3BIRA

Disecting histidine interactions in ribonuclease t1 by asn and gln substitutions
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITNTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords RIBONUCLEASE T1
publication title Dissecting histidine interactions of ribonuclease T1 with asparagine and glutamine replacements: analysis of double mutant cycles at one position.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3birA00
2F5WA 1MGWA 1BSCA 1GMRA 1LOYA 8RNTA 1BRHA 1I2GA 3D5IA 3URPA 1BNEA 1UCKA 1I0VA 1RCLA 1BU4A 1ZGXA 1X1WA 5GSPA 1B20A 1FUSA 1RGGA 2BIRA 1FW7A 1BVIA 1I2FA 1BNJA 3DGYA 3WHOA 1I70A 2BU4A 1RNBA 3AGNA 2RNTA 1RGEA 1BGSA 1I2EA 1FUTA 1TTOA 2F5MA 2KF6A 4J5GA 1AQZA 1T2HA 2AADA 1B2SA 1RTUA 1RGAA 1BRKA 1CH0A 1SARA 1GOYA 1X1YA 2KF3A 1B2UA 3D4AA 5RNTA 4HAAA 2KF5A 3HOHA 1DETA 1I3IA 4HOHA 5BIRA 1GSPA 1B27A 1BNGA 4BIRA 3A5EA 2KAAA 3AHWA 2HOHA 1LOVA 1B3SA 1YNVX 1PYLA 1BNFA 1RDSA 1RGKA 9RNTA 1IYYA 3DH2A 1BRSA 1TRPA 1FZUA 1RNTA 1LOWA 1BRGA 1RCKA 1RN1A 1X1UA 4GSPA 5BU4A 3RNTA 1GMPA 1GOVA 3D5GA 3BIRA 1JBTA 1LNIA 1A2PA 1I8VA 1MGRA 1RN4A 1BRIA 1RHLA 1TRQA 1UCLA 1HYFA 1RLSA 2GSPA 1BNRA 1GOUA 4BU4A 1BSDA 4RNTA 1I0XA 1LRAA 1C54A 3GSPA 3KCHA 1BIRA 2F4YA 1GMQA 1BOXA 4J5KA 1B2ZA 2F56A 1BNIA 1B21A 1BNSA 7GSPA 1PY3A 2AAEA 4GHOA 1BRNL 1RGHA 1JBRA 6GSPA 6RNTA 1RMSA 3AGOA 2KF4A 3Q3FA 1BRJA 1G02A 1I3FA 3AHSA 1HZ1A 3BU4A 3SYUA 7RNTA 2SARA 1BSAA 1R4YA 1DE3A 1BANA 1RSNA 1UCJA 1B2XA 1UCIA 1X1XA 1T2IA 1RGFA 1JBSA 2C4BA 2ZA4A 3WR2A 5HOHA 1RGLA 1BUJA 1BSEA 1BSBA 1YGWA 1Q9EA 1B2MA 1BAOA 1RGCA 1AY7A 1YVSA 1FYSA 2RBIA
chains in the Genus database with same CATH superfamily
1WMOA 3FG4A 3CPOA 1LOYA 3FF0A 3NBBA 4FMDA 5AYRB 5LC6A 1D6YA 1BNEA 1RJOA 2J8XB 3B4PA 5HGRA 3T8UA 1I0VA 2KRTA 4O02B 3JVCA 2GU1A 3IJEB 1FUSA 2CFKA 1I2FA 3CCM3 5AEUB 1YI23 3HX8A 3SX1A 1OHPA 2QEX3 2BHMA 2ML6A 1JB2A 3KFQC 3S5CA 3ZFZA 4RBNA 1I70A 1RNBA 2RNTA 3MG2A 4KZ1A 1ISKA 1IQ8A 3WODG 4N6OB 2F5MA 1IVWA 3Q1CA 1T2HA 2AADA 1RTUA 3B8LA 3OV4A 1JB4A 5KP3A 2C11A 4HM0B 1A67A 2WOFA 5M18A 5EVHA 1CH0A 3ROBA 2XFSA 1M1K4 1W6CA 1X1YA 5CF1A 3WMDA 3GZYB 3CPW2 2KF3A 4L8PA 1DMQA 2XEPA 3D4AA 5RNTA 1FGMA 2HMOB 2W9PA 4K1VA 1OHOA 3HOHA 1DETA 3GRDA 4HOHA 5BIRA 1BNGA 3EE1A 3OX9A 3CCL3 1DVDA 1LQMB 2KAAA 5IEPA 1IU7A 1Q864 1CEWI 1V57A 4WHAA 1OHSA 1YJ93 1IVXA 2CK3H 4KFEA 1FA3A 1JZDA 1STFI 2Z7AA 3H3HA 4CPKA 3VGNA 1IYYA 2LYXA 2K3DA 1TRPA 1GY5A 2IY2A 1FZUA 1AVLA 2W0QA 3D3LA 3O8YA 2Y74A 4FCJA 4QWTA 2ZL8A 3GWRA 2XSOB 2SBLA 3CNMA 3FLJA 3RGAA 1K8A4 3BIRA 3LXUX 2O9UX 1EUIC 1TRQA 1RN4A 1U5OA 1BRIA 1UDII 1FGRA 2P05A 3DGLA 4BTWA 1HYFA 1BNRA 4EW5A 1GOUA 2W2CA 3SOYA 1S5AA 3LYGA 4BU4A 4WWUC 2CFDA 2P0MA 3FZWA 3N8BA 3PCSA 2I9WA 1S723 3GZBA 1NNVA 3IMAB 1A2KA 5AIGA 3VF1A 3WDGB 1NJI4 4MMXB 4XBYA 4EC6A 1JNQA 2XFTA 1BOXA 3K9MC 1VQQA 2F56A 3PGBA 4JF8A 3MKIA 4L7KA 5IF6A 3G0KA 1W02A 1BNSA 4J9AA 3X40A 1K9M4 2RCDA 4HJLB 3SOAA 1PU4A 3MHEA 3NQYA 3QK9A 4BL3A 3KIIA 1STDA 4R9KA 2IUKA 3B4OA 1NO3A 6GSPA 3HK4A 1A2VA 3G8ZA 2GXFA 4J8TA 1M904 2O3OA 2UUGC 4R1KA 1BRJA 3JUQA 3U1WA 2BMOB 3V92A 4OUQA 3T8NA 1TU5A 1IQXA 1W01A 3WA3A 2CFGA 2CWVA 1CYUA 1JN5A 3NUVA 4RZMA 4XDWA 5CLKA 3X41A 5IG0A 3SVAA 2HMJB 3V99A 3HZPA 1G96A 2H0HA 1IV7A 1EKMA 1W4NA 2UX0A 2Z77A 3X42A 1O7PB 4XDVA 3I553 3FKAA 1MWTA 3S27A 5HOHA 3CCQ3 3EJVA 5AEWB 4I5QA 4O3VA 1BSEA 2A15A 1RN7A 5EQLA 4LGQA 1O7GB 1IT8A 3Q90A 8RNTA 4ZM8A 1BRHA 1I2GA 2XR8B 3NV0A 4LEHA 3CC43 1UCKA 1C7HA 1X1WA 5AIIA 1UGHI 1MOLA 2CIUA 1AVKA 1BVIA 1U8CB 2INXA 3EHCA 2KXGA 2W56A 5ELJA 3G713 1VQN3 1BNJA 2YFLB 4KT3B 3WHOA 1ULIB 1RGEA 3L0RA 5M19A 3CCS3 3CCU3 4WYKA 1FUTA 6STDA 2CW9A 1W6GA 4J5GA 1VQK3 3UL6A 1B2SA 1OCVA 1HU9A 3F9SA 3NQZA 2P09A 1Y4KA 4GL6A 3LTDA 2H0IA 1FUWA 1K41A 1RGAA 3D79A 4FR9A 3G16A 1CYVA 4JRFA 1IVUA 4WP5A 4KFDA 1JJ22 2GBWB 3F8XA 3KKGA 3A5EA 3F40A 3N54B 5FGOA 5ELUA 2HOHA 1JN5B 1SQWA 1LXEA 1B3SA 2YX9A 4FMBA 4N6TA 4R4KA 3PZWA 4I4KA 1W2B2 3NHXA 1BNFA 1N9JA 3ECFA 2OQEA 1IQYA 1E3RA 1NDOB 1YJW3 3UB1A 4MMZB 1M9GA 2MC8A 3S28A 2D42A 1YJN3 1ZS7A 1D6UA 2MF7A 4XBTA 1LOWA 1T5YA 5I97A 3K63A 2OOVA 1QVG2 1GMPA 3I0YA 4KVHA 2E2VA 1JBTA 1LNIA 4HVNA 1A2PA 1MGRA 3LMLA 1GY7A 5IW9A 1TP6A 1RLSA 4EXRA 2K54A 1ZO2A 4OK0A 5D82A 1Q7Y4 4N6MA 1RKYA 7STDA 3FH1A 4NPBA 3NV0B 1LRAA 1VQ83 1ROAA 3GSPA 1BIRA 2F4YA 1TIJA 2B1XB 3OW22 1VQ73 1OH0A 1B2ZA 2CWUA 3FG3A 5CK6A 1VQ93 1B21A 3BB9A 3PYJA 3DGNA 7GSPA 4FCZA 2Y73A 4K1UA 4NHFA 3UL5A 1NB3I 1LVNA 2W56B 1BRNL 3K7CA 1GD4A 2CHCA 3B7CA 3CCJ3 3DGMA 3F7XA 6RNTA 2IYJA 2Z6BA 3DGOA 2KF4A 4WYKB 3MG3A 1M1XB 1VQM3 1G02A 2UGIA 1UI7A 3AHSA 1KC84 1HZ1A 3WOFB 3A76A 1VQ63 4HM8B 3OWUA 3KN4A 2SARA 4G1MB 1MNLA 2GEYA 1BSAA 1R4YA 4ILFA 3EBTA 3S67A 1IDPA 1MWRA 1V58A 1X1XA 1UCJA 1UCIA 4PEJA 1QAKA 2IA7A 1T2IA 1DYUA 1SIIA 3LTAA 4HKVB 1JBSA 2C4BA 1W6YA 2RSXA 2ZA4A 3KZTA 5KP4A 1WNHA 2BT3A 3EF8A 4MJDA 1TJDA 1JRQA 1YHQ3 4AKYA 1BSBA 4H61A 1N5PA 1OUNA 5IENA 1VQL3 1O7HB 4N6V0 1FGOA 1YVSA 1J2BA 1UUGB 2RBIA 3IPTA 3G6E3 2QA43 2F5WA 1BSCA 2QGUA 4LMIA 3RGRA 1BUQA 4HZ9B 4N3VA 2HMLB 1BU4A 2XF3A 3FSDA 1ZGXA 4X2HA 4HM2B 3HIIA 5GSPA 4K90B 3PS8A 2GEXA 5STDA 3TDGA 4FMCA 4MMYB 2BO9B 3DY5A 2LQVA 3FCSB 3LOYA 3CC23 3KSED 2GU3A 1VQP3 1Q42A 1T3BA 2WGQA 5AI1A 2BU4A 1OGXA 2W9QA 3JUOA 1BGSA 4LYLB 3LT9A 2ZDJA 2ML5A 2KF6A 4WFOA 4IPBA 2CFLA 3OXAA 1ROVA 2R41A 1MWSA 1N9EA 4R9LA 2HMMB 1EA2A 3CNXA 3F7SA 1BRKA 3MG1A 4HM3B 3EC9A 3D9RA 2FNQA 3NM7A 1GYBA 1R4CA 1KQS2 1JKGA 2WO0A 1GD3A 5IERA 1F8NA 3WA2X 2E2TA 1B2UA 1W00A 3CU3A 3CXC2 2JDIH 1I3IA 2XSHB 5DRVA 5G2GA 3F8HA 1B27A 1EEJA 4BIRA 2QIYA 5IEOA 1OPYA 1ZX2A 1K28A 2M7OA 3ZG5A 3GZRA 4DKIA 1JZOA 3X3ZA 3RDEA 1YNVX 4LZIA 1IV9A 5G1KA 2B24B 3UJMA 3VSYA 1RGKA 2CX0A 1OF5A 2E2UA 2ZHXB 3DH2A 9RNTA 1VQ53 1BRSA 3JUPA 3Q2PA 1RNTA 4TX4A 1RCKA 4HM4B 2F86B 3CCE3 1W2ZA 3PXMA 3FGYA 1AR0A 2K0MA 3DM8A 2OOVC 3STDA 1I8VA 2IMJA 1RHLA 3BNBA 3I563 2HMKB 3NXJA 4OVMA 2IUJA 3U97A 4HM7B 4RNTA 3EB8A 1I0XA 2CKFB 1C54A 1N8QA 3DUKA 5JBSA 5CXOA 2BNGA 3KCHA 1DMMA 1O7MB 3JUNA 1N5HA 1MWUA 2PNCA 4J5KA 1IVVA 3NBJA 3NM2A 4CDLA 1BNIA 1EG9B 3E99A 1PY3A 2AAEA 5FW5A 3SEDA 4U13A 1RGHA 1UUVB 1LOXA 3LTBA 3K5TA 2OCTA 4NREA 1O7WB 2CH9A 2L4VA 4XM4A 1RMSA 4O8SA 3KE7A 3Q3FA 3X3YA 5TGNA 4BTXA 3K0ZA 4STDA 1RRLA 3LH4A 3SYUA 1FGTA 1NU3A 1YGEA 3HI7A 1US1A 5LC7A 5AIHA 1Q40A 1WMPA 1N8R4 1BANA 2OTL3 3N9HA 3MYTA 5BVBA 1JKGB 2L1SA 4GB5A 5CF2A 1G0TA 1RRHA 4HM1B 5AIFA 3FF2A 1UUWB 1L5GB 3HIGA 1O7NB 1TUHA 3QRDA 4BL2A 1BUJA 1TFKA 3MWZA 1BAOA 1AY7A 2JQ5A 1QMAA 1YIT3 2W03A 8CHOA 1FYSA 2STDA 4H3UA 1UW1A 2BMQB 1MGWA 4HBRA 1GMRA 1OF5B 3V98A 1YVBI 3URPA 3D5IA 3H51A 4KFFA 1QJGA 1RCLA 4FCMA 5IG4A 3FG1A 4LSOA 1KWIA 5A0OB 3GAXA 1Q824 1B20A 1W7CA 1RGGA 2BIRA 3EN8A 4L8OA 3ER7A 1TFOA 5D81A 3ZG0A 5IG5A 3J7Yd 1SJWA 1FW7A 3G4S3 4XBXA 1VZZA 1PFPA 3OWSA 4ORLA 3CC73 2XH9A 3DGYA 3GZXB 1WMNA 2V1LA 1Q7HA 4N6NB 3AGNA 4X2OA 3CME3 2CG1A 3LTCA 4HM6B 1I2EA 1TTOA 1HKXA 3DZLA 2GBXB 4BTYA 1QALA 1AQZA 3M8CA 4HYZA 3SLUA 1K734 3LT8A 2CFWA 3WOEB 1FGQA 3CMA3 1A90A 2R4IA 5AYSC 3F14A 1NB5I 4R80A 4N6UA 3ALAA 1SARA 1GOYA 1QAFA 4RNYA 4HAAA 1SIHA 2KF5A 3NBRA 1GSPA 1D6ZA 1JB5A 1LNHA 4EBGA 1E97A 2CWTA 3AHWA 4RNZA 1GS3A 1KSIA 2RGQA 3AMOA 2CX1A 5BXQA 3CCR3 1KD14 1LOVA 1Q40B 3DXOA 4EV5A 1PYLA 1RDSA 3LZAA 1WQLB 4IIAA 4HM5B 4N6LA 5DREA 4HZBB 5M1AA 2OTJ3 5KP1A 1ASKA 3BLZA 2XRXB 3OWYA 1W5ZA 1RN1A 1BRGA 1X1UA 2WOHA 4GSPA 3CCV3 5IG3A 5BU4A 3RNTA 1IT7A 1V74A 1VQ43 3JUMA 2P38A 2FXTA 1GOVA 3D5GA 1OGZA 2P0XA 1CQSA 3UNLA 3S29A 1DMNA 1UI8A 3EBYA 1UCLA 2GSPA 3EN1B 1E3VA 4EYCA 1BSDA 2H0GA 3EX9A 1QVF2 2Q07A 5JPUA 1ULJB 1GMQA 4CJNA 1IK3A 5EEOA 2OWPA 1SPUA 2W6JH 4FMAA 3PCRA 4GHOA 3BNEA 1NWWA 1UGIA 1EQKA 1JBRA 2OQEC 2Z76A 5D83A 2FGTA 3BNCA 2CG0A 3NX0A 2CC3A 3AGOA 1DVCA 4AKZA 2F99A 5JPPA 1OACA 1I3FA 3T0UA 3BU4A 1JV2B 2PZVA 5G1LA 2XGNA 7RNTA 3KSPA 4O2HA 3SXXA 4XB5A 2F98A 2WGOA 1DE3A 2YFJB 3MSOA 4CCVA 1RSNA 1B2XA 2RFRA 4K61A 2D1WA 1RGFA 1WTHA 4MEIA 1LQGC 1AV4A 2C10A 4IT7A 1GY6A 3WR2A 2W04A 4AEQA 2BMRB 1VQO3 1Z1SA 1Q814 1RGLA 3EQQB 4Q53A 2XGLA 2YFIB 1YGWA 1Q9EA 2KCDA 1RGCA 3AMOB 3MPHA 1B2MA 4EV2A 3DMCA 3BNDA 2HMNB 3CD63 1YIJ3 3X3XA
chains in the Genus database with same CATH topology
2F5WA 1MGWA 1BSCA 1GMRA 1LOYA 8RNTA 1BRHA 1I2GA 3D5IA 3URPA 1BNEA 1UCKA 1I0VA 1RCLA 1BU4A 1ZGXA 1X1WA 5GSPA 1B20A 1FUSA 1RGGA 2BIRA 1FW7A 1BVIA 1I2FA 1BNJA 3DGYA 3WHOA 1I70A 2BU4A 1RNBA 3AGNA 2RNTA 1RGEA 1BGSA 1I2EA 1FUTA 1TTOA 2F5MA 2KF6A 4J5GA 1AQZA 1T2HA 2AADA 1B2SA 1RTUA 1RGAA 1BRKA 1CH0A 1SARA 1GOYA 1X1YA 2KF3A 1B2UA 3D4AA 5RNTA 4HAAA 2KF5A 3HOHA 1DETA 1I3IA 4HOHA 5BIRA 1GSPA 1B27A 1BNGA 4BIRA 3A5EA 2KAAA 3AHWA 2HOHA 1LOVA 1B3SA 1YNVX 1PYLA 1BNFA 1RDSA 1RGKA 9RNTA 1IYYA 3DH2A 1BRSA 1TRPA 1FZUA 1RNTA 1LOWA 1BRGA 1RCKA 1RN1A 1X1UA 4GSPA 5BU4A 3RNTA 1GMPA 1GOVA 3D5GA 3BIRA 1JBTA 1LNIA 1A2PA 1I8VA 1MGRA 1RN4A 1BRIA 1RHLA 1TRQA 1UCLA 1HYFA 1RLSA 2GSPA 1BNRA 1GOUA 4BU4A 1BSDA 4RNTA 1I0XA 1LRAA 1C54A 3GSPA 3KCHA 1BIRA 2F4YA 1GMQA 1BOXA 4J5KA 1B2ZA 2F56A 1BNIA 1B21A 1BNSA 7GSPA 1PY3A 2AAEA 4GHOA 1BRNL 1RGHA 1JBRA 6GSPA 6RNTA 1RMSA 3AGOA 2KF4A 3Q3FA 1BRJA 1G02A 1I3FA 3AHSA 1HZ1A 3BU4A 3SYUA 7RNTA 2SARA 1BSAA 1R4YA 1DE3A 1BANA 1RSNA 1UCJA 1B2XA 1UCIA 1X1XA 1T2IA 1RGFA 1JBSA 2C4BA 2ZA4A 3WR2A 5HOHA 1RGLA 1BUJA 1BSEA 1BSBA 1YGWA 1Q9EA 1B2MA 1BAOA 1RGCA 1AY7A 1YVSA 1FYSA 2RBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5W A;  1MGW A;  1BSC A;  1GMR A;  1LOY A;  8RNT A;  1BRH A;  1I2G A;  3D5I A;  3URP A;  1BNE A;  1UCK A;  1I0V A;  1RCL A;  1BU4 A;  1ZGX A;  1X1W A;  5GSP A;  1B20 A;  1FUS A;  1RGG A;  2BIR A;  1FW7 A;  1BVI A;  1I2F A;  1BNJ A;  3DGY A;  3WHO A;  1I70 A;  2BU4 A;  1RNB A;  3AGN A;  2RNT A;  1RGE A;  1BGS A;  1I2E A;  1FUT A;  1TTO A;  2F5M A;  2KF6 A;  4J5G A;  1AQZ A;  1T2H A;  2AAD A;  1B2S A;  1RTU A;  1RGA A;  1BRK A;  1CH0 A;  1SAR A;  1GOY A;  1X1Y A;  2KF3 A;  1B2U A;  3D4A A;  5RNT A;  4HAA A;  2KF5 A;  3HOH A;  1DET A;  1I3I A;  4HOH A;  5BIR A;  1GSP A;  1B27 A;  1BNG A;  4BIR A;  3A5E A;  2KAA A;  3AHW A;  2HOH A;  1LOV A;  1B3S A;  1YNV X;  1PYL A;  1BNF A;  1RDS A;  1RGK A;  9RNT A;  1IYY A;  3DH2 A;  1BRS A;  1TRP A;  1FZU A;  1RNT A;  1LOW A;  1BRG A;  1RCK A;  1RN1 A;  1X1U A;  4GSP A;  5BU4 A;  3RNT A;  1GMP A;  1GOV A;  3D5G A;  3BIR A;  1JBT A;  1LNI A;  1A2P A;  1I8V A;  1MGR A;  1RN4 A;  1BRI A;  1RHL A;  1TRQ A;  1UCL A;  1HYF A;  1RLS A;  2GSP A;  1BNR A;  1GOU A;  4BU4 A;  1BSD A;  4RNT A;  1I0X A;  1LRA A;  1C54 A;  3GSP A;  3KCH A;  1BIR A;  2F4Y A;  1GMQ A;  1BOX A;  4J5K A;  1B2Z A;  2F56 A;  1BNI A;  1B21 A;  1BNS A;  7GSP A;  1PY3 A;  2AAE A;  4GHO A;  1BRN L;  1RGH A;  1JBR A;  6GSP A;  6RNT A;  1RMS A;  3AGO A;  2KF4 A;  3Q3F A;  1BRJ A;  1G02 A;  1I3F A;  3AHS A;  1HZ1 A;  3BU4 A;  3SYU A;  7RNT A;  2SAR A;  1BSA A;  1R4Y A;  1DE3 A;  1BAN A;  1RSN A;  1UCJ A;  1B2X A;  1UCI A;  1X1X A;  1T2I A;  1RGF A;  1JBS A;  2C4B A;  2ZA4 A;  3WR2 A;  5HOH A;  1RGL A;  1BUJ A;  1BSE A;  1BSB A;  1YGW A;  1Q9E A;  1B2M A;  1BAO A;  1RGC A;  1AY7 A;  1YVS A;  1FYS A;  2RBI A; 
#chains in the Genus database with same CATH topology
 1WMO A;  3FG4 A;  3CPO A;  1LOY A;  3FF0 A;  3NBB A;  4FMD A;  5AYR B;  5LC6 A;  1D6Y A;  1BNE A;  1RJO A;  2J8X B;  3B4P A;  5HGR A;  3T8U A;  1I0V A;  2KRT A;  4O02 B;  3JVC A;  2GU1 A;  3IJE B;  1FUS A;  2CFK A;  1I2F A;  3CCM 3;  5AEU B;  1YI2 3;  3HX8 A;  3SX1 A;  1OHP A;  2QEX 3;  2BHM A;  2ML6 A;  1JB2 A;  3KFQ C;  3S5C A;  3ZFZ A;  4RBN A;  1I70 A;  1RNB A;  2RNT A;  3MG2 A;  4KZ1 A;  1ISK A;  1IQ8 A;  3WOD G;  4N6O B;  2F5M A;  1IVW A;  3Q1C A;  1T2H A;  2AAD A;  1RTU A;  3B8L A;  3OV4 A;  1JB4 A;  5KP3 A;  2C11 A;  4HM0 B;  1A67 A;  2WOF A;  5M18 A;  5EVH A;  1CH0 A;  3ROB A;  2XFS A;  1M1K 4;  1W6C A;  1X1Y A;  5CF1 A;  3WMD A;  3GZY B;  3CPW 2;  2KF3 A;  4L8P A;  1DMQ A;  2XEP A;  3D4A A;  5RNT A;  1FGM A;  2HMO B;  2W9P A;  4K1V A;  1OHO A;  3HOH A;  1DET A;  3GRD A;  4HOH A;  5BIR A;  1BNG A;  3EE1 A;  3OX9 A;  3CCL 3;  1DVD A;  1LQM B;  2KAA A;  5IEP A;  1IU7 A;  1Q86 4;  1CEW I;  1V57 A;  4WHA A;  1OHS A;  1YJ9 3;  1IVX A;  2CK3 H;  4KFE A;  1FA3 A;  1JZD A;  1STF I;  2Z7A A;  3H3H A;  4CPK A;  3VGN A;  1IYY A;  2LYX A;  2K3D A;  1TRP A;  1GY5 A;  2IY2 A;  1FZU A;  1AVL A;  2W0Q A;  3D3L A;  3O8Y A;  2Y74 A;  4FCJ A;  4QWT A;  2ZL8 A;  3GWR A;  2XSO B;  2SBL A;  3CNM A;  3FLJ A;  3RGA A;  1K8A 4;  3BIR A;  3LXU X;  2O9U X;  1EUI C;  1TRQ A;  1RN4 A;  1U5O A;  1BRI A;  1UDI I;  1FGR A;  2P05 A;  3DGL A;  4BTW A;  1HYF A;  1BNR A;  4EW5 A;  1GOU A;  2W2C A;  3SOY A;  1S5A A;  3LYG A;  4BU4 A;  4WWU C;  2CFD A;  2P0M A;  3FZW A;  3N8B A;  3PCS A;  2I9W A;  1S72 3;  3GZB A;  1NNV A;  3IMA B;  1A2K A;  5AIG A;  3VF1 A;  3WDG B;  1NJI 4;  4MMX B;  4XBY A;  4EC6 A;  1JNQ A;  2XFT A;  1BOX A;  3K9M C;  1VQQ A;  2F56 A;  3PGB A;  4JF8 A;  3MKI A;  4L7K A;  5IF6 A;  3G0K A;  1W02 A;  1BNS A;  4J9A A;  3X40 A;  1K9M 4;  2RCD A;  4HJL B;  3SOA A;  1PU4 A;  3MHE A;  3NQY A;  3QK9 A;  4BL3 A;  3KII A;  1STD A;  4R9K A;  2IUK A;  3B4O A;  1NO3 A;  6GSP A;  3HK4 A;  1A2V A;  3G8Z A;  2GXF A;  4J8T A;  1M90 4;  2O3O A;  2UUG C;  4R1K A;  1BRJ A;  3JUQ A;  3U1W A;  2BMO B;  3V92 A;  4OUQ A;  3T8N A;  1TU5 A;  1IQX A;  1W01 A;  3WA3 A;  2CFG A;  2CWV A;  1CYU A;  1JN5 A;  3NUV A;  4RZM A;  4XDW A;  5CLK A;  3X41 A;  5IG0 A;  3SVA A;  2HMJ B;  3V99 A;  3HZP A;  1G96 A;  2H0H A;  1IV7 A;  1EKM A;  1W4N A;  2UX0 A;  2Z77 A;  3X42 A;  1O7P B;  4XDV A;  3I55 3;  3FKA A;  1MWT A;  3S27 A;  5HOH A;  3CCQ 3;  3EJV A;  5AEW B;  4I5Q A;  4O3V A;  1BSE A;  2A15 A;  1RN7 A;  5EQL A;  4LGQ A;  1O7G B;  1IT8 A;  3Q90 A;  8RNT A;  4ZM8 A;  1BRH A;  1I2G A;  2XR8 B;  3NV0 A;  4LEH A;  3CC4 3;  1UCK A;  1C7H A;  1X1W A;  5AII A;  1UGH I;  1MOL A;  2CIU A;  1AVK A;  1BVI A;  1U8C B;  2INX A;  3EHC A;  2KXG A;  2W56 A;  5ELJ A;  3G71 3;  1VQN 3;  1BNJ A;  2YFL B;  4KT3 B;  3WHO A;  1ULI B;  1RGE A;  3L0R A;  5M19 A;  3CCS 3;  3CCU 3;  4WYK A;  1FUT A;  6STD A;  2CW9 A;  1W6G A;  4J5G A;  1VQK 3;  3UL6 A;  1B2S A;  1OCV A;  1HU9 A;  3F9S A;  3NQZ A;  2P09 A;  1Y4K A;  4GL6 A;  3LTD A;  2H0I A;  1FUW A;  1K41 A;  1RGA A;  3D79 A;  4FR9 A;  3G16 A;  1CYV A;  4JRF A;  1IVU A;  4WP5 A;  4KFD A;  1JJ2 2;  2GBW B;  3F8X A;  3KKG A;  3A5E A;  3F40 A;  3N54 B;  5FGO A;  5ELU A;  2HOH A;  1JN5 B;  1SQW A;  1LXE A;  1B3S A;  2YX9 A;  4FMB A;  4N6T A;  4R4K A;  3PZW A;  4I4K A;  1W2B 2;  3NHX A;  1BNF A;  1N9J A;  3ECF A;  2OQE A;  1IQY A;  1E3R A;  1NDO B;  1YJW 3;  3UB1 A;  4MMZ B;  1M9G A;  2MC8 A;  3S28 A;  2D42 A;  1YJN 3;  1ZS7 A;  1D6U A;  2MF7 A;  4XBT A;  1LOW A;  1T5Y A;  5I97 A;  3K63 A;  2OOV A;  1QVG 2;  1GMP A;  3I0Y A;  4KVH A;  2E2V A;  1JBT A;  1LNI A;  4HVN A;  1A2P A;  1MGR A;  3LML A;  1GY7 A;  5IW9 A;  1TP6 A;  1RLS A;  4EXR A;  2K54 A;  1ZO2 A;  4OK0 A;  5D82 A;  1Q7Y 4;  4N6M A;  1RKY A;  7STD A;  3FH1 A;  4NPB A;  3NV0 B;  1LRA A;  1VQ8 3;  1ROA A;  3GSP A;  1BIR A;  2F4Y A;  1TIJ A;  2B1X B;  3OW2 2;  1VQ7 3;  1OH0 A;  1B2Z A;  2CWU A;  3FG3 A;  5CK6 A;  1VQ9 3;  1B21 A;  3BB9 A;  3PYJ A;  3DGN A;  7GSP A;  4FCZ A;  2Y73 A;  4K1U A;  4NHF A;  3UL5 A;  1NB3 I;  1LVN A;  2W56 B;  1BRN L;  3K7C A;  1GD4 A;  2CHC A;  3B7C A;  3CCJ 3;  3DGM A;  3F7X A;  6RNT A;  2IYJ A;  2Z6B A;  3DGO A;  2KF4 A;  4WYK B;  3MG3 A;  1M1X B;  1VQM 3;  1G02 A;  2UGI A;  1UI7 A;  3AHS A;  1KC8 4;  1HZ1 A;  3WOF B;  3A76 A;  1VQ6 3;  4HM8 B;  3OWU A;  3KN4 A;  2SAR A;  4G1M B;  1MNL A;  2GEY A;  1BSA A;  1R4Y A;  4ILF A;  3EBT A;  3S67 A;  1IDP A;  1MWR A;  1V58 A;  1X1X A;  1UCJ A;  1UCI A;  4PEJ A;  1QAK A;  2IA7 A;  1T2I A;  1DYU A;  1SII A;  3LTA A;  4HKV B;  1JBS A;  2C4B A;  1W6Y A;  2RSX A;  2ZA4 A;  3KZT A;  5KP4 A;  1WNH A;  2BT3 A;  3EF8 A;  4MJD A;  1TJD A;  1JRQ A;  1YHQ 3;  4AKY A;  1BSB A;  4H61 A;  1N5P A;  1OUN A;  5IEN A;  1VQL 3;  1O7H B;  4N6V 0;  1FGO A;  1YVS A;  1J2B A;  1UUG B;  2RBI A;  3IPT A;  3G6E 3;  2QA4 3;  2F5W A;  1BSC A;  2QGU A;  4LMI A;  3RGR A;  1BUQ A;  4HZ9 B;  4N3V A;  2HML B;  1BU4 A;  2XF3 A;  3FSD A;  1ZGX A;  4X2H A;  4HM2 B;  3HII A;  5GSP A;  4K90 B;  3PS8 A;  2GEX A;  5STD A;  3TDG A;  4FMC A;  4MMY B;  2BO9 B;  3DY5 A;  2LQV A;  3FCS B;  3LOY A;  3CC2 3;  3KSE D;  2GU3 A;  1VQP 3;  1Q42 A;  1T3B A;  2WGQ A;  5AI1 A;  2BU4 A;  1OGX A;  2W9Q A;  3JUO A;  1BGS A;  4LYL B;  3LT9 A;  2ZDJ A;  2ML5 A;  2KF6 A;  4WFO A;  4IPB A;  2CFL A;  3OXA A;  1ROV A;  2R41 A;  1MWS A;  1N9E A;  4R9L A;  2HMM B;  1EA2 A;  3CNX A;  3F7S A;  1BRK A;  3MG1 A;  4HM3 B;  3EC9 A;  3D9R A;  2FNQ A;  3NM7 A;  1GYB A;  1R4C A;  1KQS 2;  1JKG A;  2WO0 A;  1GD3 A;  5IER A;  1F8N A;  3WA2 X;  2E2T A;  1B2U A;  1W00 A;  3CU3 A;  3CXC 2;  2JDI H;  1I3I A;  2XSH B;  5DRV A;  5G2G A;  3F8H A;  1B27 A;  1EEJ A;  4BIR A;  2QIY A;  5IEO A;  1OPY A;  1ZX2 A;  1K28 A;  2M7O A;  3ZG5 A;  3GZR A;  4DKI A;  1JZO A;  3X3Z A;  3RDE A;  1YNV X;  4LZI A;  1IV9 A;  5G1K A;  2B24 B;  3UJM A;  3VSY A;  1RGK A;  2CX0 A;  1OF5 A;  2E2U A;  2ZHX B;  3DH2 A;  9RNT A;  1VQ5 3;  1BRS A;  3JUP A;  3Q2P A;  1RNT A;  4TX4 A;  1RCK A;  4HM4 B;  2F86 B;  3CCE 3;  1W2Z A;  3PXM A;  3FGY A;  1AR0 A;  2K0M A;  3DM8 A;  2OOV C;  3STD A;  1I8V A;  2IMJ A;  1RHL A;  3BNB A;  3I56 3;  2HMK B;  3NXJ A;  4OVM A;  2IUJ A;  3U97 A;  4HM7 B;  4RNT A;  3EB8 A;  1I0X A;  2CKF B;  1C54 A;  1N8Q A;  3DUK A;  5JBS A;  5CXO A;  2BNG A;  3KCH A;  1DMM A;  1O7M B;  3JUN A;  1N5H A;  1MWU A;  2PNC A;  4J5K A;  1IVV A;  3NBJ A;  3NM2 A;  4CDL A;  1BNI A;  1EG9 B;  3E99 A;  1PY3 A;  2AAE A;  5FW5 A;  3SED A;  4U13 A;  1RGH A;  1UUV B;  1LOX A;  3LTB A;  3K5T A;  2OCT A;  4NRE A;  1O7W B;  2CH9 A;  2L4V A;  4XM4 A;  1RMS A;  4O8S A;  3KE7 A;  3Q3F A;  3X3Y A;  5TGN A;  4BTX A;  3K0Z A;  4STD A;  1RRL A;  3LH4 A;  3SYU A;  1FGT A;  1NU3 A;  1YGE A;  3HI7 A;  1US1 A;  5LC7 A;  5AIH A;  1Q40 A;  1WMP A;  1N8R 4;  1BAN A;  2OTL 3;  3N9H A;  3MYT A;  5BVB A;  1JKG B;  2L1S A;  4GB5 A;  5CF2 A;  1G0T A;  1RRH A;  4HM1 B;  5AIF A;  3FF2 A;  1UUW B;  1L5G B;  3HIG A;  1O7N B;  1TUH A;  3QRD A;  4BL2 A;  1BUJ A;  1TFK A;  3MWZ A;  1BAO A;  1AY7 A;  2JQ5 A;  1QMA A;  1YIT 3;  2W03 A;  8CHO A;  1FYS A;  2STD A;  4H3U A;  1UW1 A;  2BMQ B;  1MGW A;  4HBR A;  1GMR A;  1OF5 B;  3V98 A;  1YVB I;  3URP A;  3D5I A;  3H51 A;  4KFF A;  1QJG A;  1RCL A;  4FCM A;  5IG4 A;  3FG1 A;  4LSO A;  1KWI A;  5A0O B;  3GAX A;  1Q82 4;  1B20 A;  1W7C A;  1RGG A;  2BIR A;  3EN8 A;  4L8O A;  3ER7 A;  1TFO A;  5D81 A;  3ZG0 A;  5IG5 A;  3J7Y d;  1SJW A;  1FW7 A;  3G4S 3;  4XBX A;  1VZZ A;  1PFP A;  3OWS A;  4ORL A;  3CC7 3;  2XH9 A;  3DGY A;  3GZX B;  1WMN A;  2V1L A;  1Q7H A;  4N6N B;  3AGN A;  4X2O A;  3CME 3;  2CG1 A;  3LTC A;  4HM6 B;  1I2E A;  1TTO A;  1HKX A;  3DZL A;  2GBX B;  4BTY A;  1QAL A;  1AQZ A;  3M8C A;  4HYZ A;  3SLU A;  1K73 4;  3LT8 A;  2CFW A;  3WOE B;  1FGQ A;  3CMA 3;  1A90 A;  2R4I A;  5AYS C;  3F14 A;  1NB5 I;  4R80 A;  4N6U A;  3ALA A;  1SAR A;  1GOY A;  1QAF A;  4RNY A;  4HAA A;  1SIH A;  2KF5 A;  3NBR A;  1GSP A;  1D6Z A;  1JB5 A;  1LNH A;  4EBG A;  1E97 A;  2CWT A;  3AHW A;  4RNZ A;  1GS3 A;  1KSI A;  2RGQ A;  3AMO A;  2CX1 A;  5BXQ A;  3CCR 3;  1KD1 4;  1LOV A;  1Q40 B;  3DXO A;  4EV5 A;  1PYL A;  1RDS A;  3LZA A;  1WQL B;  4IIA A;  4HM5 B;  4N6L A;  5DRE A;  4HZB B;  5M1A A;  2OTJ 3;  5KP1 A;  1ASK A;  3BLZ A;  2XRX B;  3OWY A;  1W5Z A;  1RN1 A;  1BRG A;  1X1U A;  2WOH A;  4GSP A;  3CCV 3;  5IG3 A;  5BU4 A;  3RNT A;  1IT7 A;  1V74 A;  1VQ4 3;  3JUM A;  2P38 A;  2FXT A;  1GOV A;  3D5G A;  1OGZ A;  2P0X A;  1CQS A;  3UNL A;  3S29 A;  1DMN A;  1UI8 A;  3EBY A;  1UCL A;  2GSP A;  3EN1 B;  1E3V A;  4EYC A;  1BSD A;  2H0G A;  3EX9 A;  1QVF 2;  2Q07 A;  5JPU A;  1ULJ B;  1GMQ A;  4CJN A;  1IK3 A;  5EEO A;  2OWP A;  1SPU A;  2W6J H;  4FMA A;  3PCR A;  4GHO A;  3BNE A;  1NWW A;  1UGI A;  1EQK A;  1JBR A;  2OQE C;  2Z76 A;  5D83 A;  2FGT A;  3BNC A;  2CG0 A;  3NX0 A;  2CC3 A;  3AGO A;  1DVC A;  4AKZ A;  2F99 A;  5JPP A;  1OAC A;  1I3F A;  3T0U A;  3BU4 A;  1JV2 B;  2PZV A;  5G1L A;  2XGN A;  7RNT A;  3KSP A;  4O2H A;  3SXX A;  4XB5 A;  2F98 A;  2WGO A;  1DE3 A;  2YFJ B;  3MSO A;  4CCV A;  1RSN A;  1B2X A;  2RFR A;  4K61 A;  2D1W A;  1RGF A;  1WTH A;  4MEI A;  1LQG C;  1AV4 A;  2C10 A;  4IT7 A;  1GY6 A;  3WR2 A;  2W04 A;  4AEQ A;  2BMR B;  1VQO 3;  1Z1S A;  1Q81 4;  1RGL A;  3EQQ B;  4Q53 A;  2XGL A;  2YFI B;  1YGW A;  1Q9E A;  2KCD A;  1RGC A;  3AMO B;  3MPH A;  1B2M A;  4EV2 A;  3DMC A;  3BND A;  2HMN B;  3CD6 3;  1YIJ 3;  3X3X A; 
#chains in the Genus database with same CATH homology
 2F5W A;  1MGW A;  1BSC A;  1GMR A;  1LOY A;  8RNT A;  1BRH A;  1I2G A;  3D5I A;  3URP A;  1BNE A;  1UCK A;  1I0V A;  1RCL A;  1BU4 A;  1ZGX A;  1X1W A;  5GSP A;  1B20 A;  1FUS A;  1RGG A;  2BIR A;  1FW7 A;  1BVI A;  1I2F A;  1BNJ A;  3DGY A;  3WHO A;  1I70 A;  2BU4 A;  1RNB A;  3AGN A;  2RNT A;  1RGE A;  1BGS A;  1I2E A;  1FUT A;  1TTO A;  2F5M A;  2KF6 A;  4J5G A;  1AQZ A;  1T2H A;  2AAD A;  1B2S A;  1RTU A;  1RGA A;  1BRK A;  1CH0 A;  1SAR A;  1GOY A;  1X1Y A;  2KF3 A;  1B2U A;  3D4A A;  5RNT A;  4HAA A;  2KF5 A;  3HOH A;  1DET A;  1I3I A;  4HOH A;  5BIR A;  1GSP A;  1B27 A;  1BNG A;  4BIR A;  3A5E A;  2KAA A;  3AHW A;  2HOH A;  1LOV A;  1B3S A;  1YNV X;  1PYL A;  1BNF A;  1RDS A;  1RGK A;  9RNT A;  1IYY A;  3DH2 A;  1BRS A;  1TRP A;  1FZU A;  1RNT A;  1LOW A;  1BRG A;  1RCK A;  1RN1 A;  1X1U A;  4GSP A;  5BU4 A;  3RNT A;  1GMP A;  1GOV A;  3D5G A;  3BIR A;  1JBT A;  1LNI A;  1A2P A;  1I8V A;  1MGR A;  1RN4 A;  1BRI A;  1RHL A;  1TRQ A;  1UCL A;  1HYF A;  1RLS A;  2GSP A;  1BNR A;  1GOU A;  4BU4 A;  1BSD A;  4RNT A;  1I0X A;  1LRA A;  1C54 A;  3GSP A;  3KCH A;  1BIR A;  2F4Y A;  1GMQ A;  1BOX A;  4J5K A;  1B2Z A;  2F56 A;  1BNI A;  1B21 A;  1BNS A;  7GSP A;  1PY3 A;  2AAE A;  4GHO A;  1BRN L;  1RGH A;  1JBR A;  6GSP A;  6RNT A;  1RMS A;  3AGO A;  2KF4 A;  3Q3F A;  1BRJ A;  1G02 A;  1I3F A;  3AHS A;  1HZ1 A;  3BU4 A;  3SYU A;  7RNT A;  2SAR A;  1BSA A;  1R4Y A;  1DE3 A;  1BAN A;  1RSN A;  1UCJ A;  1B2X A;  1UCI A;  1X1X A;  1T2I A;  1RGF A;  1JBS A;  2C4B A;  2ZA4 A;  3WR2 A;  5HOH A;  1RGL A;  1BUJ A;  1BSE A;  1BSB A;  1YGW A;  1Q9E A;  1B2M A;  1BAO A;  1RGC A;  1AY7 A;  1YVS A;  1FYS A;  2RBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...