3BIRA

Disecting histidine interactions in ribonuclease t1 by asn and gln substitutions
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITNTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Dissecting histidine interactions of ribonuclease T1 with asparagine and glutamine replacements: analysis of double mutant cycles at one position.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endonuclease
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3birA00
1I3FA 1I2EA 2F5WA 3BU4A 1BRSA 1GMRA 1PY3A 1RDSA 1T2IA 1UCIA 4J5KA 3AHSA 3HOHA 1I3IA 5RNTA 3AGNA 1C54A 3AHWA 1GSPA 1GOUA 1BSEA 1FYSA 1RHLA 3BIRA 1RSNA 3D5GA 6GSPA 1BU4A 1PYLA 2F56A 1CH0A 1B2XA 3SYUA 1BGSA 1BNRA 1YGWA 3URPA 3A5EA 7GSPA 1B21A 2HOHA 3KCHA 2BU4A 1RGKA 1RTUA 3DGYA 2BIRA 1BRGA 7RNTA 4GSPA 4RNTA 1B27A 1BNFA 1I0VA 1MGRA 9RNTA 1GOYA 3Q3FA 4J5GA 1BOXA 1HYFA 4BIRA 1BRNL 2KF5A 1RGAA 1I2GA 1Q9EA 1JBRA 1BSDA 2KAAA 2RBIA 1X1UA 1B2ZA 1BNEA 6RNTA 1GMPA 1GMQA 2F5MA 3D4AA 1DE3A 1BSAA 1BRJA 1BVIA 1RGGA 1RN1A 1UCKA 1RGEA 5BU4A 1HZ1A 1RCKA 1UCLA 1BNGA 1FUTA 1TRPA 2F4YA 2KF4A 4BU4A 1BANA 1LNIA 1I8VA 1RGFA 5BIRA 1GOVA 2AADA 1X1XA 1A2PA 1I2FA 1AQZA 1IYYA 1BRKA 1B2SA 1RN4A 1B20A 1LOWA 1AY7A 1RGLA 2KF3A 2RNTA 1T2HA 1RNTA 1UCJA 1YNVX 1B2UA 1BNIA 4HOHA 1BSCA 1X1WA 1TTOA 1I0XA 1G02A 1B2MA 1RGHA 1DETA 1SARA 1ZGXA 1BSBA 1JBSA 1R4YA 1LRAA 4HAAA 1BAOA 3RNTA 2KF6A 2GSPA 5GSPA 1BIRA 1TRQA 8RNTA 1JBTA 1FUSA 1FZUA 3WHOA 1BRIA 1X1YA 3WR2A 1MGWA 5HOHA 2AAEA 1RNBA 3D5IA 1BUJA 4GHOA 1FW7A 2ZA4A 1RMSA 1RGCA 1BNSA 3GSPA 3DH2A 2SARA 1RLSA 1RCLA 1BNJA 1LOVA 3AGOA 1LOYA 1YVSA 1B3SA 1I70A 2C4BA 1BRHA
chains in the Genus database with same CATH superfamily
4WFOA 3JUQA 2WOHA 2INXA 2LQVA 1VQ83 4X2OA 1VQ53 1PY3A 3DXOA 4MMYB 5AIHA 3LTCA 3F7SA 5IF6A 3AGNA 1TU5A 3AHWA 2W2CA 3GZRA 3N9HA 5CF1A 4HM7B 4L8PA 4R9LA 1O7HB 2UGIA 1YJ93 4N6TA 1YHQ3 3MG3A 5IW9A 1JN5A 1US1A 2OCTA 3KIIA 5KP1A 1YI23 1K734 1NWWA 4BL2A 7GSPA 2HOHA 3WOEB 1RTUA 3EBTA 3I553 4HM1B 5EVHA 1BRGA 4GSPA 3L0RA 2H0IA 1V58A 3EB8A 1GS3A 3V98A 1MGRA 1RRHA 1GOYA 9RNTA 3Q3FA 3JUPA 3NV0B 3J7Yd 1LVNA 1W5ZA 2XH9A 3EN8A 1RGAA 3N8BA 1K8A4 1I2GA 4KZ1A 3OX9A 2GEYA 5AEUB 4ORLA 3NUVA 4STDA 1UGIA 3H3HA 1MWRA 1R4CA 1BSAA 4N6LA 4GB5A 1W7CA 4J8TA 1A2KA 2GBWB 4EC6A 1O7MB 4CCVA 3UJMA 1S5AA 3D79A 4HM3B 4HM2B 1Z1SA 2ZHXB 1BNGA 1TRPA 3LZAA 3F8HA 4BU4A 3PGBA 1BANA 1O7WB 3U97A 2XFSA 1N9JA 2E2UA 3LT8A 4WHAA 3QRDA 1IVUA 2Y73A 1I2FA 1RN7A 3LXUX 2BNGA 5LC6A 3K7CA 1IYYA 1B2SA 2FGTA 3EQQB 2W0QA 2BO9B 1LNHA 1UUVB 4K1UA 1DMNA 2KF3A 1ROVA 2RNTA 3QK9A 2QGUA 1ROAA 1JB2A 1RNTA 1IU7A 1SIHA 1W2ZA 1UCJA 3CU3A 3PCRA 4LGQA 4XDVA 4HOHA 1LOXA 4R9KA 4EXRA 3G6E3 1UI8A 1ISKA 3LH4A 4I4KA 1QAKA 4K1VA 1G02A 3ROBA 1YIT3 1F8NA 1JB4A 3MWZA 4IT7A 3CD63 1AVLA 3F14A 2KXGA 1WMPA 1IDPA 4X2HA 5AYRB 3FH1A 1IVXA 1U5OA 3F40A 2CG1A 1AVKA 1CYVA 2RSXA 3AMOB 3UL6A 3X40A 3JUMA 1MOLA 3PS8A 2MF7A 1FZUA 1E97A 5M18A 1VQ63 3Q1CA 3DGLA 4HJLB 3X3YA 1EG9B 5IEPA 1KC84 1RNBA 1QVG2 3VGNA 2W56A 4R4KA 3OW22 1FW7A 4JRFA 3KSED 4NHFA 3CCM3 4O2HA 2IMJA 1VQ73 5IEOA 3K63A 1WQLB 4CPKA 4Q53A 1JJ22 3GSPA 3DH2A 1ZO2A 3IJEB 4XB5A 3FG1A 3RGAA 1RLSA 1UUWB 4BL3A 1IQYA 2H0HA 1CEWI 1ASKA 2OOVC 3AGOA 4TX4A 5IG5A 3UB1A 1YVSA 1B3SA 3M8CA 2CFKA 4HKVB 4XBYA 3FLJA 1JZOA 4O02B 1YGEA 1LQMB 1BRHA 4K90B 4AKZA 2K3DA 1J2BA 4MMZB 4OVMA 1RRLA 2F5WA 4H3UA 5TGNA 1A67A 4RBNA 1UCIA 1AV4A 3DGOA 3SVAA 4EV2A 5RNTA 1TFKA 2OTJ3 1GOUA 1BSEA 2Z76A 3HI7A 4K61A 2GEXA 1RHLA 2CWUA 3S67A 1RSNA 1KQS2 1KSIA 3K5TA 4AKYA 3CMA3 2F56A 3STDA 1QMAA 1V57A 3T0UA 1YGWA 3URPA 2YX9A 3A5EA 1SQWA 2Q07A 3DGNA 4J9AA 5JBSA 3KCHA 2BU4A 1VQQA 3SOYA 4EYCA 2RGQA 4RNYA 4R1KA 1B27A 4HM6B 1BNFA 1ZS7A 4NREA 8CHOA 1AR0A 1W4NA 3ZFZA 5A0OB 4BIRA 3ECFA 2L1SA 4HVNA 4LEHA 1Q40B 3SOAA 4CJNA 1EA2A 2P0MA 2WOFA 2F86B 5DREA 2RBIA 4L7KA 3DY5A 4N6UA 1B2ZA 3WODG 3CCL3 5AYSC 6RNTA 2GXFA 1KD14 1DE3A 1IV7A 1OUNA 3SEDA 1BRJA 3OWYA 1OF5B 1RGGA 2PZVA 1D6YA 1RGEA 1OHSA 5BU4A 1UW1A 1FGMA 1RCKA 4MMXB 1LQGC 2YFJB 4KFFA 1QVF2 3GAXA 1EUIC 1LNIA 1TUHA 1I8VA 4KFEA 3FG4A 5G1KA 1GOVA 4FMDA 1YJW3 2WGOA 3LMLA 1A2PA 3RGRA 2CFLA 3KN4A 3NV0A 1YJN3 5STDA 3NHXA 1AQZA 2CC3A 2CWVA 2HMJB 1FUWA 4EV5A 1TP6A 3SXXA 1LOWA 3D9RA 2OOVA 1GD3A 1G0TA 3G16A 3CCE3 2B24B 1IK3A 1EQKA 3MKIA 1B2UA 1BNIA 1GD4A 3NQYA 5DRVA 2Z77A 1X1WA 1G96A 1TTOA 3OWSA 4H61A 1VQN3 1I0XA 3BNEA 3S27A 4WYKB 5BXQA 1IQXA 2M7OA 1K41A 4OK0A 3EC9A 2WGQA 3VSYA 1A90A 2CFGA 3OV4A 2HMNB 1QJGA 1BSBA 2QA43 3CPOA 1DVDA 4PEJA 1R4YA 1NB3I 1W00A 1GYBA 2CIUA 3EJVA 1WMOA 1BAOA 1ULIB 1ZX2A 2KF6A 2E2VA 2GSPA 3EN1B 1TJDA 5GSPA 1Y4KA 8RNTA 3EF8A 2O3OA 3WHOA 1N8QA 3BLZA 1SIIA 1X1YA 2CHCA 4LMIA 2P09A 4HAAA 1K28A 3NX0A 2IUJA 1MGWA 3K0ZA 2HMMB 2JQ5A 2B1XB 1OACA 4HYZA 2ZA4A 1RMSA 1U8CB 1BNSA 1UGHI 3NXJA 3SLUA 3MSOA 4XBXA 1W01A 1GY5A 3KE7A 1I70A 3EE1A 2D1WA 2C4BA 2CH9A 3DUKA 3I0YA 3CME3 1I2EA 1BRSA 3AMOA 1GMRA 1RDSA 1T2IA 3RDEA 1Q864 1MWUA 3FF0A 3EBYA 1DMQA 3HOHA 5CF2A 2OTL3 4N6NB 2JDIH 3HIIA 5IG4A 1E3VA 4LZIA 1FYSA 3PZWA 3G713 3EX9A 5CK6A 3I563 2ZDJA 1BU4A 1CH0A 3WMDA 5IG3A 5IG0A 1BNRA 2W04A 1VQK3 3JUNA 2IYJA 3D3LA 1M904 1OHOA 3KZTA 4N6OB 3VF1A 3CCR3 7RNTA 1VQO3 3HX8A 1CQSA 4IPBA 1N9EA 1YVBI 2Y74A 5CLKA 5AIGA 1D6ZA 1DMMA 3CNMA 1I0VA 4FCZA 3FSDA 1BOXA 3GRDA 2PNCA 5G1LA 5KP4A 2KF5A 5D82A 5KP3A 2IY2A 4HZBB 3BB9A 1Q9EA 2C11A 1MWSA 3GZBA 1BSDA 3NQZA 4LSOA 3OXAA 2KAAA 1IT7A 1TIJA 3FG3A 1Q814 3MG2A 2F99A 1X1UA 3T8NA 1FGRA 5AIFA 1GMQA 2F5MA 3D4AA 4FMCA 7STDA 1N5PA 1RN1A 5LC7A 3PCSA 4ILFA 3B4PA 5D81A 3PYJA 2RFRA 3MG1A 1UCLA 2CWTA 3GZXB 2J8XB 4GL6A 2K54A 2OWPA 2UUGC 1RGFA 5BIRA 2BMOB 2AADA 1DYUA 1WTHA 4FR9A 4KVHA 3IMAB 2IUKA 1EEJA 1N5HA 3V92A 4FCMA 4KT3B 4BTXA 5JPUA 1BRKA 1L5GB 1Q40A 1K9M4 4HM0B 1RGLA 1T3BA 2P38A 4HM5B 1GY6A 1MNLA 3CPW2 1JKGB 2CFDA 3A76A 3FF2A 3LTBA 3JUOA 1JB5A 3UL5A 1YNVX 4EW5A 3F8XA 1W2B2 1IV9A 2YFLB 3T8UA 2XFTA 3ER7A 3Q90A 1QALA 3K9MC 2H0GA 1SARA 2P0XA 3O8YA 1Q7Y4 4U13A 1HU9A 1ZGXA 1OGXA 2W9PA 3G0KA 2P05A 3TDGA 3CNXA 5IENA 2R41A 5ELJA 3B8LA 1JNQA 1UDII 4XBTA 4FCJA 5AEWB 3B4OA 3BNDA 1JBSA 1D6UA 1LRAA 1W6YA 2IA7A 3X3ZA 3RNTA 2F98A 1WMNA 3X41A 1OPYA 1BIRA 2SBLA 1TFOA 1O7NB 5ELUA 2GBXB 3X42A 1M1XB 1V74A 3CC43 1CYUA 2XSHB 2WO0A 1E3RA 3DGMA 3CXC2 1GY7A 1NB5I 3DMCA 2OQEC 4GHOA 2HMOB 4DKIA 1N8R4 1WNHA 3LT9A 1NDOB 1JN5B 2FXTA 3KFQC 3FCSB 3WOFB 2SARA 4WYKA 5AI1A 1RCLA 1BNJA 4I5QA 1LOVA 4XDWA 2A15A 3GZYB 2CW9A 1PFPA 3ZG0A 1BUQA 1FA3A 2Z7AA 4CDLA 1I3FA 1JRQA 2ML6A 2W03A 2XGLA 1OGZA 3BU4A 3G8ZA 1S723 3WA2X 3N54B 2XEPA 4J5KA 2W6JH 5HGRA 3AHSA 1W6GA 2BT3A 2CG0A 1I3IA 2E2TA 4HZ9B 1NO3A 3E99A 5BVBA 1M1K4 1NNVA 1GSPA 2GU3A 2XGNA 2FNQA 3MHEA 1UUGB 1O7PB 2W9QA 2YFIB 3BIRA 2K0MA 3D5GA 4XM4A 3U1WA 3BNBA 3NBBA 6GSPA 3CCU3 1PYLA 1VQ93 3HZPA 1RJOA 1Q7HA 1IT8A 1B2XA 3IPTA 3SYUA 3CC73 1BGSA 1W02A 2RCDA 4RNZA 5G2GA 3LOYA 1MWTA 2BMQB 2LYXA 3Q2PA 4HM8B 5AIIA 2UX0A 4FMBA 4AEQA 1B21A 1IVWA 3NM7A 1SJWA 3FGYA 1RGKA 3DGYA 1VQ43 2BIRA 4MEIA 3OWUA 3UNLA 1KWIA 4RNTA 1FGOA 2CFWA 4J5GA 1HYFA 1HKXA 2I9WA 3DM8A 4FMAA 3LYGA 1Q42A 1BRNL 4ZM8A 1PU4A 1UI7A 3NBRA 1VQP3 1JBRA 1OHPA 3G4S3 2MC8A 4KFDA 1IVVA 3HIGA 3S28A 1BNEA 2L4VA 1RKYA 4IIAA 1GMPA 2BHMA 2V1LA 2STDA 4NPBA 2QIYA 1NU3A 4N6V0 1BVIA 1LXEA 1UCKA 3H51A 3WDGB 2CK3H 3LTAA 3NM2A 4WWUC 1HZ1A 1FUTA 2F4YA 1A2VA 2KF4A 3LTDA 3FKAA 1OCVA 3F7XA 1STDA 6STDA 5IERA 2OQEA 2C10A 3BNCA 4N6MA 1VZZA 1W6CA 1IQ8A 1X1XA 3CC23 5M1AA 1DVCA 5EEOA 2XRXB 1OH0A 1RN4A 5FW5A 1B20A 2R4IA 3HK4A 3V99A 1AY7A 3FZWA 1YIJ3 3ALAA 2BMRB 1T2HA 1VQL3 2W56B 2CX1A 3JVCA 3PXMA 3CCS3 5CXOA 3CCQ3 1JZDA 3KKGA 1ULJB 2O9UX 3S29A 1EKMA 1BSCA 4L8OA 3SX1A 2CX0A 1FGQA 1B2MA 1RGHA 1DETA 2ML5A 3MYTA 5M19A 4O3VA 2QEX3 4BTYA 4HM4B 2KRTA 3WA3A 3ZG5A 3F9SA 3B7CA 5FGOA 2XR8B 1C7HA 1JV2B 2KCDA 2XF3A 3DZLA 4EBGA 4WP5A 4G1MB 5EQLA 1TRQA 1JBTA 1FUSA 1FGTA 4QWTA 1BRIA 3WR2A 3X3XA 2GU1A 1JKGA 5HOHA 2AAEA 3D5IA 5JPPA 1Q824 1BUJA 4R80A 1C54A 3NBJA 3CCJ3 4OUQA 3CCV3 3MPHA 1M9GA 1RGCA 1VQM3 5I97A 1STFI 4MJDA 4O8SA 5D83A 1OF5A 3GWRA 4LYLB 4N3VA 3KSPA 2CKFB 4BTWA 3S5CA 4HBRA 4RZMA 1LOYA 1O7GB 1SPUA 1NJI4 2XSOB 2HMLB 2Z6BA 1T5YA 1QAFA 2ZL8A 4JF8A 3EHCA 2HMKB 2D42A
chains in the Genus database with same CATH topology
1I3FA 1I2EA 2F5WA 3BU4A 1BRSA 1GMRA 1PY3A 1RDSA 1T2IA 1UCIA 4J5KA 3AHSA 3HOHA 1I3IA 5RNTA 3AGNA 1C54A 3AHWA 1GSPA 1GOUA 1BSEA 1FYSA 1RHLA 3BIRA 1RSNA 3D5GA 6GSPA 1BU4A 1PYLA 2F56A 1CH0A 1B2XA 3SYUA 1BGSA 1BNRA 1YGWA 3URPA 3A5EA 7GSPA 1B21A 2HOHA 3KCHA 2BU4A 1RGKA 1RTUA 3DGYA 2BIRA 1BRGA 7RNTA 4GSPA 4RNTA 1B27A 1BNFA 1I0VA 1MGRA 9RNTA 1GOYA 3Q3FA 4J5GA 1BOXA 1HYFA 4BIRA 1BRNL 2KF5A 1RGAA 1I2GA 1Q9EA 1JBRA 1BSDA 2KAAA 2RBIA 1X1UA 1B2ZA 1BNEA 6RNTA 1GMPA 1GMQA 2F5MA 3D4AA 1DE3A 1BSAA 1BRJA 1BVIA 1RGGA 1RN1A 1UCKA 1RGEA 5BU4A 1HZ1A 1RCKA 1UCLA 1BNGA 1FUTA 1TRPA 2F4YA 2KF4A 4BU4A 1BANA 1LNIA 1I8VA 1RGFA 5BIRA 1GOVA 2AADA 1X1XA 1A2PA 1I2FA 1AQZA 1IYYA 1BRKA 1B2SA 1RN4A 1B20A 1LOWA 1AY7A 1RGLA 2KF3A 2RNTA 1T2HA 1RNTA 1UCJA 1YNVX 1B2UA 1BNIA 4HOHA 1BSCA 1X1WA 1TTOA 1I0XA 1G02A 1B2MA 1RGHA 1DETA 1SARA 1ZGXA 1BSBA 1JBSA 1R4YA 1LRAA 4HAAA 1BAOA 3RNTA 2KF6A 2GSPA 5GSPA 1BIRA 1TRQA 8RNTA 1JBTA 1FUSA 1FZUA 3WHOA 1BRIA 1X1YA 3WR2A 1MGWA 5HOHA 2AAEA 1RNBA 3D5IA 1BUJA 4GHOA 1FW7A 2ZA4A 1RMSA 1RGCA 1BNSA 3GSPA 3DH2A 2SARA 1RLSA 1RCLA 1BNJA 1LOVA 3AGOA 1LOYA 1YVSA 1B3SA 1I70A 2C4BA 1BRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3F A;  1I2E A;  2F5W A;  3BU4 A;  1BRS A;  1GMR A;  1PY3 A;  1RDS A;  1T2I A;  1UCI A;  4J5K A;  3AHS A;  3HOH A;  1I3I A;  5RNT A;  3AGN A;  1C54 A;  3AHW A;  1GSP A;  1GOU A;  1BSE A;  1FYS A;  1RHL A;  3BIR A;  1RSN A;  3D5G A;  6GSP A;  1BU4 A;  1PYL A;  2F56 A;  1CH0 A;  1B2X A;  3SYU A;  1BGS A;  1BNR A;  1YGW A;  3URP A;  3A5E A;  7GSP A;  1B21 A;  2HOH A;  3KCH A;  2BU4 A;  1RGK A;  1RTU A;  3DGY A;  2BIR A;  1BRG A;  7RNT A;  4GSP A;  4RNT A;  1B27 A;  1BNF A;  1I0V A;  1MGR A;  9RNT A;  1GOY A;  3Q3F A;  4J5G A;  1BOX A;  1HYF A;  4BIR A;  1BRN L;  2KF5 A;  1RGA A;  1I2G A;  1Q9E A;  1JBR A;  1BSD A;  2KAA A;  2RBI A;  1X1U A;  1B2Z A;  1BNE A;  6RNT A;  1GMP A;  1GMQ A;  2F5M A;  3D4A A;  1DE3 A;  1BSA A;  1BRJ A;  1BVI A;  1RGG A;  1RN1 A;  1UCK A;  1RGE A;  5BU4 A;  1HZ1 A;  1RCK A;  1UCL A;  1BNG A;  1FUT A;  1TRP A;  2F4Y A;  2KF4 A;  4BU4 A;  1BAN A;  1LNI A;  1I8V A;  1RGF A;  5BIR A;  1GOV A;  2AAD A;  1X1X A;  1A2P A;  1I2F A;  1AQZ A;  1IYY A;  1BRK A;  1B2S A;  1RN4 A;  1B20 A;  1LOW A;  1AY7 A;  1RGL A;  2KF3 A;  2RNT A;  1T2H A;  1RNT A;  1UCJ A;  1YNV X;  1B2U A;  1BNI A;  4HOH A;  1BSC A;  1X1W A;  1TTO A;  1I0X A;  1G02 A;  1B2M A;  1RGH A;  1DET A;  1SAR A;  1ZGX A;  1BSB A;  1JBS A;  1R4Y A;  1LRA A;  4HAA A;  1BAO A;  3RNT A;  2KF6 A;  2GSP A;  5GSP A;  1BIR A;  1TRQ A;  8RNT A;  1JBT A;  1FUS A;  1FZU A;  3WHO A;  1BRI A;  1X1Y A;  3WR2 A;  1MGW A;  5HOH A;  2AAE A;  1RNB A;  3D5I A;  1BUJ A;  4GHO A;  1FW7 A;  2ZA4 A;  1RMS A;  1RGC A;  1BNS A;  3GSP A;  3DH2 A;  2SAR A;  1RLS A;  1RCL A;  1BNJ A;  1LOV A;  3AGO A;  1LOY A;  1YVS A;  1B3S A;  1I70 A;  2C4B A;  1BRH A; 
#chains in the Genus database with same CATH topology
 4WFO A;  3JUQ A;  2WOH A;  2INX A;  2LQV A;  1VQ8 3;  4X2O A;  1VQ5 3;  1PY3 A;  3DXO A;  4MMY B;  5AIH A;  3LTC A;  3F7S A;  5IF6 A;  3AGN A;  1TU5 A;  3AHW A;  2W2C A;  3GZR A;  3N9H A;  5CF1 A;  4HM7 B;  4L8P A;  4R9L A;  1O7H B;  2UGI A;  1YJ9 3;  4N6T A;  1YHQ 3;  3MG3 A;  5IW9 A;  1JN5 A;  1US1 A;  2OCT A;  3KII A;  5KP1 A;  1YI2 3;  1K73 4;  1NWW A;  4BL2 A;  7GSP A;  2HOH A;  3WOE B;  1RTU A;  3EBT A;  3I55 3;  4HM1 B;  5EVH A;  1BRG A;  4GSP A;  3L0R A;  2H0I A;  1V58 A;  3EB8 A;  1GS3 A;  3V98 A;  1MGR A;  1RRH A;  1GOY A;  9RNT A;  3Q3F A;  3JUP A;  3NV0 B;  3J7Y d;  1LVN A;  1W5Z A;  2XH9 A;  3EN8 A;  1RGA A;  3N8B A;  1K8A 4;  1I2G A;  4KZ1 A;  3OX9 A;  2GEY A;  5AEU B;  4ORL A;  3NUV A;  4STD A;  1UGI A;  3H3H A;  1MWR A;  1R4C A;  1BSA A;  4N6L A;  4GB5 A;  1W7C A;  4J8T A;  1A2K A;  2GBW B;  4EC6 A;  1O7M B;  4CCV A;  3UJM A;  1S5A A;  3D79 A;  4HM3 B;  4HM2 B;  1Z1S A;  2ZHX B;  1BNG A;  1TRP A;  3LZA A;  3F8H A;  4BU4 A;  3PGB A;  1BAN A;  1O7W B;  3U97 A;  2XFS A;  1N9J A;  2E2U A;  3LT8 A;  4WHA A;  3QRD A;  1IVU A;  2Y73 A;  1I2F A;  1RN7 A;  3LXU X;  2BNG A;  5LC6 A;  3K7C A;  1IYY A;  1B2S A;  2FGT A;  3EQQ B;  2W0Q A;  2BO9 B;  1LNH A;  1UUV B;  4K1U A;  1DMN A;  2KF3 A;  1ROV A;  2RNT A;  3QK9 A;  2QGU A;  1ROA A;  1JB2 A;  1RNT A;  1IU7 A;  1SIH A;  1W2Z A;  1UCJ A;  3CU3 A;  3PCR A;  4LGQ A;  4XDV A;  4HOH A;  1LOX A;  4R9K A;  4EXR A;  3G6E 3;  1UI8 A;  1ISK A;  3LH4 A;  4I4K A;  1QAK A;  4K1V A;  1G02 A;  3ROB A;  1YIT 3;  1F8N A;  1JB4 A;  3MWZ A;  4IT7 A;  3CD6 3;  1AVL A;  3F14 A;  2KXG A;  1WMP A;  1IDP A;  4X2H A;  5AYR B;  3FH1 A;  1IVX A;  1U5O A;  3F40 A;  2CG1 A;  1AVK A;  1CYV A;  2RSX A;  3AMO B;  3UL6 A;  3X40 A;  3JUM A;  1MOL A;  3PS8 A;  2MF7 A;  1FZU A;  1E97 A;  5M18 A;  1VQ6 3;  3Q1C A;  3DGL A;  4HJL B;  3X3Y A;  1EG9 B;  5IEP A;  1KC8 4;  1RNB A;  1QVG 2;  3VGN A;  2W56 A;  4R4K A;  3OW2 2;  1FW7 A;  4JRF A;  3KSE D;  4NHF A;  3CCM 3;  4O2H A;  2IMJ A;  1VQ7 3;  5IEO A;  3K63 A;  1WQL B;  4CPK A;  4Q53 A;  1JJ2 2;  3GSP A;  3DH2 A;  1ZO2 A;  3IJE B;  4XB5 A;  3FG1 A;  3RGA A;  1RLS A;  1UUW B;  4BL3 A;  1IQY A;  2H0H A;  1CEW I;  1ASK A;  2OOV C;  3AGO A;  4TX4 A;  5IG5 A;  3UB1 A;  1YVS A;  1B3S A;  3M8C A;  2CFK A;  4HKV B;  4XBY A;  3FLJ A;  1JZO A;  4O02 B;  1YGE A;  1LQM B;  1BRH A;  4K90 B;  4AKZ A;  2K3D A;  1J2B A;  4MMZ B;  4OVM A;  1RRL A;  2F5W A;  4H3U A;  5TGN A;  1A67 A;  4RBN A;  1UCI A;  1AV4 A;  3DGO A;  3SVA A;  4EV2 A;  5RNT A;  1TFK A;  2OTJ 3;  1GOU A;  1BSE A;  2Z76 A;  3HI7 A;  4K61 A;  2GEX A;  1RHL A;  2CWU A;  3S67 A;  1RSN A;  1KQS 2;  1KSI A;  3K5T A;  4AKY A;  3CMA 3;  2F56 A;  3STD A;  1QMA A;  1V57 A;  3T0U A;  1YGW A;  3URP A;  2YX9 A;  3A5E A;  1SQW A;  2Q07 A;  3DGN A;  4J9A A;  5JBS A;  3KCH A;  2BU4 A;  1VQQ A;  3SOY A;  4EYC A;  2RGQ A;  4RNY A;  4R1K A;  1B27 A;  4HM6 B;  1BNF A;  1ZS7 A;  4NRE A;  8CHO A;  1AR0 A;  1W4N A;  3ZFZ A;  5A0O B;  4BIR A;  3ECF A;  2L1S A;  4HVN A;  4LEH A;  1Q40 B;  3SOA A;  4CJN A;  1EA2 A;  2P0M A;  2WOF A;  2F86 B;  5DRE A;  2RBI A;  4L7K A;  3DY5 A;  4N6U A;  1B2Z A;  3WOD G;  3CCL 3;  5AYS C;  6RNT A;  2GXF A;  1KD1 4;  1DE3 A;  1IV7 A;  1OUN A;  3SED A;  1BRJ A;  3OWY A;  1OF5 B;  1RGG A;  2PZV A;  1D6Y A;  1RGE A;  1OHS A;  5BU4 A;  1UW1 A;  1FGM A;  1RCK A;  4MMX B;  1LQG C;  2YFJ B;  4KFF A;  1QVF 2;  3GAX A;  1EUI C;  1LNI A;  1TUH A;  1I8V A;  4KFE A;  3FG4 A;  5G1K A;  1GOV A;  4FMD A;  1YJW 3;  2WGO A;  3LML A;  1A2P A;  3RGR A;  2CFL A;  3KN4 A;  3NV0 A;  1YJN 3;  5STD A;  3NHX A;  1AQZ A;  2CC3 A;  2CWV A;  2HMJ B;  1FUW A;  4EV5 A;  1TP6 A;  3SXX A;  1LOW A;  3D9R A;  2OOV A;  1GD3 A;  1G0T A;  3G16 A;  3CCE 3;  2B24 B;  1IK3 A;  1EQK A;  3MKI A;  1B2U A;  1BNI A;  1GD4 A;  3NQY A;  5DRV A;  2Z77 A;  1X1W A;  1G96 A;  1TTO A;  3OWS A;  4H61 A;  1VQN 3;  1I0X A;  3BNE A;  3S27 A;  4WYK B;  5BXQ A;  1IQX A;  2M7O A;  1K41 A;  4OK0 A;  3EC9 A;  2WGQ A;  3VSY A;  1A90 A;  2CFG A;  3OV4 A;  2HMN B;  1QJG A;  1BSB A;  2QA4 3;  3CPO A;  1DVD A;  4PEJ A;  1R4Y A;  1NB3 I;  1W00 A;  1GYB A;  2CIU A;  3EJV A;  1WMO A;  1BAO A;  1ULI B;  1ZX2 A;  2KF6 A;  2E2V A;  2GSP A;  3EN1 B;  1TJD A;  5GSP A;  1Y4K A;  8RNT A;  3EF8 A;  2O3O A;  3WHO A;  1N8Q A;  3BLZ A;  1SII A;  1X1Y A;  2CHC A;  4LMI A;  2P09 A;  4HAA A;  1K28 A;  3NX0 A;  2IUJ A;  1MGW A;  3K0Z A;  2HMM B;  2JQ5 A;  2B1X B;  1OAC A;  4HYZ A;  2ZA4 A;  1RMS A;  1U8C B;  1BNS A;  1UGH I;  3NXJ A;  3SLU A;  3MSO A;  4XBX A;  1W01 A;  1GY5 A;  3KE7 A;  1I70 A;  3EE1 A;  2D1W A;  2C4B A;  2CH9 A;  3DUK A;  3I0Y A;  3CME 3;  1I2E A;  1BRS A;  3AMO A;  1GMR A;  1RDS A;  1T2I A;  3RDE A;  1Q86 4;  1MWU A;  3FF0 A;  3EBY A;  1DMQ A;  3HOH A;  5CF2 A;  2OTL 3;  4N6N B;  2JDI H;  3HII A;  5IG4 A;  1E3V A;  4LZI A;  1FYS A;  3PZW A;  3G71 3;  3EX9 A;  5CK6 A;  3I56 3;  2ZDJ A;  1BU4 A;  1CH0 A;  3WMD A;  5IG3 A;  5IG0 A;  1BNR A;  2W04 A;  1VQK 3;  3JUN A;  2IYJ A;  3D3L A;  1M90 4;  1OHO A;  3KZT A;  4N6O B;  3VF1 A;  3CCR 3;  7RNT A;  1VQO 3;  3HX8 A;  1CQS A;  4IPB A;  1N9E A;  1YVB I;  2Y74 A;  5CLK A;  5AIG A;  1D6Z A;  1DMM A;  3CNM A;  1I0V A;  4FCZ A;  3FSD A;  1BOX A;  3GRD A;  2PNC A;  5G1L A;  5KP4 A;  2KF5 A;  5D82 A;  5KP3 A;  2IY2 A;  4HZB B;  3BB9 A;  1Q9E A;  2C11 A;  1MWS A;  3GZB A;  1BSD A;  3NQZ A;  4LSO A;  3OXA A;  2KAA A;  1IT7 A;  1TIJ A;  3FG3 A;  1Q81 4;  3MG2 A;  2F99 A;  1X1U A;  3T8N A;  1FGR A;  5AIF A;  1GMQ A;  2F5M A;  3D4A A;  4FMC A;  7STD A;  1N5P A;  1RN1 A;  5LC7 A;  3PCS A;  4ILF A;  3B4P A;  5D81 A;  3PYJ A;  2RFR A;  3MG1 A;  1UCL A;  2CWT A;  3GZX B;  2J8X B;  4GL6 A;  2K54 A;  2OWP A;  2UUG C;  1RGF A;  5BIR A;  2BMO B;  2AAD A;  1DYU A;  1WTH A;  4FR9 A;  4KVH A;  3IMA B;  2IUK A;  1EEJ A;  1N5H A;  3V92 A;  4FCM A;  4KT3 B;  4BTX A;  5JPU A;  1BRK A;  1L5G B;  1Q40 A;  1K9M 4;  4HM0 B;  1RGL A;  1T3B A;  2P38 A;  4HM5 B;  1GY6 A;  1MNL A;  3CPW 2;  1JKG B;  2CFD A;  3A76 A;  3FF2 A;  3LTB A;  3JUO A;  1JB5 A;  3UL5 A;  1YNV X;  4EW5 A;  3F8X A;  1W2B 2;  1IV9 A;  2YFL B;  3T8U A;  2XFT A;  3ER7 A;  3Q90 A;  1QAL A;  3K9M C;  2H0G A;  1SAR A;  2P0X A;  3O8Y A;  1Q7Y 4;  4U13 A;  1HU9 A;  1ZGX A;  1OGX A;  2W9P A;  3G0K A;  2P05 A;  3TDG A;  3CNX A;  5IEN A;  2R41 A;  5ELJ A;  3B8L A;  1JNQ A;  1UDI I;  4XBT A;  4FCJ A;  5AEW B;  3B4O A;  3BND A;  1JBS A;  1D6U A;  1LRA A;  1W6Y A;  2IA7 A;  3X3Z A;  3RNT A;  2F98 A;  1WMN A;  3X41 A;  1OPY A;  1BIR A;  2SBL A;  1TFO A;  1O7N B;  5ELU A;  2GBX B;  3X42 A;  1M1X B;  1V74 A;  3CC4 3;  1CYU A;  2XSH B;  2WO0 A;  1E3R A;  3DGM A;  3CXC 2;  1GY7 A;  1NB5 I;  3DMC A;  2OQE C;  4GHO A;  2HMO B;  4DKI A;  1N8R 4;  1WNH A;  3LT9 A;  1NDO B;  1JN5 B;  2FXT A;  3KFQ C;  3FCS B;  3WOF B;  2SAR A;  4WYK A;  5AI1 A;  1RCL A;  1BNJ A;  4I5Q A;  1LOV A;  4XDW A;  2A15 A;  3GZY B;  2CW9 A;  1PFP A;  3ZG0 A;  1BUQ A;  1FA3 A;  2Z7A A;  4CDL A;  1I3F A;  1JRQ A;  2ML6 A;  2W03 A;  2XGL A;  1OGZ A;  3BU4 A;  3G8Z A;  1S72 3;  3WA2 X;  3N54 B;  2XEP A;  4J5K A;  2W6J H;  5HGR A;  3AHS A;  1W6G A;  2BT3 A;  2CG0 A;  1I3I A;  2E2T A;  4HZ9 B;  1NO3 A;  3E99 A;  5BVB A;  1M1K 4;  1NNV A;  1GSP A;  2GU3 A;  2XGN A;  2FNQ A;  3MHE A;  1UUG B;  1O7P B;  2W9Q A;  2YFI B;  3BIR A;  2K0M A;  3D5G A;  4XM4 A;  3U1W A;  3BNB A;  3NBB A;  6GSP A;  3CCU 3;  1PYL A;  1VQ9 3;  3HZP A;  1RJO A;  1Q7H A;  1IT8 A;  1B2X A;  3IPT A;  3SYU A;  3CC7 3;  1BGS A;  1W02 A;  2RCD A;  4RNZ A;  5G2G A;  3LOY A;  1MWT A;  2BMQ B;  2LYX A;  3Q2P A;  4HM8 B;  5AII A;  2UX0 A;  4FMB A;  4AEQ A;  1B21 A;  1IVW A;  3NM7 A;  1SJW A;  3FGY A;  1RGK A;  3DGY A;  1VQ4 3;  2BIR A;  4MEI A;  3OWU A;  3UNL A;  1KWI A;  4RNT A;  1FGO A;  2CFW A;  4J5G A;  1HYF A;  1HKX A;  2I9W A;  3DM8 A;  4FMA A;  3LYG A;  1Q42 A;  1BRN L;  4ZM8 A;  1PU4 A;  1UI7 A;  3NBR A;  1VQP 3;  1JBR A;  1OHP A;  3G4S 3;  2MC8 A;  4KFD A;  1IVV A;  3HIG A;  3S28 A;  1BNE A;  2L4V A;  1RKY A;  4IIA A;  1GMP A;  2BHM A;  2V1L A;  2STD A;  4NPB A;  2QIY A;  1NU3 A;  4N6V 0;  1BVI A;  1LXE A;  1UCK A;  3H51 A;  3WDG B;  2CK3 H;  3LTA A;  3NM2 A;  4WWU C;  1HZ1 A;  1FUT A;  2F4Y A;  1A2V A;  2KF4 A;  3LTD A;  3FKA A;  1OCV A;  3F7X A;  1STD A;  6STD A;  5IER A;  2OQE A;  2C10 A;  3BNC A;  4N6M A;  1VZZ A;  1W6C A;  1IQ8 A;  1X1X A;  3CC2 3;  5M1A A;  1DVC A;  5EEO A;  2XRX B;  1OH0 A;  1RN4 A;  5FW5 A;  1B20 A;  2R4I A;  3HK4 A;  3V99 A;  1AY7 A;  3FZW A;  1YIJ 3;  3ALA A;  2BMR B;  1T2H A;  1VQL 3;  2W56 B;  2CX1 A;  3JVC A;  3PXM A;  3CCS 3;  5CXO A;  3CCQ 3;  1JZD A;  3KKG A;  1ULJ B;  2O9U X;  3S29 A;  1EKM A;  1BSC A;  4L8O A;  3SX1 A;  2CX0 A;  1FGQ A;  1B2M A;  1RGH A;  1DET A;  2ML5 A;  3MYT A;  5M19 A;  4O3V A;  2QEX 3;  4BTY A;  4HM4 B;  2KRT A;  3WA3 A;  3ZG5 A;  3F9S A;  3B7C A;  5FGO A;  2XR8 B;  1C7H A;  1JV2 B;  2KCD A;  2XF3 A;  3DZL A;  4EBG A;  4WP5 A;  4G1M B;  5EQL A;  1TRQ A;  1JBT A;  1FUS A;  1FGT A;  4QWT A;  1BRI A;  3WR2 A;  3X3X A;  2GU1 A;  1JKG A;  5HOH A;  2AAE A;  3D5I A;  5JPP A;  1Q82 4;  1BUJ A;  4R80 A;  1C54 A;  3NBJ A;  3CCJ 3;  4OUQ A;  3CCV 3;  3MPH A;  1M9G A;  1RGC A;  1VQM 3;  5I97 A;  1STF I;  4MJD A;  4O8S A;  5D83 A;  1OF5 A;  3GWR A;  4LYL B;  4N3V A;  3KSP A;  2CKF B;  4BTW A;  3S5C A;  4HBR A;  4RZM A;  1LOY A;  1O7G B;  1SPU A;  1NJI 4;  2XSO B;  2HML B;  2Z6B A;  1T5Y A;  1QAF A;  2ZL8 A;  4JF8 A;  3EHC A;  2HMK B;  2D42 A; 
#chains in the Genus database with same CATH homology
 1I3F A;  1I2E A;  2F5W A;  3BU4 A;  1BRS A;  1GMR A;  1PY3 A;  1RDS A;  1T2I A;  1UCI A;  4J5K A;  3AHS A;  3HOH A;  1I3I A;  5RNT A;  3AGN A;  1C54 A;  3AHW A;  1GSP A;  1GOU A;  1BSE A;  1FYS A;  1RHL A;  3BIR A;  1RSN A;  3D5G A;  6GSP A;  1BU4 A;  1PYL A;  2F56 A;  1CH0 A;  1B2X A;  3SYU A;  1BGS A;  1BNR A;  1YGW A;  3URP A;  3A5E A;  7GSP A;  1B21 A;  2HOH A;  3KCH A;  2BU4 A;  1RGK A;  1RTU A;  3DGY A;  2BIR A;  1BRG A;  7RNT A;  4GSP A;  4RNT A;  1B27 A;  1BNF A;  1I0V A;  1MGR A;  9RNT A;  1GOY A;  3Q3F A;  4J5G A;  1BOX A;  1HYF A;  4BIR A;  1BRN L;  2KF5 A;  1RGA A;  1I2G A;  1Q9E A;  1JBR A;  1BSD A;  2KAA A;  2RBI A;  1X1U A;  1B2Z A;  1BNE A;  6RNT A;  1GMP A;  1GMQ A;  2F5M A;  3D4A A;  1DE3 A;  1BSA A;  1BRJ A;  1BVI A;  1RGG A;  1RN1 A;  1UCK A;  1RGE A;  5BU4 A;  1HZ1 A;  1RCK A;  1UCL A;  1BNG A;  1FUT A;  1TRP A;  2F4Y A;  2KF4 A;  4BU4 A;  1BAN A;  1LNI A;  1I8V A;  1RGF A;  5BIR A;  1GOV A;  2AAD A;  1X1X A;  1A2P A;  1I2F A;  1AQZ A;  1IYY A;  1BRK A;  1B2S A;  1RN4 A;  1B20 A;  1LOW A;  1AY7 A;  1RGL A;  2KF3 A;  2RNT A;  1T2H A;  1RNT A;  1UCJ A;  1YNV X;  1B2U A;  1BNI A;  4HOH A;  1BSC A;  1X1W A;  1TTO A;  1I0X A;  1G02 A;  1B2M A;  1RGH A;  1DET A;  1SAR A;  1ZGX A;  1BSB A;  1JBS A;  1R4Y A;  1LRA A;  4HAA A;  1BAO A;  3RNT A;  2KF6 A;  2GSP A;  5GSP A;  1BIR A;  1TRQ A;  8RNT A;  1JBT A;  1FUS A;  1FZU A;  3WHO A;  1BRI A;  1X1Y A;  3WR2 A;  1MGW A;  5HOH A;  2AAE A;  1RNB A;  3D5I A;  1BUJ A;  4GHO A;  1FW7 A;  2ZA4 A;  1RMS A;  1RGC A;  1BNS A;  3GSP A;  3DH2 A;  2SAR A;  1RLS A;  1RCL A;  1BNJ A;  1LOV A;  3AGO A;  1LOY A;  1YVS A;  1B3S A;  1I70 A;  2C4B A;  1BRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...