PY3 A;  1I2E A;  1BNF A;  1CH0 A;  1I70 A;  1YVS A;  1BSE A;  2HOH A;  3A5E A;  4BIR A;  1LNI A;  2BU4 A;  1I8V A;  1RGF A;  1FYS A;  1RHL A;  2AAD A;  1FW7 A;  1BIR A;  2ZA4 A;  1TRQ A;  1RCL A;  4HOH A;  1TRP A;  3RNT A;  3AGN A;  1RGH A;  5HOH A;  1HZ1 A;  1B2S A;  1RGA A;  1BNR A;  4J5G A;  1BRK A;  1BRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...