3BIRA

Disecting histidine interactions in ribonuclease t1 by asn and gln substitutions
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITNTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting histidine interactions of ribonuclease T1 with asparagine and glutamine replacements: analysis of double mutant cycles at one position.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endonuclease
molecule keywords RIBONUCLEASE T1
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3birA00
1B21A 1I0XA 2C4BA 3AGNA 1LOWA 3WHOA 2ZA4A 5RNTA 3HOHA 1YNVX 1BNIA 4J5GA 1PYLA 1GOUA 3DGYA 1BGSA 5BU4A 1RCLA 1T2HA 1UCLA 2KF3A 1SARA 1BOXA 1RGCA 1TRQA 1BRSA 1BAOA 1B2SA 1BU4A 1RGLA 1RGHA 2BU4A 1GMQA 2AAEA 3AHSA 1X1UA 1YGWA 1BNJA 1BNFA 1RMSA 2RBIA 2SARA 1GOYA 2KF4A 1JBSA 3GSPA 1DE3A 1X1WA 9RNTA 1T2IA 8RNTA 1BRIA 1BNRA 1Q9EA 2F5WA 1FUTA 1A2PA 1B27A 1BVIA 1I0VA 1X1YA 6RNTA 1RNBA 1BRHA 4GHOA 1AQZA 3KCHA 7GSPA 1X1XA 1I70A 1RGGA 1UCKA 1DETA 3D5IA 1UCIA 1RN1A 2AADA 1BNEA 1RHLA 3BIRA 1MGWA 3AGOA 1FW7A 1CH0A 1RNTA 1I3IA 1RLSA 5HOHA 2KF6A 3SYUA 3BU4A 1I2FA 3DH2A 1FUSA 1BSEA 4HOHA 1BNSA 1RGKA 2KF5A 1GOVA 1B20A 3D4AA 1I8VA 1PY3A 3AHWA 4HAAA 1HZ1A 1I2EA 1B3SA 1HYFA 1RGFA 1BIRA 1RTUA 1TTOA 7RNTA 1B2UA 3D5GA 1JBTA 4RNTA 2F4YA 1JBRA 1BSAA 1GSPA 1RGEA 3Q3FA 1AY7A 1MGRA 2BIRA 5BIRA 2GSPA 1YVSA 2F5MA 4BU4A 1RCKA 1BRKA 1BRJA 3URPA 1ZGXA 1LOVA 3WR2A 1BSCA 1BSBA 2HOHA 1RN4A 6GSPA 2RNTA 1RGAA 1IYYA 4GSPA 1LOYA 1RDSA 1BSDA 1GMRA 1I2GA 3A5EA 1RSNA 1B2MA 4J5KA 1I3FA 1LRAA 1FYSA 2F56A 1R4YA 1BRGA 1G02A 5GSPA 1B2ZA 3RNTA 1C54A 1BNGA 1TRPA 1BUJA 1FZUA 1B2XA 1BRNL 1BANA 1LNIA 1UCJA 2KAAA 1GMPA 4BIRA
chains in the Genus database with same CATH superfamily
1B21A 1W6CA 4IT7A 4NHFA 4HM1B 4CDLA 2GU1A 1TU5A 1BNIA 1W01A 1PYLA 4QWTA 1STFI 4WYKB 3EQQB 2Q07A 1IVWA 1VQ63 5IG0A 3DGYA 4MMXB 5ELUA 1UCLA 2KF3A 4XBXA 2PZVA 1VQP3 1UW1A 1BOXA 1TRQA 3ZG5A 4EYCA 1BU4A 2XR8B 4RNZA 2BU4A 4X2HA 3PZWA 1X1UA 1EUIC 3IPTA 1BNFA 1RMSA 2SARA 1VQ43 2YFLB 3JUQA 5AEUB 5DREA 3WMDA 2XRXB 1BNRA 5IW9A 1YI23 4O2HA 1N5PA 2CH9A 4WWUC 1A2PA 2WOHA 4K1VA 1I0VA 4HBRA 5AYRB 1PFPA 1WNHA 3N8BA 1ZX2A 4GHOA 1AQZA 1JB2A 3NQZA 1VQQA 4EV5A 3IJEB 4R4KA 4R80A 1VQ83 3MWZA 1UCIA 1RN1A 1K9M4 1TFKA 4WP5A 3Q1CA 3AGOA 4JF8A 2E2VA 5BVBA 1D6UA 3K0ZA 4LMIA 3A76A 2KXGA 1OF5B 1TJDA 1RLSA 1EEJA 4L8OA 3I0YA 1NO3A 3SYUA 2O3OA 2FXTA 1VQ53 1K734 1BSEA 1IT7A 2L1SA 3EF8A 3CMA3 3CCS3 2W9QA 3WOEB 3NQYA 1KSIA 1RGKA 2KF5A 8CHOA 5KP4A 1IT8A 2ZDJA 1UUGB 1I8VA 2ML6A 3SLUA 2CFDA 4FCJA 4WYKA 1UUVB 1B3SA 1TUHA 2XH9A 4MEIA 3VF1A 3F7XA 3GWRA 3CU3A 2F4YA 1JBRA 2GEYA 1T5YA 1JKGA 4N6UA 1L5GB 5IERA 2OQEC 2BIRA 5DRVA 4O3VA 2OQEA 2BNGA 4LYLB 2BMQB 2OCTA 3O8YA 3Q2PA 3DGLA 5AIGA 5BIRA 3OX9A 4FMDA 4N6MA 3S27A 1YVSA 3DGNA 3I563 3OW22 1JKGB 1GY7A 4HM5B 1OHPA 2R41A 1HKXA 2CKFB 1LOVA 1KC84 2XSOB 2BT3A 3BB9A 1EA2A 1RN4A 2WO0A 2CFWA 3CNXA 3NBJA 3LMLA 4BL2A 2RNTA 2CWTA 1YIJ3 1JZOA 1OACA 4GSPA 2XF3A 2HMMB 3FZWA 1RDSA 1GMRA 2KRTA 3A5EA 4MMYB 2B1XB 5AIHA 1RSNA 4R9LA 5D81A 5G1LA 1QVF2 1YJ93 1AV4A 1IVUA 1GY5A 1AVKA 3FF2A 5LC6A 3G6E3 3STDA 1EQKA 2J8XB 3BNEA 5I97A 1F8NA 2OOVA 1TRPA 1JNQA 1BUJA 3HX8A 2CFKA 2IY2A 2SBLA 3ROBA 3WA3A 1SIIA 3FH1A 1QJGA 4XM4A 3CCJ3 2F98A 2RSXA 1DVCA 2H0IA 2XFSA 4N6TA 5M1AA 3X3ZA 4AKYA 1Q824 3FCSB 3RGRA 2C4BA 3AGNA 1LOWA 3EE1A 1NWWA 2D42A 3GZBA 4BTXA 3G8ZA 3HOHA 4FMAA 5RNTA 1MWTA 3LZAA 4BTYA 4K90B 3BNDA 1KWIA 1RRHA 3KZTA 1IVXA 1SARA 3D79A 3H51A 3F9SA 4N6LA 2XFTA 2Z77A 3KE7A 4AKZA 3FF0A 1BAOA 3B4PA 1RGHA 2AAEA 5M19A 1ROVA 2GU3A 3K63A 1U5OA 1WMNA 3ECFA 3G713 2C10A 1JBSA 1G96A 3DXOA 3GSPA 1X1WA 4WHAA 9RNTA 2OOVC 2ZL8A 1T2IA 1U8CB 1WTHA 2FNQA 1EG9B 4BL3A 1M9GA 3NV0B 3FLJA 3CD63 1MOLA 1YJW3 1ROAA 2CK3H 1Q814 6RNTA 1CYUA 3QRDA 3PGBA 4J8TA 1LQMB 3DMCA 1ZO2A 3EB8A 1UCKA 1RGGA 3GZRA 4EXRA 2WGOA 3X42A 3G4S3 1VQO3 2AADA 3CCR3 2W04A 3CCU3 3LOYA 4KFDA 1FGQA 3QK9A 1O7MB 3BIRA 3PCSA 4HZBB 4J9AA 3SXXA 3CCV3 4AEQA 1M1XB 3UJMA 3CC43 4X2OA 4U13A 1FUWA 1FW7A 1CH0A 4LGQA 1W02A 1QMAA 4HM0B 2UUGC 3Q90A 1I3IA 1OHSA 3CC23 1RRLA 2INXA 3JVCA 1NB5I 3MG1A 1O7NB 3BU4A 3DH2A 2IYJA 2W03A 1Q7Y4 1VZZA 3KIIA 3DGMA 4G1MB 5ELJA 4XBYA 1E3RA 3FGYA 4JRFA 4MJDA 1Q864 2D1WA 3HZPA 5AIFA 4CPKA 4ZM8A 4HJLB 1B20A 1IQXA 5HGRA 1ULJB 4HAAA 1IQYA 3MYTA 1W2ZA 5EQLA 2OTL3 1QAFA 3OWSA 1UDII 1DYUA 1W2B2 2YFIB 1UGHI 1RGFA 1BIRA 1RTUA 1N8QA 2XEPA 3NUVA 3CCL3 5IF6A 3L0RA 4ORLA 3JUPA 1FA3A 5CLKA 5G1KA 1BSAA 1RGEA 2Z6BA 1AY7A 3TDGA 1ISKA 3EJVA 2GSPA 2B24B 2F5MA 1BRKA 1IK3A 1K41A 3PXMA 2CW9A 3DY5A 3V99A 4HKVB 1BSCA 2IUJA 4H61A 1Q40B 1FGOA 4DKIA 5JPUA 1QVG2 1RGAA 2GBXB 3N9HA 1N9EA 2RCDA 4KZ1A 1OPYA 1LOYA 1LOXA 4KT3B 1G0TA 1BSDA 4N6OB 1Z1SA 2E2TA 2V1LA 1V58A 4NPBA 5JBSA 1M1K4 1I3FA 2WGQA 1JN5B 3HIGA 2GEXA 3MPHA 5IG5A 4KFFA 1V57A 1YIT3 1QAKA 1NJI4 5AEWB 5GSPA 3LTBA 1W6GA 1GD3A 1FZUA 3UB1A 2K0MA 2BO9B 4TX4A 4BIRA 2HMKB 2W9PA 2QIYA 3WHOA 3B7CA 1C7HA 2MC8A 1WMPA 2W6JH 3LT8A 2HMOB 3BLZA 1BGSA 1RCLA 1T2HA 2BMRB 3EHCA 4FMCA 2P38A 1JRQA 3F8XA 2O9UX 4FCMA 3VGNA 1BRSA 1RGLA 3NXJA 1W5ZA 4O8SA 1R4CA 3AHSA 1OUNA 5AYSC 3NHXA 1M904 1DMNA 3AMOB 1YGWA 2IMJA 1BNJA 2RBIA 2YX9A 4LEHA 1GOYA 2HMJB 2KF4A 1DE3A 3ALAA 4HM4B 3K5TA 3B8LA 1JJ22 1V74A 4STDA 4EBGA 2HMLB 2CHCA 1BRIA 1Q9EA 4I4KA 2OTJ3 1UGIA 1FUTA 1B27A 5FW5A 1JV2B 1X1YA 1GYBA 5D83A 3DM8A 1AVLA 2CFLA 1LNHA 1X1XA 2CG0A 1I70A 1W4NA 5IENA 3D5IA 3MSOA 3I553 3CC73 1NDOB 2HMNB 3X3XA 4OK0A 1Q7HA 3T8NA 2QGUA 1MGWA 3E99A 2CG1A 1E97A 3LTAA 4OVMA 3MG3A 1S723 4RBNA 1FGTA 1SPUA 1IQ8A 3MHEA 1O7GB 2CX1A 1I2FA 2W0QA 1FUSA 4FMBA 3GZXB 4MMZB 5AIIA 4HYZA 4EC6A 1IDPA 1BUQA 2P0XA 2M7OA 4HOHA 1D6ZA 2H0GA 5CK6A 1VQL3 1CYVA 1DMMA 5JPPA 1OGXA 3KFQC 1MWRA 1STDA 3D4AA 1A90A 1PY3A 3AHWA 2OWPA 1HZ1A 1NU3A 3LYGA 1I2EA 2IA7A 2CWVA 5LC7A 1HYFA 1TP6A 3ZG0A 7RNTA 1B2UA 4IPBA 2MF7A 4GB5A 4N3VA 5KP1A 1GSPA 1FGMA 1LVNA 3JUOA 3K7CA 3Q3FA 4R9KA 1DMQA 1YVBI 3HI7A 1J2BA 3DGOA 3F14A 1N9JA 2P09A 3AMOA 1A67A 1OHOA 3NV0A 5G2GA 2K54A 3JUNA 3V98A 1KQS2 3G16A 5KP3A 2BMOB 3EBTA 4H3UA 3MKIA 1ZGXA 1HU9A 2GBWB 3OWUA 4XDVA 3WR2A 3KKGA 1RKYA 2HOHA 3U1WA 2W2CA 1MNLA 2QEX3 3G0KA 3NBBA 3S67A 3UL6A 3EBYA 5CXOA 3CNMA 1SQWA 2ML5A 4K1UA 4CJNA 2I9WA 2RGQA 1KD14 2BHMA 1WMOA 4NREA 1YJN3 3MG2A 2Z7AA 2LYXA 1LRAA 3VSYA 2F56A 1R4YA 1BRGA 1US1A 1G02A 3OV4A 3RNTA 1A2VA 3LH4A 3U97A 3FG1A 4EV2A 1N5HA 2A15A 3JUMA 4HM8B 4XBTA 1OGZA 1B2XA 4FCZA 2Z76A 5EVHA 3S29A 1VQ73 4CCVA 1E3VA 3CCQ3 3CME3 1LNIA 1UCJA 3NBRA 3OWYA 1O7WB 2KAAA 2YFJB 1VQK3 3RDEA 6GSPA 2CC3A 3UL5A 1OCVA 2XGNA 1I0XA 5IG3A 1JB4A 5TGNA 3T0UA 2JQ5A 3WA2X 2ZA4A 1TIJA 1CEWI 2GXFA 2KCDA 1YNVX 2P05A 4GL6A 4J5GA 5FGOA 5IEOA 3RGAA 1GOUA 1W00A 3GAXA 5BXQA 2XGLA 3CCE3 1LQGC 5BU4A 1O7PB 3WDGB 1GD4A 3KSPA 3X3YA 5IG4A 1MWUA 1NNVA 2WOFA 2E2UA 5M18A 1AR0A 1RGCA 4N6NB 1W7CA 1B2SA 3EN8A 4ILFA 1UI8A 2K3DA 1GMQA 2W56A 4HM6B 3X40A 3M8CA 1SJWA 3FG3A 1VQN3 3DZLA 3SOAA 1O7HB 3BNBA 2LQVA 3PCRA 5STDA 1D6YA 6STDA 2RFRA 3ER7A 8RNTA 4BTWA 2F5WA 1BVIA 3X41A 3IMAB 1RNBA 1BRHA 1PU4A 4RNYA 1JZDA 3T8UA 4I5QA 3KCHA 1WQLB 7GSPA 1N8R4 1UI7A 1DETA 3KSED 4HM7B 3K9MC 4IIAA 2XSHB 1K8A4 1VQM3 4HM3B 1BNEA 3HK4A 4Q53A 1ASKA 2Y73A 3F40A 3PS8A 2IUKA 3SVAA 1RHLA 3EC9A 3GRDA 1K28A 2STDA 1ZS7A 3FG4A 5CF2A 1IV7A 3UNLA 4RZMA 3ZFZA 4HZ9B 1VQ93 1RNTA 4FR9A 3F8HA 3FKAA 3NM2A 5HOHA 2KF6A 1IU7A 2CWUA 1ULIB 3D3LA 3DUKA 1UUWB 1GS3A 1BNSA 1EKMA 1YGEA 3CXC2 3CPOA 3SEDA 1RN7A 2PNCA 1MWSA 4K61A 1RJOA 3LTCA 3N54B 1GOVA 2CIUA 5IEPA 3NM7A 2P0MA 2H0HA 3OXAA 2ZHXB 4XDWA 5D82A 3EN1B 1W6YA 2R4IA 4R1KA 2CFGA 1TTOA 3LT9A 4L8PA 3D5GA 1JBTA 4RNTA 5EEOA 3SOYA 1LXEA 4WFOA 3WOFB 2UGIA 1DVDA 3CCM3 1JB5A 3D9RA 3CPW2 3GZYB 1MGRA 2W56B 4KVHA 4O02B 1QALA 1SIHA 4L7KA 2F86B 1A2KA 1OH0A 4OUQA 4BU4A 1RCKA 1FGRA 3V92A 5AI1A 2F99A 1BRJA 4HM2B 3URPA 5CF1A 1IV9A 1BSBA 1CQSA 7STDA 1Q42A 2QA43 1T3BA 4N6V0 3BNCA 3S5CA 1JN5A 4EW5A 1Y4KA 2C11A 1IYYA 5A0OB 3J7Yd 1I2GA 3LXUX 3PYJA 1B2MA 3S28A 4J5KA 4XB5A 1Q40A 4HVNA 2Y74A 2FGTA 1GY6A 4PEJA 1FYSA 1OF5A 1S5AA 2UX0A 1TFOA 3HIIA 1B2ZA 3NX0A 4LSOA 4LZIA 3KN4A 3H3HA 1BNGA 1C54A 1NB3I 2CX0A 2JDIH 3WODG 1BRNL 3SX1A 1YHQ3 1BANA 3EX9A 4KFEA 3FSDA 1IVVA 2L4VA 3F7SA 1GMPA 3B4OA 3LTDA
chains in the Genus database with same CATH topology
1B21A 1I0XA 2C4BA 3AGNA 1LOWA 3WHOA 2ZA4A 5RNTA 3HOHA 1YNVX 1BNIA 4J5GA 1PYLA 1GOUA 3DGYA 1BGSA 5BU4A 1RCLA 1T2HA 1UCLA 2KF3A 1SARA 1BOXA 1RGCA 1TRQA 1BRSA 1BAOA 1B2SA 1BU4A 1RGLA 1RGHA 2BU4A 1GMQA 2AAEA 3AHSA 1X1UA 1YGWA 1BNJA 1BNFA 1RMSA 2RBIA 2SARA 1GOYA 2KF4A 1JBSA 3GSPA 1DE3A 1X1WA 9RNTA 1T2IA 8RNTA 1BRIA 1BNRA 1Q9EA 2F5WA 1FUTA 1A2PA 1B27A 1BVIA 1I0VA 1X1YA 6RNTA 1RNBA 1BRHA 4GHOA 1AQZA 3KCHA 7GSPA 1X1XA 1I70A 1RGGA 1UCKA 1DETA 3D5IA 1UCIA 1RN1A 2AADA 1BNEA 1RHLA 3BIRA 1MGWA 3AGOA 1FW7A 1CH0A 1RNTA 1I3IA 1RLSA 5HOHA 2KF6A 3SYUA 3BU4A 1I2FA 3DH2A 1FUSA 1BSEA 4HOHA 1BNSA 1RGKA 2KF5A 1GOVA 1B20A 3D4AA 1I8VA 1PY3A 3AHWA 4HAAA 1HZ1A 1I2EA 1B3SA 1HYFA 1RGFA 1BIRA 1RTUA 1TTOA 7RNTA 1B2UA 3D5GA 1JBTA 4RNTA 2F4YA 1JBRA 1BSAA 1GSPA 1RGEA 3Q3FA 1AY7A 1MGRA 2BIRA 5BIRA 2GSPA 1YVSA 2F5MA 4BU4A 1RCKA 1BRKA 1BRJA 3URPA 1ZGXA 1LOVA 3WR2A 1BSCA 1BSBA 2HOHA 1RN4A 6GSPA 2RNTA 1RGAA 1IYYA 4GSPA 1LOYA 1RDSA 1BSDA 1GMRA 1I2GA 3A5EA 1RSNA 1B2MA 4J5KA 1I3FA 1LRAA 1FYSA 2F56A 1R4YA 1BRGA 1G02A 5GSPA 1B2ZA 3RNTA 1C54A 1BNGA 1TRPA 1BUJA 1FZUA 1B2XA 1BRNL 1BANA 1LNIA 1UCJA 2KAAA 1GMPA 4BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B21 A;  1I0X A;  2C4B A;  3AGN A;  1LOW A;  3WHO A;  2ZA4 A;  5RNT A;  3HOH A;  1YNV X;  1BNI A;  4J5G A;  1PYL A;  1GOU A;  3DGY A;  1BGS A;  5BU4 A;  1RCL A;  1T2H A;  1UCL A;  2KF3 A;  1SAR A;  1BOX A;  1RGC A;  1TRQ A;  1BRS A;  1BAO A;  1B2S A;  1BU4 A;  1RGL A;  1RGH A;  2BU4 A;  1GMQ A;  2AAE A;  3AHS A;  1X1U A;  1YGW A;  1BNJ A;  1BNF A;  1RMS A;  2RBI A;  2SAR A;  1GOY A;  2KF4 A;  1JBS A;  3GSP A;  1DE3 A;  1X1W A;  9RNT A;  1T2I A;  8RNT A;  1BRI A;  1BNR A;  1Q9E A;  2F5W A;  1FUT A;  1A2P A;  1B27 A;  1BVI A;  1I0V A;  1X1Y A;  6RNT A;  1RNB A;  1BRH A;  4GHO A;  1AQZ A;  3KCH A;  7GSP A;  1X1X A;  1I70 A;  1RGG A;  1UCK A;  1DET A;  3D5I A;  1UCI A;  1RN1 A;  2AAD A;  1BNE A;  1RHL A;  3BIR A;  1MGW A;  3AGO A;  1FW7 A;  1CH0 A;  1RNT A;  1I3I A;  1RLS A;  5HOH A;  2KF6 A;  3SYU A;  3BU4 A;  1I2F A;  3DH2 A;  1FUS A;  1BSE A;  4HOH A;  1BNS A;  1RGK A;  2KF5 A;  1GOV A;  1B20 A;  3D4A A;  1I8V A;  1PY3 A;  3AHW A;  4HAA A;  1HZ1 A;  1I2E A;  1B3S A;  1HYF A;  1RGF A;  1BIR A;  1RTU A;  1TTO A;  7RNT A;  1B2U A;  3D5G A;  1JBT A;  4RNT A;  2F4Y A;  1JBR A;  1BSA A;  1GSP A;  1RGE A;  3Q3F A;  1AY7 A;  1MGR A;  2BIR A;  5BIR A;  2GSP A;  1YVS A;  2F5M A;  4BU4 A;  1RCK A;  1BRK A;  1BRJ A;  3URP A;  1ZGX A;  1LOV A;  3WR2 A;  1BSC A;  1BSB A;  2HOH A;  1RN4 A;  6GSP A;  2RNT A;  1RGA A;  1IYY A;  4GSP A;  1LOY A;  1RDS A;  1BSD A;  1GMR A;  1I2G A;  3A5E A;  1RSN A;  1B2M A;  4J5K A;  1I3F A;  1LRA A;  1FYS A;  2F56 A;  1R4Y A;  1BRG A;  1G02 A;  5GSP A;  1B2Z A;  3RNT A;  1C54 A;  1BNG A;  1TRP A;  1BUJ A;  1FZU A;  1B2X A;  1BRN L;  1BAN A;  1LNI A;  1UCJ A;  2KAA A;  1GMP A;  4BIR A; 
#chains in the Genus database with same CATH topology
 1B21 A;  1W6C A;  4IT7 A;  4NHF A;  4HM1 B;  4CDL A;  2GU1 A;  1TU5 A;  1BNI A;  1W01 A;  1PYL A;  4QWT A;  1STF I;  4WYK B;  3EQQ B;  2Q07 A;  1IVW A;  1VQ6 3;  5IG0 A;  3DGY A;  4MMX B;  5ELU A;  1UCL A;  2KF3 A;  4XBX A;  2PZV A;  1VQP 3;  1UW1 A;  1BOX A;  1TRQ A;  3ZG5 A;  4EYC A;  1BU4 A;  2XR8 B;  4RNZ A;  2BU4 A;  4X2H A;  3PZW A;  1X1U A;  1EUI C;  3IPT A;  1BNF A;  1RMS A;  2SAR A;  1VQ4 3;  2YFL B;  3JUQ A;  5AEU B;  5DRE A;  3WMD A;  2XRX B;  1BNR A;  5IW9 A;  1YI2 3;  4O2H A;  1N5P A;  2CH9 A;  4WWU C;  1A2P A;  2WOH A;  4K1V A;  1I0V A;  4HBR A;  5AYR B;  1PFP A;  1WNH A;  3N8B A;  1ZX2 A;  4GHO A;  1AQZ A;  1JB2 A;  3NQZ A;  1VQQ A;  4EV5 A;  3IJE B;  4R4K A;  4R80 A;  1VQ8 3;  3MWZ A;  1UCI A;  1RN1 A;  1K9M 4;  1TFK A;  4WP5 A;  3Q1C A;  3AGO A;  4JF8 A;  2E2V A;  5BVB A;  1D6U A;  3K0Z A;  4LMI A;  3A76 A;  2KXG A;  1OF5 B;  1TJD A;  1RLS A;  1EEJ A;  4L8O A;  3I0Y A;  1NO3 A;  3SYU A;  2O3O A;  2FXT A;  1VQ5 3;  1K73 4;  1BSE A;  1IT7 A;  2L1S A;  3EF8 A;  3CMA 3;  3CCS 3;  2W9Q A;  3WOE B;  3NQY A;  1KSI A;  1RGK A;  2KF5 A;  8CHO A;  5KP4 A;  1IT8 A;  2ZDJ A;  1UUG B;  1I8V A;  2ML6 A;  3SLU A;  2CFD A;  4FCJ A;  4WYK A;  1UUV B;  1B3S A;  1TUH A;  2XH9 A;  4MEI A;  3VF1 A;  3F7X A;  3GWR A;  3CU3 A;  2F4Y A;  1JBR A;  2GEY A;  1T5Y A;  1JKG A;  4N6U A;  1L5G B;  5IER A;  2OQE C;  2BIR A;  5DRV A;  4O3V A;  2OQE A;  2BNG A;  4LYL B;  2BMQ B;  2OCT A;  3O8Y A;  3Q2P A;  3DGL A;  5AIG A;  5BIR A;  3OX9 A;  4FMD A;  4N6M A;  3S27 A;  1YVS A;  3DGN A;  3I56 3;  3OW2 2;  1JKG B;  1GY7 A;  4HM5 B;  1OHP A;  2R41 A;  1HKX A;  2CKF B;  1LOV A;  1KC8 4;  2XSO B;  2BT3 A;  3BB9 A;  1EA2 A;  1RN4 A;  2WO0 A;  2CFW A;  3CNX A;  3NBJ A;  3LML A;  4BL2 A;  2RNT A;  2CWT A;  1YIJ 3;  1JZO A;  1OAC A;  4GSP A;  2XF3 A;  2HMM B;  3FZW A;  1RDS A;  1GMR A;  2KRT A;  3A5E A;  4MMY B;  2B1X B;  5AIH A;  1RSN A;  4R9L A;  5D81 A;  5G1L A;  1QVF 2;  1YJ9 3;  1AV4 A;  1IVU A;  1GY5 A;  1AVK A;  3FF2 A;  5LC6 A;  3G6E 3;  3STD A;  1EQK A;  2J8X B;  3BNE A;  5I97 A;  1F8N A;  2OOV A;  1TRP A;  1JNQ A;  1BUJ A;  3HX8 A;  2CFK A;  2IY2 A;  2SBL A;  3ROB A;  3WA3 A;  1SII A;  3FH1 A;  1QJG A;  4XM4 A;  3CCJ 3;  2F98 A;  2RSX A;  1DVC A;  2H0I A;  2XFS A;  4N6T A;  5M1A A;  3X3Z A;  4AKY A;  1Q82 4;  3FCS B;  3RGR A;  2C4B A;  3AGN A;  1LOW A;  3EE1 A;  1NWW A;  2D42 A;  3GZB A;  4BTX A;  3G8Z A;  3HOH A;  4FMA A;  5RNT A;  1MWT A;  3LZA A;  4BTY A;  4K90 B;  3BND A;  1KWI A;  1RRH A;  3KZT A;  1IVX A;  1SAR A;  3D79 A;  3H51 A;  3F9S A;  4N6L A;  2XFT A;  2Z77 A;  3KE7 A;  4AKZ A;  3FF0 A;  1BAO A;  3B4P A;  1RGH A;  2AAE A;  5M19 A;  1ROV A;  2GU3 A;  3K63 A;  1U5O A;  1WMN A;  3ECF A;  3G71 3;  2C10 A;  1JBS A;  1G96 A;  3DXO A;  3GSP A;  1X1W A;  4WHA A;  9RNT A;  2OOV C;  2ZL8 A;  1T2I A;  1U8C B;  1WTH A;  2FNQ A;  1EG9 B;  4BL3 A;  1M9G A;  3NV0 B;  3FLJ A;  3CD6 3;  1MOL A;  1YJW 3;  1ROA A;  2CK3 H;  1Q81 4;  6RNT A;  1CYU A;  3QRD A;  3PGB A;  4J8T A;  1LQM B;  3DMC A;  1ZO2 A;  3EB8 A;  1UCK A;  1RGG A;  3GZR A;  4EXR A;  2WGO A;  3X42 A;  3G4S 3;  1VQO 3;  2AAD A;  3CCR 3;  2W04 A;  3CCU 3;  3LOY A;  4KFD A;  1FGQ A;  3QK9 A;  1O7M B;  3BIR A;  3PCS A;  4HZB B;  4J9A A;  3SXX A;  3CCV 3;  4AEQ A;  1M1X B;  3UJM A;  3CC4 3;  4X2O A;  4U13 A;  1FUW A;  1FW7 A;  1CH0 A;  4LGQ A;  1W02 A;  1QMA A;  4HM0 B;  2UUG C;  3Q90 A;  1I3I A;  1OHS A;  3CC2 3;  1RRL A;  2INX A;  3JVC A;  1NB5 I;  3MG1 A;  1O7N B;  3BU4 A;  3DH2 A;  2IYJ A;  2W03 A;  1Q7Y 4;  1VZZ A;  3KII A;  3DGM A;  4G1M B;  5ELJ A;  4XBY A;  1E3R A;  3FGY A;  4JRF A;  4MJD A;  1Q86 4;  2D1W A;  3HZP A;  5AIF A;  4CPK A;  4ZM8 A;  4HJL B;  1B20 A;  1IQX A;  5HGR A;  1ULJ B;  4HAA A;  1IQY A;  3MYT A;  1W2Z A;  5EQL A;  2OTL 3;  1QAF A;  3OWS A;  1UDI I;  1DYU A;  1W2B 2;  2YFI B;  1UGH I;  1RGF A;  1BIR A;  1RTU A;  1N8Q A;  2XEP A;  3NUV A;  3CCL 3;  5IF6 A;  3L0R A;  4ORL A;  3JUP A;  1FA3 A;  5CLK A;  5G1K A;  1BSA A;  1RGE A;  2Z6B A;  1AY7 A;  3TDG A;  1ISK A;  3EJV A;  2GSP A;  2B24 B;  2F5M A;  1BRK A;  1IK3 A;  1K41 A;  3PXM A;  2CW9 A;  3DY5 A;  3V99 A;  4HKV B;  1BSC A;  2IUJ A;  4H61 A;  1Q40 B;  1FGO A;  4DKI A;  5JPU A;  1QVG 2;  1RGA A;  2GBX B;  3N9H A;  1N9E A;  2RCD A;  4KZ1 A;  1OPY A;  1LOY A;  1LOX A;  4KT3 B;  1G0T A;  1BSD A;  4N6O B;  1Z1S A;  2E2T A;  2V1L A;  1V58 A;  4NPB A;  5JBS A;  1M1K 4;  1I3F A;  2WGQ A;  1JN5 B;  3HIG A;  2GEX A;  3MPH A;  5IG5 A;  4KFF A;  1V57 A;  1YIT 3;  1QAK A;  1NJI 4;  5AEW B;  5GSP A;  3LTB A;  1W6G A;  1GD3 A;  1FZU A;  3UB1 A;  2K0M A;  2BO9 B;  4TX4 A;  4BIR A;  2HMK B;  2W9P A;  2QIY A;  3WHO A;  3B7C A;  1C7H A;  2MC8 A;  1WMP A;  2W6J H;  3LT8 A;  2HMO B;  3BLZ A;  1BGS A;  1RCL A;  1T2H A;  2BMR B;  3EHC A;  4FMC A;  2P38 A;  1JRQ A;  3F8X A;  2O9U X;  4FCM A;  3VGN A;  1BRS A;  1RGL A;  3NXJ A;  1W5Z A;  4O8S A;  1R4C A;  3AHS A;  1OUN A;  5AYS C;  3NHX A;  1M90 4;  1DMN A;  3AMO B;  1YGW A;  2IMJ A;  1BNJ A;  2RBI A;  2YX9 A;  4LEH A;  1GOY A;  2HMJ B;  2KF4 A;  1DE3 A;  3ALA A;  4HM4 B;  3K5T A;  3B8L A;  1JJ2 2;  1V74 A;  4STD A;  4EBG A;  2HML B;  2CHC A;  1BRI A;  1Q9E A;  4I4K A;  2OTJ 3;  1UGI A;  1FUT A;  1B27 A;  5FW5 A;  1JV2 B;  1X1Y A;  1GYB A;  5D83 A;  3DM8 A;  1AVL A;  2CFL A;  1LNH A;  1X1X A;  2CG0 A;  1I70 A;  1W4N A;  5IEN A;  3D5I A;  3MSO A;  3I55 3;  3CC7 3;  1NDO B;  2HMN B;  3X3X A;  4OK0 A;  1Q7H A;  3T8N A;  2QGU A;  1MGW A;  3E99 A;  2CG1 A;  1E97 A;  3LTA A;  4OVM A;  3MG3 A;  1S72 3;  4RBN A;  1FGT A;  1SPU A;  1IQ8 A;  3MHE A;  1O7G B;  2CX1 A;  1I2F A;  2W0Q A;  1FUS A;  4FMB A;  3GZX B;  4MMZ B;  5AII A;  4HYZ A;  4EC6 A;  1IDP A;  1BUQ A;  2P0X A;  2M7O A;  4HOH A;  1D6Z A;  2H0G A;  5CK6 A;  1VQL 3;  1CYV A;  1DMM A;  5JPP A;  1OGX A;  3KFQ C;  1MWR A;  1STD A;  3D4A A;  1A90 A;  1PY3 A;  3AHW A;  2OWP A;  1HZ1 A;  1NU3 A;  3LYG A;  1I2E A;  2IA7 A;  2CWV A;  5LC7 A;  1HYF A;  1TP6 A;  3ZG0 A;  7RNT A;  1B2U A;  4IPB A;  2MF7 A;  4GB5 A;  4N3V A;  5KP1 A;  1GSP A;  1FGM A;  1LVN A;  3JUO A;  3K7C A;  3Q3F A;  4R9K A;  1DMQ A;  1YVB I;  3HI7 A;  1J2B A;  3DGO A;  3F14 A;  1N9J A;  2P09 A;  3AMO A;  1A67 A;  1OHO A;  3NV0 A;  5G2G A;  2K54 A;  3JUN A;  3V98 A;  1KQS 2;  3G16 A;  5KP3 A;  2BMO B;  3EBT A;  4H3U A;  3MKI A;  1ZGX A;  1HU9 A;  2GBW B;  3OWU A;  4XDV A;  3WR2 A;  3KKG A;  1RKY A;  2HOH A;  3U1W A;  2W2C A;  1MNL A;  2QEX 3;  3G0K A;  3NBB A;  3S67 A;  3UL6 A;  3EBY A;  5CXO A;  3CNM A;  1SQW A;  2ML5 A;  4K1U A;  4CJN A;  2I9W A;  2RGQ A;  1KD1 4;  2BHM A;  1WMO A;  4NRE A;  1YJN 3;  3MG2 A;  2Z7A A;  2LYX A;  1LRA A;  3VSY A;  2F56 A;  1R4Y A;  1BRG A;  1US1 A;  1G02 A;  3OV4 A;  3RNT A;  1A2V A;  3LH4 A;  3U97 A;  3FG1 A;  4EV2 A;  1N5H A;  2A15 A;  3JUM A;  4HM8 B;  4XBT A;  1OGZ A;  1B2X A;  4FCZ A;  2Z76 A;  5EVH A;  3S29 A;  1VQ7 3;  4CCV A;  1E3V A;  3CCQ 3;  3CME 3;  1LNI A;  1UCJ A;  3NBR A;  3OWY A;  1O7W B;  2KAA A;  2YFJ B;  1VQK 3;  3RDE A;  6GSP A;  2CC3 A;  3UL5 A;  1OCV A;  2XGN A;  1I0X A;  5IG3 A;  1JB4 A;  5TGN A;  3T0U A;  2JQ5 A;  3WA2 X;  2ZA4 A;  1TIJ A;  1CEW I;  2GXF A;  2KCD A;  1YNV X;  2P05 A;  4GL6 A;  4J5G A;  5FGO A;  5IEO A;  3RGA A;  1GOU A;  1W00 A;  3GAX A;  5BXQ A;  2XGL A;  3CCE 3;  1LQG C;  5BU4 A;  1O7P B;  3WDG B;  1GD4 A;  3KSP A;  3X3Y A;  5IG4 A;  1MWU A;  1NNV A;  2WOF A;  2E2U A;  5M18 A;  1AR0 A;  1RGC A;  4N6N B;  1W7C A;  1B2S A;  3EN8 A;  4ILF A;  1UI8 A;  2K3D A;  1GMQ A;  2W56 A;  4HM6 B;  3X40 A;  3M8C A;  1SJW A;  3FG3 A;  1VQN 3;  3DZL A;  3SOA A;  1O7H B;  3BNB A;  2LQV A;  3PCR A;  5STD A;  1D6Y A;  6STD A;  2RFR A;  3ER7 A;  8RNT A;  4BTW A;  2F5W A;  1BVI A;  3X41 A;  3IMA B;  1RNB A;  1BRH A;  1PU4 A;  4RNY A;  1JZD A;  3T8U A;  4I5Q A;  3KCH A;  1WQL B;  7GSP A;  1N8R 4;  1UI7 A;  1DET A;  3KSE D;  4HM7 B;  3K9M C;  4IIA A;  2XSH B;  1K8A 4;  1VQM 3;  4HM3 B;  1BNE A;  3HK4 A;  4Q53 A;  1ASK A;  2Y73 A;  3F40 A;  3PS8 A;  2IUK A;  3SVA A;  1RHL A;  3EC9 A;  3GRD A;  1K28 A;  2STD A;  1ZS7 A;  3FG4 A;  5CF2 A;  1IV7 A;  3UNL A;  4RZM A;  3ZFZ A;  4HZ9 B;  1VQ9 3;  1RNT A;  4FR9 A;  3F8H A;  3FKA A;  3NM2 A;  5HOH A;  2KF6 A;  1IU7 A;  2CWU A;  1ULI B;  3D3L A;  3DUK A;  1UUW B;  1GS3 A;  1BNS A;  1EKM A;  1YGE A;  3CXC 2;  3CPO A;  3SED A;  1RN7 A;  2PNC A;  1MWS A;  4K61 A;  1RJO A;  3LTC A;  3N54 B;  1GOV A;  2CIU A;  5IEP A;  3NM7 A;  2P0M A;  2H0H A;  3OXA A;  2ZHX B;  4XDW A;  5D82 A;  3EN1 B;  1W6Y A;  2R4I A;  4R1K A;  2CFG A;  1TTO A;  3LT9 A;  4L8P A;  3D5G A;  1JBT A;  4RNT A;  5EEO A;  3SOY A;  1LXE A;  4WFO A;  3WOF B;  2UGI A;  1DVD A;  3CCM 3;  1JB5 A;  3D9R A;  3CPW 2;  3GZY B;  1MGR A;  2W56 B;  4KVH A;  4O02 B;  1QAL A;  1SIH A;  4L7K A;  2F86 B;  1A2K A;  1OH0 A;  4OUQ A;  4BU4 A;  1RCK A;  1FGR A;  3V92 A;  5AI1 A;  2F99 A;  1BRJ A;  4HM2 B;  3URP A;  5CF1 A;  1IV9 A;  1BSB A;  1CQS A;  7STD A;  1Q42 A;  2QA4 3;  1T3B A;  4N6V 0;  3BNC A;  3S5C A;  1JN5 A;  4EW5 A;  1Y4K A;  2C11 A;  1IYY A;  5A0O B;  3J7Y d;  1I2G A;  3LXU X;  3PYJ A;  1B2M A;  3S28 A;  4J5K A;  4XB5 A;  1Q40 A;  4HVN A;  2Y74 A;  2FGT A;  1GY6 A;  4PEJ A;  1FYS A;  1OF5 A;  1S5A A;  2UX0 A;  1TFO A;  3HII A;  1B2Z A;  3NX0 A;  4LSO A;  4LZI A;  3KN4 A;  3H3H A;  1BNG A;  1C54 A;  1NB3 I;  2CX0 A;  2JDI H;  3WOD G;  1BRN L;  3SX1 A;  1YHQ 3;  1BAN A;  3EX9 A;  4KFE A;  3FSD A;  1IVV A;  2L4V A;  3F7S A;  1GMP A;  3B4O A;  3LTD A; 
#chains in the Genus database with same CATH homology
 1B21 A;  1I0X A;  2C4B A;  3AGN A;  1LOW A;  3WHO A;  2ZA4 A;  5RNT A;  3HOH A;  1YNV X;  1BNI A;  4J5G A;  1PYL A;  1GOU A;  3DGY A;  1BGS A;  5BU4 A;  1RCL A;  1T2H A;  1UCL A;  2KF3 A;  1SAR A;  1BOX A;  1RGC A;  1TRQ A;  1BRS A;  1BAO A;  1B2S A;  1BU4 A;  1RGL A;  1RGH A;  2BU4 A;  1GMQ A;  2AAE A;  3AHS A;  1X1U A;  1YGW A;  1BNJ A;  1BNF A;  1RMS A;  2RBI A;  2SAR A;  1GOY A;  2KF4 A;  1JBS A;  3GSP A;  1DE3 A;  1X1W A;  9RNT A;  1T2I A;  8RNT A;  1BRI A;  1BNR A;  1Q9E A;  2F5W A;  1FUT A;  1A2P A;  1B27 A;  1BVI A;  1I0V A;  1X1Y A;  6RNT A;  1RNB A;  1BRH A;  4GHO A;  1AQZ A;  3KCH A;  7GSP A;  1X1X A;  1I70 A;  1RGG A;  1UCK A;  1DET A;  3D5I A;  1UCI A;  1RN1 A;  2AAD A;  1BNE A;  1RHL A;  3BIR A;  1MGW A;  3AGO A;  1FW7 A;  1CH0 A;  1RNT A;  1I3I A;  1RLS A;  5HOH A;  2KF6 A;  3SYU A;  3BU4 A;  1I2F A;  3DH2 A;  1FUS A;  1BSE A;  4HOH A;  1BNS A;  1RGK A;  2KF5 A;  1GOV A;  1B20 A;  3D4A A;  1I8V A;  1PY3 A;  3AHW A;  4HAA A;  1HZ1 A;  1I2E A;  1B3S A;  1HYF A;  1RGF A;  1BIR A;  1RTU A;  1TTO A;  7RNT A;  1B2U A;  3D5G A;  1JBT A;  4RNT A;  2F4Y A;  1JBR A;  1BSA A;  1GSP A;  1RGE A;  3Q3F A;  1AY7 A;  1MGR A;  2BIR A;  5BIR A;  2GSP A;  1YVS A;  2F5M A;  4BU4 A;  1RCK A;  1BRK A;  1BRJ A;  3URP A;  1ZGX A;  1LOV A;  3WR2 A;  1BSC A;  1BSB A;  2HOH A;  1RN4 A;  6GSP A;  2RNT A;  1RGA A;  1IYY A;  4GSP A;  1LOY A;  1RDS A;  1BSD A;  1GMR A;  1I2G A;  3A5E A;  1RSN A;  1B2M A;  4J5K A;  1I3F A;  1LRA A;  1FYS A;  2F56 A;  1R4Y A;  1BRG A;  1G02 A;  5GSP A;  1B2Z A;  3RNT A;  1C54 A;  1BNG A;  1TRP A;  1BUJ A;  1FZU A;  1B2X A;  1BRN L;  1BAN A;  1LNI A;  1UCJ A;  2KAA A;  1GMP A;  4BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...