5CF2A

Crystal structure of the i80y/l114v/i116v mutant of leh
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal Structure of the I80Y/L114V/I116V mutant of LEH
rcsb
source organism Rhodococcus erythropolis
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5cf2A00
3H3HA 3OWYA 5AEWB 1CQSA 3NV0B 3EHCA 1OGXA 4KVHA 1E3VA 3WMDA 1W02A 1O7NB 1ULJB 3DXOA 3B4OA 3OXAA 1OHSA 3GZYB 3EBTA 1OUNA 5IENA 5IEPA 1EG9B 1GY5A 1DMQA 4XBXA 5EVHA 3E99A 4STDA 3FF0A 4J8TA 2BMOB 1OPYA 1AR0A 1OGZA 4ORLA 2YFJB 4HJLB 5FW5A 1HKXA 3HX8A 3EJVA 5BVBA 2HMOB 1JN5A 4K1UA 5AIGA 1C7HA 5IERA 3BB9A 3FF2A 1VZZA 3H51A 5CLKA 3K7CA 2INXA 4XM4A 3BLZA 2HMLB 4I4KA 4K1VA 5IG5A 2A15A 3MG2A 1ZX2A 2JQ5A 2XSOB 4R1KA 1EA2A 3JUNA 3OWSA 3LZAA 2BMQB 5CK6A 1GY6A 1A2KA 3G8ZA 2YFIB 5DREA 1ISKA 4RZMA 4OVMA 3EQQB 3EX9A 5KP1A 7STDA 4HVNA 4J9AA 4L7KA 1GYBA 3ER7A 3EN8A 3IPTA 3OX9A 3KSPA 3B8LA 5IF6A 2HMNB 3F8HA 1QMAA 3S5CA 2Z76A 3MSOA 2RCDA 1O7WB 4HZ9B 1O7PB 2B1XB 5DRVA 1Q40A 2R4IA 1ZO2A 2HMMB 4Q53A 3NHXA 5D83A 1E3RA 2GBXB 1JB5A 3GZRA 3KKGA 4R9LA 4XDVA 4WP5A 1O7GB 3JUOA 4HM1B 4WYKA 4HM3B 2CKFB 2F99A 1U5OA 4XB5A 1OF5A 3RGAA 1JN5B 3NBRA 2PZVA 2QIYA 4L8OA 5AEUB 2XRXB 2Z7AA 1TP6A 4GB5A 4PEJA 1JB4A 3FZWA 2XR8B 1JKGA 1W00A 3NXJA 3LYGA 1JB2A 3MYTA 2GBWB 3SOAA 3DZLA 3GRDA 3DUKA 3EF8A 3F40A 1W6YA 1W01A 1S5AA 3NM2A 2BNGA 1Z1SA 3OWUA 5AIHA 1STDA 3FKAA 5AIIA 1WQLB 2STDA 4HM4B 4X2HA 2OWPA 5STDA 3F9SA 4WWUC 3UNLA 5AIFA 3F7SA 3CNMA 2UX0A 8CHOA 3JUQA 1OCVA 5D82A 3KZTA 2GXFA 3EBYA 1Q40B 2BMRB 3A76A 1OHOA 4N3VA 3KE7A 4XDWA 2F86B 1E97A 1OHPA 2HMJB 1ASKA 2YFLB 3STDA 2XSHB 1O7MB 3DMCA 1IDPA 2Z77A 3RGRA 4WYKB 4XBTA 1OF5B 1UUVB 3JUPA 4HM5B 3EC9A 4H3UA 1NWWA 3MG3A 3VSYA 1DMMA 3MG1A 2K54A 3T8UA 4XBYA 3FSDA 3B4PA 1JKGB 2B24B 3CU3A 2RFRA 3VGNA 5D81A 5IG4A 4HM0B 5CF1A 1Q42A 2GEXA 5JPUA 3CPOA 3F14A 3K0ZA 3G0KA 4L8PA 3DM8A 2GEYA 5TGNA 3NV0A 5KP4A 1TUHA 3HZPA 1K41A 3G16A 4LMIA 3GZBA 2QGUA 4MJDA 4HM8B 4LEHA 1BUQA 2CHCA 3F8XA 3T8NA 3MHEA 1O7HB 3FLJA 3B7CA 5HGRA 3GZXB 1SJWA 3CNXA 3FH1A 5IG0A 3ROBA 4R9KA 1GY7A 1ULIB 3EN1B 3SOYA 1DMNA 1GS3A 5BXQA 5IEOA 2F98A 4U13A 3SEDA 3JUMA 3I0YA 3HK4A 1NU3A 2I9WA 4FCMA 1UUWB 4LGQA 3D9RA 5IG3A 4FCJA 5CF2A 5G2GA 2HMKB 4HZBB 4CDLA 4IIAA 4OUQA 4X2OA 3MKIA 3M8CA 5KP3A 5JPPA 1NDOB 3GWRA 2W2CA 3Q90A 1QJGA 3F7XA 3UJMA 6STDA 3ECFA 3OV4A 4HM7B 2IMJA 4HKVB 3NUVA 4HM2B 5AI1A 2RGQA 1OH0A 3FGYA 4HM6B 5CXOA
chains in the Genus database with same CATH superfamily
2YX9A 4LZIA 3H3HA 4AEQA 3OWYA 1A67A 1MNLA 1B21A 5JBSA 3WODG 3LTBA 5AEWB 1CQSA 3NV0B 1IQXA 2J8XB 3ZG5A 3CCV3 3EHCA 1OGXA 4K61A 4KVHA 1D6ZA 1E3VA 3LH4A 4HAAA 3WDGB 3WMDA 3Q3FA 3S29A 1W02A 1RCLA 1O7NB 1ULJB 2JDIH 1LNHA 3DXOA 5IW9A 5EQLA 3B4OA 3OXAA 1BSEA 2CW9A 1OHSA 4BIRA 4N6V0 3GZYB 2KXGA 3KSED 1JBRA 3DGLA 5GSPA 3EBTA 1OUNA 5IENA 5IEPA 2SARA 4FMBA 4GL6A 1EG9B 2CWVA 3GAXA 1GY5A 1DMQA 4XBXA 5EVHA 1M1XB 1SIIA 2LQVA 3AHSA 3E99A 3FG3A 3HIIA 4STDA 5M18A 1RGKA 4ZM8A 3FF0A 4N6MA 1AVLA 4J8TA 1IT8A 1A90A 2BMOB 2ZDJA 4JF8A 1I2FA 2Y74A 3AMOB 2OTL3 1OPYA 1WMOA 2W56B 1HU9A 1I2EA 1UCIA 2W6JH 3UL6A 2P38A 5ELJA 5BU4A 1AR0A 1OGZA 4ORLA 4O02B 2CG1A 2YFJB 4HJLB 5FW5A 1HKXA 4OK0A 1RN4A 1LQMB 1YJW3 3TDGA 1M904 1TJDA 2IYJA 1MWUA 3EJVA 3HX8A 4RNYA 3T0UA 5A0OB 1UGHI 5BVBA 1BNGA 2HMOB 1JN5A 4K1UA 5AIGA 1C7HA 3EB8A 1W7CA 1GSPA 5IERA 2XF3A 3BB9A 3WOFB 1FZUA 3FF2A 4CJNA 1VZZA 3H51A 5RNTA 3PCSA 1ROVA 2D42A 5CLKA 3K7CA 3X3XA 3CD63 1YJ93 1PYLA 2INXA 4XM4A 4HYZA 3BLZA 3KN4A 3X41A 2HMLB 4WHAA 4AKZA 1ZGXA 4I4KA 3CC23 1HYFA 2ML5A 4K1VA 4BTYA 2F56A 5IG5A 2XGNA 1VQN3 3AMOA 1RNTA 1B3SA 2A15A 3MG2A 3QRDA 1ZX2A 3O8YA 2JQ5A 1GMPA 1T3BA 1VQM3 2XSOB 4FR9A 1D6YA 4R1KA 4IT7A 1EA2A 2D1WA 3JUNA 3OWSA 3LZAA 1CYVA 4J5KA 2BMQB 1X1WA 1GY6A 1RLSA 5CK6A 1A2KA 3G8ZA 1I0XA 1W2ZA 3K5TA 3PYJA 3PGBA 5EEOA 2BT3A 2YFIB 5DREA 1ISKA 4RZMA 4OVMA 3EQQB 3EX9A 5KP1A 6RNTA 7STDA 6GSPA 2KF3A 3N9HA 1BRGA 2AAEA 4HVNA 4J9AA 4L7KA 3G713 1GYBA 2XFSA 4O2HA 3ER7A 1T5YA 3G6E3 2E2UA 3EN8A 5G1KA 3IPTA 4NHFA 2HOHA 1A2VA 3OX9A 4MMXB 1RGAA 1K28A 1LXEA 5M19A 3V98A 2W04A 3S67A 1LOYA 3Q2PA 2C11A 1RHLA 3KSPA 2H0GA 4KFDA 1MWRA 1N8QA 1K8A4 2H0IA 3B8LA 5IF6A 1ROAA 1I8VA 2HMNB 3F8HA 1DETA 1QMAA 3S5CA 4BU4A 1RN7A 2O3OA 1SPUA 2Z76A 3LT8A 2KRTA 1K734 3RDEA 4BL3A 3D5GA 3MSOA 2RCDA 3DGYA 2OQEA 1K9M4 1O7WB 5LC6A 1N5HA 1T2IA 1UDII 3NX0A 4HZ9B 1O7PB 3NBJA 2B1XB 2W0QA 5DRVA 1JNQA 1Q40A 1IQ8A 2BIRA 2R4IA 3CCQ3 1PY3A 1ZO2A 2WO0A 2HMMB 4Q53A 1RKYA 3NHXA 5D83A 3ZFZA 1E3RA 2CFDA 1Q7HA 2GBXB 1UUGB 2P0MA 3D4AA 1DE3A 1FUTA 2FGTA 4ILFA 1FGMA 4LSOA 1U8CB 1NB5I 2MC8A 1KWIA 1JB5A 1W5ZA 2UUGC 3GZRA 4IPBA 3KKGA 1M9GA 4CCVA 3CXC2 2XH9A 1N5PA 3BIRA 4EW5A 2CC3A 3FG1A 4R9LA 1UCKA 1S723 1JBTA 4XDVA 4N6OB 3DH2A 4WP5A 1O7GB 2XFTA 3JUOA 3L0RA 1B2SA 1YVSA 4HM1B 1LNIA 4JRFA 1YGWA 4WYKA 4HM3B 2CKFB 2F99A 2CWTA 1RGLA 1AY7A 1CEWI 1U5OA 4XB5A 3ZG0A 1OF5A 1D6UA 3RGAA 3CC73 3OW22 3MPHA 3AGNA 1JN5B 1W6GA 1KSIA 2C10A 1QAFA 2P09A 4O3VA 3NBRA 3CCJ3 2BU4A 1I3IA 3SX1A 2CH9A 1RNBA 2PZVA 1G96A 4K90B 1BNEA 2P05A 4J5GA 2QIYA 4L8OA 5AEUB 2KF6A 1FGQA 3CME3 4EYCA 1DVDA 1RCKA 5LC7A 1WMNA 2GSPA 2XRXB 2M7OA 1BRJA 3WHOA 1VQ53 4RNTA 3PZWA 1BNSA 1QALA 1YVBI 1VQQA 2Z7AA 1TP6A 4GB5A 4PEJA 1TRPA 1JB4A 1OACA 2K0MA 3FZWA 1MGRA 2E2VA 2BHMA 1BRNL 3WA3A 2XR8B 1VQP3 1JKGA 3FG4A 3URPA 3K9MC 1VQ43 4EV2A 1W00A 1A2PA 3NXJA 4BL2A 3LYGA 2XGLA 1QVG2 1CYUA 1JB2A 3LMLA 2OCTA 1W2B2 3MYTA 2GBWB 5G1LA 1V74A 3SOAA 3DZLA 4LYLB 3GRDA 1X1UA 1NB3I 1ZS7A 3DUKA 3EF8A 3F40A 1W6YA 3LOYA 5FGOA 1T2HA 1TFKA 3WR2A 1W01A 1S5AA 3CPW2 1NO3A 1SARA 2CFWA 2UGIA 1JBSA 1BNRA 3NM2A 1BU4A 2RSXA 4RNZA 2C4BA 2BNGA 1Z1SA 1R4YA 1YIJ3 3OWUA 5AIHA 1GD4A 1STDA 3FKAA 1WQLB 5AIIA 1MOLA 2STDA 1TIJA 1IV9A 4HM4B 1UCLA 1IT7A 3DGMA 2LYXA 2OWPA 3KCHA 1G02A 2W9QA 1UGIA 3BNCA 4X2HA 3F9SA 3LXUX 4WWUC 5STDA 3UNLA 5AIFA 3F7SA 3CNMA 3NM7A 2UX0A 1X1XA 3WOEB 1BUJA 4KFFA 4GHOA 8CHOA 3JUQA 1OCVA 1BANA 1C54A 3D3LA 3AHWA 4N6LA 5D82A 1IK3A 5AYRB 3KZTA 4FCZA 2GXFA 3EBYA 1M1K4 3PXMA 4R4KA 5HOHA 2WOHA 1Q40B 1B2ZA 2BMRB 1JZOA 3IJEB 1PU4A 1SQWA 1RGCA 3A76A 2OOVC 2CWUA 1B2MA 1BSDA 1OHOA 2OQEC 4FMDA 1VQ83 4O8SA 2QEX3 4GSPA 2IUJA 3EE1A 3SVAA 4N3VA 3KE7A 4DKIA 3LT9A 1RGGA 4XDWA 1YIT3 3DGNA 1VQ63 2F86B 1VQK3 1BRSA 1E97A 1OHPA 2Z6BA 3BNDA 3X3ZA 1VQL3 1FA3A 1MGWA 2HMJB 2ML6A 1B20A 4MEIA 1ASKA 1US1A 2YFLB 3STDA 2XSHB 1TFOA 1O7MB 2OOVA 2QA43 1IVWA 3DMCA 3CC43 1FGRA 1IDPA 2ZA4A 3X42A 2Z77A 3I563 1QVF2 1NJI4 2KCDA 3RGRA 5M1AA 4WYKB 2PNCA 1BAOA 4XBTA 1OF5B 1IVVA 1KC84 4N6NB 1LOXA 1BNIA 1UUVB 2KF4A 3JUPA 1BVIA 4HM5B 1F8NA 1UW1A 2AADA 3QK9A 7RNTA 1WTHA 2MF7A 3EC9A 1VQ73 4H3UA 1NWWA 4N6TA 4R80A 3CCS3 2IY2A 1BIRA 3MG3A 3VSYA 4AKYA 1Y4KA 2K3DA 1DMMA 3MG1A 1MWTA 3S27A 1GMRA 2K54A 3VF1A 1WNHA 3T8UA 3DY5A 2E2TA 1LOVA 3A5EA 4XBYA 2FXTA 3FSDA 1YGEA 3B4PA 1PFPA 1EEJA 1JKGB 1FUSA 1JZDA 1EQKA 1BRHA 1HZ1A 2R41A 1JV2B 3GSPA 3J7Yd 1NNVA 2B24B 3CU3A 1RGFA 1RGHA 2RFRA 4TX4A 3VGNA 2CFKA 5D81A 3N8BA 4KZ1A 1FGOA 3SLUA 5IG4A 4HM0B 5CF1A 3CCR3 1Q42A 1Q9EA 1VQ93 2FNQA 2GEXA 4CPKA 3HOHA 1FGTA 1BSBA 2ZL8A 5JPUA 1Q814 8RNTA 1GOVA 3LTCA 3CPOA 3F14A 2F5WA 3K0ZA 2F4YA 2CG0A 3LTAA 3G0KA 4HOHA 2CX0A 2OTJ3 3Q1CA 1I3FA 1LQGC 1UI8A 1EKMA 4BTWA 1DVCA 4L8PA 3UB1A 1RJOA 5AYSC 2GU1A 3K63A 3X40A 3DM8A 1I0VA 3FCSB 2GEYA 5TGNA 1AV4A 3NV0A 3PS8A 5KP4A 1TUHA 3HZPA 1K41A 2CK3H 1W6CA 3G16A 4LMIA 2IA7A 1RDSA 3GZBA 4I5QA 1RRHA 1BNJA 2QGUA 1TU5A 1KQS2 7GSPA 1RMSA 4MJDA 1AVKA 1LOWA 4HM8B 4LEHA 1RRLA 2KF5A 1BUQA 2CHCA 1IU7A 1J2BA 1MWSA 3F8XA 1IVXA 3T8NA 4EBGA 1BRKA 3HI7A 3MHEA 4WFOA 1O7HB 1IVUA 1KD14 1I70A 3FLJA 3B7CA 3CCM3 1X1YA 2W9PA 5HGRA 3GZXB 1SJWA 3CNXA 3KFQC 3FH1A 5IG0A 3ROBA 1B2UA 1Q824 1LVNA 4R9KA 1GY7A 1N9EA 4BTXA 2SBLA 1YI23 1UI7A 1TRQA 3RNTA 4EV5A 1IV7A 1ULIB 4QWTA 1BNFA 2L1SA 3U1WA 3EN1B 4RBNA 3SOYA 2H0HA 3I553 2CFLA 3BNBA 3BNEA 3N54B 2W56A 1YHQ3 1N8R4 2CIUA 4KT3B 4HBRA 4EXRA 3HIGA 1DMNA 1GS3A 1Q864 5BXQA 4MMYB 2Y73A 1B27A 1BGSA 3NQYA 3ALAA 1IQYA 5ELUA 3UL5A 3CCU3 1GOUA 2O9UX 3U97A 5IEOA 2F98A 1BSAA 2CX1A 1RN1A 4U13A 2CFGA 3KIIA 3SEDA 1TTOA 3JUMA 4MMZB 9RNTA 3NQZA 3I0YA 3G4S3 1STFI 1V58A 3HK4A 1NU3A 2I9WA 4FCMA 2F5MA 1UUWB 2W03A 1V57A 3D79A 1JRQA 3MWZA 1L5GB 2XEPA 2WGQA 4NPBA 1W4NA 1YNVX 1GOYA 4LGQA 2L4VA 3D9RA 1FUWA 5IG3A 1YJN3 3IMAB 1BRIA 3BU4A 4FCJA 3SXXA 4FMCA 5CF2A 4G1MB 5G2GA 2HMKB 4HZBB 3V99A 4CDLA 3JVCA 1R4CA 1QAKA 4IIAA 1FW7A 4OUQA 3NBBA 4NREA 2GU3A 3S28A 4FMAA 3PCRA 1GMQA 1WMPA 3MKIA 4X2OA 3M8CA 5KP3A 5JPPA 1DYUA 1NDOB 2KAAA 1RTUA 3GWRA 2Q07A 2WGOA 1BSCA 1I2GA 1SIHA 2W2CA 3Q90A 3LTDA 2ZHXB 1BOXA 1GD3A 1QJGA 2P0XA 3F7XA 3UJMA 4EC6A 2BO9B 1IYYA 3X3YA 1AQZA 1EUIC 1Q7Y4 1VQO3 1RSNA 6STDA 2IUKA 1RGEA 4N6UA 3ECFA 3SYUA 2RNTA 4H61A 3WA2X 3OV4A 1CH0A 3D5IA 1LRAA 4HM7B 1G0TA 2IMJA 5BIRA 1UCJA 1B2XA 4HKVB 1FYSA 5I97A 3NUVA 4HM2B 4KFEA 2WOFA 5AI1A 2RGQA 3DGOA 1JJ22 1OH0A 3FGYA 3V92A 3CCE3 3CCL3 3CMA3 3AGOA 2RBIA 1N9JA 4HM6B 5CXOA 2V1LA
chains in the Genus database with same CATH topology
2YX9A 4LZIA 3H3HA 4AEQA 3OWYA 1A67A 1MNLA 5JBSA 3WODG 3LTBA 5AEWB 1CQSA 3NV0B 1IQXA 3CCV3 3EHCA 1OGXA 4K61A 4KVHA 1D6ZA 1E3VA 3LH4A 3WDGB 3WMDA 3S29A 1W02A 1O7NB 1ULJB 2JDIH 1LNHA 3DXOA 5IW9A 5EQLA 3B4OA 3OXAA 2CW9A 1OHSA 4N6V0 3GZYB 2KXGA 3KSED 3DGLA 3EBTA 1OUNA 5IENA 5IEPA 4FMBA 4GL6A 1EG9B 2CWVA 3GAXA 1GY5A 1DMQA 4XBXA 5EVHA 1M1XB 1SIIA 2LQVA 3FG3A 3E99A 3HIIA 4STDA 4ZM8A 3FF0A 4N6MA 1AVLA 4J8TA 1IT8A 1A90A 2BMOB 2ZDJA 4JF8A 3AMOB 2Y74A 2OTL3 1OPYA 1WMOA 2W56B 1HU9A 2W6JH 3UL6A 2P38A 5ELJA 1AR0A 1OGZA 4ORLA 4O02B 2CG1A 2YFJB 4HJLB 5FW5A 1HKXA 4OK0A 1YJW3 3TDGA 1M904 3HX8A 3T0UA 3EJVA 5A0OB 4RNYA 5BVBA 2HMOB 1JN5A 4K1UA 5AIGA 1C7HA 3EB8A 1W7CA 5IERA 2XF3A 3BB9A 3WOFB 3FF2A 1VZZA 3H51A 3PCSA 1ROVA 2D42A 5CLKA 3K7CA 3X3XA 3CD63 1YJ93 2INXA 4XM4A 4HYZA 3BLZA 3KN4A 3X41A 2HMLB 4WHAA 4AKZA 4I4KA 3CC23 2ML5A 4K1VA 1VQN3 4BTYA 5IG5A 2XGNA 3AMOA 2A15A 3MG2A 3QRDA 1ZX2A 3O8YA 2JQ5A 1VQM3 2XSOB 4FR9A 1D6YA 4R1KA 4IT7A 1EA2A 2D1WA 3JUNA 3OWSA 3LZAA 1CYVA 2BMQB 5CK6A 1GY6A 1A2KA 3G8ZA 1W2ZA 3K5TA 3PYJA 3PGBA 5EEOA 2BT3A 2YFIB 5DREA 1ISKA 4RZMA 4OVMA 3EQQB 3EX9A 5KP1A 7STDA 3N9HA 4HVNA 4J9AA 4L7KA 3G713 1GYBA 2XFSA 4O2HA 3ER7A 1T5YA 3G6E3 2E2UA 3EN8A 3IPTA 4NHFA 1A2VA 3OX9A 4MMXB 1K28A 1LXEA 3V98A 2W04A 3S67A 3Q2PA 2C11A 3KSPA 4KFDA 1N8QA 1K8A4 3B8LA 5IF6A 1ROAA 2HMNB 3F8HA 1QMAA 3S5CA 1RN7A 2O3OA 1SPUA 2Z76A 3LT8A 2KRTA 1K734 3RDEA 3MSOA 2RCDA 1K9M4 2OQEA 1O7WB 5LC6A 1N5HA 3NX0A 4HZ9B 1O7PB 3NBJA 2B1XB 2W0QA 5DRVA 1JNQA 1Q40A 1IQ8A 2R4IA 3CCQ3 1ZO2A 2WO0A 2HMMB 4Q53A 1RKYA 3NHXA 5D83A 1E3RA 2CFDA 2GBXB 2P0MA 2FGTA 1FGMA 4LSOA 1U8CB 2MC8A 1KWIA 1JB5A 1W5ZA 3GZRA 4IPBA 3KKGA 1M9GA 4CCVA 3CXC2 2XH9A 1N5PA 2CC3A 3FG1A 4R9LA 1S723 4XDVA 4N6OB 4WP5A 1O7GB 2XFTA 3JUOA 3L0RA 4HM1B 4JRFA 4WYKA 4HM3B 2CKFB 2F99A 2CWTA 1CEWI 1U5OA 4XB5A 1OF5A 1D6UA 3RGAA 3CC73 3OW22 3MPHA 1JN5B 1W6GA 1KSIA 2C10A 1QAFA 2P09A 4O3VA 3NBRA 3CCJ3 3SX1A 2CH9A 2PZVA 1G96A 4K90B 2P05A 2QIYA 4L8OA 5AEUB 1FGQA 3CME3 4EYCA 1DVDA 5LC7A 1WMNA 2XRXB 2M7OA 1VQ53 3PZWA 1QALA 1YVBI 2Z7AA 1TP6A 4GB5A 4PEJA 1JB4A 1OACA 2K0MA 3FZWA 2E2VA 2BHMA 3WA3A 2XR8B 1VQP3 1JKGA 3FG4A 1VQ43 3K9MC 4EV2A 1W00A 3NXJA 3LYGA 2XGLA 1QVG2 1CYUA 1JB2A 3LMLA 2OCTA 1W2B2 3MYTA 2GBWB 1V74A 3SOAA 3DZLA 3GRDA 1NB3I 3DUKA 3EF8A 3F40A 1W6YA 3LOYA 5FGOA 1TFKA 1W01A 1S5AA 3CPW2 1NO3A 2CFWA 3NM2A 2RSXA 4RNZA 2BNGA 1Z1SA 1YIJ3 3OWUA 5AIHA 1GD4A 1STDA 3FKAA 1WQLB 5AIIA 2STDA 1MOLA 1TIJA 1IV9A 4HM4B 3DGMA 1IT7A 5AYRB 2LYXA 2OWPA 4X2HA 2W9QA 5STDA 3BNCA 1NB5I 3F9SA 3LXUX 4WWUC 3UNLA 5AIFA 3F7SA 3CNMA 3NM7A 2UX0A 3WOEB 4KFFA 8CHOA 3JUQA 1OCVA 3D3LA 4N6LA 5D82A 1IK3A 3KZTA 4FCZA 2GXFA 3EBYA 1M1K4 3PXMA 4R4KA 2WOHA 1Q40B 2BMRB 3IJEB 1PU4A 1SQWA 3A76A 2OOVC 2CWUA 1OHOA 2OQEC 4FMDA 1VQ83 4O8SA 2QEX3 2IUJA 3EE1A 3SVAA 4N3VA 3KE7A 3LT9A 4XDWA 1YIT3 3DGNA 1VQ63 2F86B 1VQK3 1E97A 1OHPA 2Z6BA 3BNDA 3X3ZA 1VQL3 1FA3A 2HMJB 2ML6A 4MEIA 1ASKA 1US1A 2YFLB 3STDA 2XSHB 1TFOA 1O7MB 2OOVA 2QA43 1IVWA 3DMCA 3CC43 1FGRA 1IDPA 3X42A 3I563 2Z77A 1QVF2 1NJI4 2KCDA 3RGRA 4WYKB 2PNCA 4XBTA 1OF5B 1IVVA 1KC84 4N6NB 1LOXA 1UUVB 3JUPA 4HM5B 1F8NA 1UW1A 3QK9A 1WTHA 2MF7A 3EC9A 1VQ73 4H3UA 1NWWA 4N6TA 4R80A 3CCS3 3MG3A 3VSYA 4AKYA 1Y4KA 1DMMA 3MG1A 3S27A 2K54A 3VF1A 1WNHA 3T8UA 3DY5A 2E2TA 4XBYA 2FXTA 3FSDA 1YGEA 3B4PA 1PFPA 1JKGB 1EQKA 1JV2B 3J7Yd 2B24B 3CU3A 2RFRA 4TX4A 3VGNA 2CFKA 5D81A 3N8BA 4KZ1A 1FGOA 3SLUA 5IG4A 4HM0B 5CF1A 3CCR3 1Q42A 1VQ93 2FNQA 2GEXA 1FGTA 2ZL8A 5JPUA 1Q814 3LTCA 3CPOA 3F14A 3K0ZA 2CG0A 3LTAA 3G0KA 2OTJ3 3Q1CA 1UI8A 1EKMA 4BTWA 1DVCA 4L8PA 3UB1A 1RJOA 5AYSC 2GU1A 3K63A 3X40A 3DM8A 3FCSB 2GEYA 5TGNA 1AV4A 3NV0A 3PS8A 5KP4A 1TUHA 3HZPA 1K41A 2CK3H 1W6CA 3G16A 4LMIA 2IA7A 3GZBA 1KQS2 1RRHA 1TU5A 2QGUA 4MJDA 1AVKA 4HM8B 4LEHA 1RRLA 1BUQA 2CHCA 1IU7A 1J2BA 3F8XA 3T8NA 1IVXA 4EBGA 3HI7A 3MHEA 4WFOA 1O7HB 1IVUA 1KD14 3FLJA 3CCM3 3B7CA 2W9PA 5HGRA 3GZXB 1SJWA 3CNXA 3KFQC 3FH1A 5IG0A 3ROBA 1Q824 1LVNA 4R9KA 1GY7A 1N9EA 4BTXA 2SBLA 1YI23 1UI7A 4EV5A 1IV7A 1ULIB 4QWTA 3U1WA 3EN1B 4RBNA 3SOYA 3I553 2CFLA 3BNBA 3BNEA 3N54B 2W56A 1YHQ3 1N8R4 2CIUA 4HBRA 4EXRA 3HIGA 1DMNA 1GS3A 1Q864 5BXQA 4MMYB 2Y73A 3NQYA 3ALAA 1IQYA 5ELUA 3UL5A 3CCU3 2O9UX 3U97A 5IEOA 2F98A 4U13A 2CFGA 3KIIA 3SEDA 3JUMA 4MMZB 3NQZA 3I0YA 3G4S3 1STFI 3HK4A 1NU3A 2I9WA 4FCMA 1UUWB 2W03A 3MWZA 1JRQA 1L5GB 2XEPA 2WGQA 1W4NA 4LGQA 2L4VA 3D9RA 1FUWA 5IG3A 1YJN3 3IMAB 4FCJA 3SXXA 4FMCA 5CF2A 4G1MB 5G2GA 2HMKB 4HZBB 3V99A 4CDLA 3JVCA 1R4CA 1QAKA 4IIAA 4OUQA 3NBBA 4NREA 2GU3A 3S28A 4FMAA 3PCRA 1WMPA 4X2OA 3MKIA 3M8CA 5KP3A 5JPPA 1DYUA 1NDOB 3GWRA 2Q07A 2WGOA 1SIHA 2W2CA 3Q90A 3LTDA 1GD3A 4EC6A 1QJGA 2P0XA 3F7XA 3UJMA 2BO9B 3X3YA 1Q7Y4 1VQO3 6STDA 2IUKA 4N6UA 3ECFA 4H61A 3WA2X 3OV4A 4HM7B 2IMJA 5I97A 4HKVB 3NUVA 4HM2B 4KFEA 2WOFA 5AI1A 2RGQA 3DGOA 1JJ22 1OH0A 3FGYA 3V92A 3CCE3 3CCL3 3CMA3 1N9JA 4HM6B 5CXOA 2V1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3H A;  3OWY A;  5AEW B;  1CQS A;  3NV0 B;  3EHC A;  1OGX A;  4KVH A;  1E3V A;  3WMD A;  1W02 A;  1O7N B;  1ULJ B;  3DXO A;  3B4O A;  3OXA A;  1OHS A;  3GZY B;  3EBT A;  1OUN A;  5IEN A;  5IEP A;  1EG9 B;  1GY5 A;  1DMQ A;  4XBX A;  5EVH A;  3E99 A;  4STD A;  3FF0 A;  4J8T A;  2BMO B;  1OPY A;  1AR0 A;  1OGZ A;  4ORL A;  2YFJ B;  4HJL B;  5FW5 A;  1HKX A;  3HX8 A;  3EJV A;  5BVB A;  2HMO B;  1JN5 A;  4K1U A;  5AIG A;  1C7H A;  5IER A;  3BB9 A;  3FF2 A;  1VZZ A;  3H51 A;  5CLK A;  3K7C A;  2INX A;  4XM4 A;  3BLZ A;  2HML B;  4I4K A;  4K1V A;  5IG5 A;  2A15 A;  3MG2 A;  1ZX2 A;  2JQ5 A;  2XSO B;  4R1K A;  1EA2 A;  3JUN A;  3OWS A;  3LZA A;  2BMQ B;  5CK6 A;  1GY6 A;  1A2K A;  3G8Z A;  2YFI B;  5DRE A;  1ISK A;  4RZM A;  4OVM A;  3EQQ B;  3EX9 A;  5KP1 A;  7STD A;  4HVN A;  4J9A A;  4L7K A;  1GYB A;  3ER7 A;  3EN8 A;  3IPT A;  3OX9 A;  3KSP A;  3B8L A;  5IF6 A;  2HMN B;  3F8H A;  1QMA A;  3S5C A;  2Z76 A;  3MSO A;  2RCD A;  1O7W B;  4HZ9 B;  1O7P B;  2B1X B;  5DRV A;  1Q40 A;  2R4I A;  1ZO2 A;  2HMM B;  4Q53 A;  3NHX A;  5D83 A;  1E3R A;  2GBX B;  1JB5 A;  3GZR A;  3KKG A;  4R9L A;  4XDV A;  4WP5 A;  1O7G B;  3JUO A;  4HM1 B;  4WYK A;  4HM3 B;  2CKF B;  2F99 A;  1U5O A;  4XB5 A;  1OF5 A;  3RGA A;  1JN5 B;  3NBR A;  2PZV A;  2QIY A;  4L8O A;  5AEU B;  2XRX B;  2Z7A A;  1TP6 A;  4GB5 A;  4PEJ A;  1JB4 A;  3FZW A;  2XR8 B;  1JKG A;  1W00 A;  3NXJ A;  3LYG A;  1JB2 A;  3MYT A;  2GBW B;  3SOA A;  3DZL A;  3GRD A;  3DUK A;  3EF8 A;  3F40 A;  1W6Y A;  1W01 A;  1S5A A;  3NM2 A;  2BNG A;  1Z1S A;  3OWU A;  5AIH A;  1STD A;  3FKA A;  5AII A;  1WQL B;  2STD A;  4HM4 B;  4X2H A;  2OWP A;  5STD A;  3F9S A;  4WWU C;  3UNL A;  5AIF A;  3F7S A;  3CNM A;  2UX0 A;  8CHO A;  3JUQ A;  1OCV A;  5D82 A;  3KZT A;  2GXF A;  3EBY A;  1Q40 B;  2BMR B;  3A76 A;  1OHO A;  4N3V A;  3KE7 A;  4XDW A;  2F86 B;  1E97 A;  1OHP A;  2HMJ B;  1ASK A;  2YFL B;  3STD A;  2XSH B;  1O7M B;  3DMC A;  1IDP A;  2Z77 A;  3RGR A;  4WYK B;  4XBT A;  1OF5 B;  1UUV B;  3JUP A;  4HM5 B;  3EC9 A;  4H3U A;  1NWW A;  3MG3 A;  3VSY A;  1DMM A;  3MG1 A;  2K54 A;  3T8U A;  4XBY A;  3FSD A;  3B4P A;  1JKG B;  2B24 B;  3CU3 A;  2RFR A;  3VGN A;  5D81 A;  5IG4 A;  4HM0 B;  5CF1 A;  1Q42 A;  2GEX A;  5JPU A;  3CPO A;  3F14 A;  3K0Z A;  3G0K A;  4L8P A;  3DM8 A;  2GEY A;  5TGN A;  3NV0 A;  5KP4 A;  1TUH A;  3HZP A;  1K41 A;  3G16 A;  4LMI A;  3GZB A;  2QGU A;  4MJD A;  4HM8 B;  4LEH A;  1BUQ A;  2CHC A;  3F8X A;  3T8N A;  3MHE A;  1O7H B;  3FLJ A;  3B7C A;  5HGR A;  3GZX B;  1SJW A;  3CNX A;  3FH1 A;  5IG0 A;  3ROB A;  4R9K A;  1GY7 A;  1ULI B;  3EN1 B;  3SOY A;  1DMN A;  1GS3 A;  5BXQ A;  5IEO A;  2F98 A;  4U13 A;  3SED A;  3JUM A;  3I0Y A;  3HK4 A;  1NU3 A;  2I9W A;  4FCM A;  1UUW B;  4LGQ A;  3D9R A;  5IG3 A;  4FCJ A;  5CF2 A;  5G2G A;  2HMK B;  4HZB B;  4CDL A;  4IIA A;  4OUQ A;  4X2O A;  3MKI A;  3M8C A;  5KP3 A;  5JPP A;  1NDO B;  3GWR A;  2W2C A;  3Q90 A;  1QJG A;  3F7X A;  3UJM A;  6STD A;  3ECF A;  3OV4 A;  4HM7 B;  2IMJ A;  4HKV B;  3NUV A;  4HM2 B;  5AI1 A;  2RGQ A;  1OH0 A;  3FGY A;  4HM6 B;  5CXO A; 
#chains in the Genus database with same CATH topology
 2YX9 A;  4LZI A;  3H3H A;  4AEQ A;  3OWY A;  1A67 A;  1MNL A;  1B21 A;  5JBS A;  3WOD G;  3LTB A;  5AEW B;  1CQS A;  3NV0 B;  1IQX A;  2J8X B;  3ZG5 A;  3CCV 3;  3EHC A;  1OGX A;  4K61 A;  4KVH A;  1D6Z A;  1E3V A;  3LH4 A;  4HAA A;  3WDG B;  3WMD A;  3Q3F A;  3S29 A;  1W02 A;  1RCL A;  1O7N B;  1ULJ B;  2JDI H;  1LNH A;  3DXO A;  5IW9 A;  5EQL A;  3B4O A;  3OXA A;  1BSE A;  2CW9 A;  1OHS A;  4BIR A;  4N6V 0;  3GZY B;  2KXG A;  3KSE D;  1JBR A;  3DGL A;  5GSP A;  3EBT A;  1OUN A;  5IEN A;  5IEP A;  2SAR A;  4FMB A;  4GL6 A;  1EG9 B;  2CWV A;  3GAX A;  1GY5 A;  1DMQ A;  4XBX A;  5EVH A;  1M1X B;  1SII A;  2LQV A;  3AHS A;  3E99 A;  3FG3 A;  3HII A;  4STD A;  5M18 A;  1RGK A;  4ZM8 A;  3FF0 A;  4N6M A;  1AVL A;  4J8T A;  1IT8 A;  1A90 A;  2BMO B;  2ZDJ A;  4JF8 A;  1I2F A;  2Y74 A;  3AMO B;  2OTL 3;  1OPY A;  1WMO A;  2W56 B;  1HU9 A;  1I2E A;  1UCI A;  2W6J H;  3UL6 A;  2P38 A;  5ELJ A;  5BU4 A;  1AR0 A;  1OGZ A;  4ORL A;  4O02 B;  2CG1 A;  2YFJ B;  4HJL B;  5FW5 A;  1HKX A;  4OK0 A;  1RN4 A;  1LQM B;  1YJW 3;  3TDG A;  1M90 4;  1TJD A;  2IYJ A;  1MWU A;  3EJV A;  3HX8 A;  4RNY A;  3T0U A;  5A0O B;  1UGH I;  5BVB A;  1BNG A;  2HMO B;  1JN5 A;  4K1U A;  5AIG A;  1C7H A;  3EB8 A;  1W7C A;  1GSP A;  5IER A;  2XF3 A;  3BB9 A;  3WOF B;  1FZU A;  3FF2 A;  4CJN A;  1VZZ A;  3H51 A;  5RNT A;  3PCS A;  1ROV A;  2D42 A;  5CLK A;  3K7C A;  3X3X A;  3CD6 3;  1YJ9 3;  1PYL A;  2INX A;  4XM4 A;  4HYZ A;  3BLZ A;  3KN4 A;  3X41 A;  2HML B;  4WHA A;  4AKZ A;  1ZGX A;  4I4K A;  3CC2 3;  1HYF A;  2ML5 A;  4K1V A;  4BTY A;  2F56 A;  5IG5 A;  2XGN A;  1VQN 3;  3AMO A;  1RNT A;  1B3S A;  2A15 A;  3MG2 A;  3QRD A;  1ZX2 A;  3O8Y A;  2JQ5 A;  1GMP A;  1T3B A;  1VQM 3;  2XSO B;  4FR9 A;  1D6Y A;  4R1K A;  4IT7 A;  1EA2 A;  2D1W A;  3JUN A;  3OWS A;  3LZA A;  1CYV A;  4J5K A;  2BMQ B;  1X1W A;  1GY6 A;  1RLS A;  5CK6 A;  1A2K A;  3G8Z A;  1I0X A;  1W2Z A;  3K5T A;  3PYJ A;  3PGB A;  5EEO A;  2BT3 A;  2YFI B;  5DRE A;  1ISK A;  4RZM A;  4OVM A;  3EQQ B;  3EX9 A;  5KP1 A;  6RNT A;  7STD A;  6GSP A;  2KF3 A;  3N9H A;  1BRG A;  2AAE A;  4HVN A;  4J9A A;  4L7K A;  3G71 3;  1GYB A;  2XFS A;  4O2H A;  3ER7 A;  1T5Y A;  3G6E 3;  2E2U A;  3EN8 A;  5G1K A;  3IPT A;  4NHF A;  2HOH A;  1A2V A;  3OX9 A;  4MMX B;  1RGA A;  1K28 A;  1LXE A;  5M19 A;  3V98 A;  2W04 A;  3S67 A;  1LOY A;  3Q2P A;  2C11 A;  1RHL A;  3KSP A;  2H0G A;  4KFD A;  1MWR A;  1N8Q A;  1K8A 4;  2H0I A;  3B8L A;  5IF6 A;  1ROA A;  1I8V A;  2HMN B;  3F8H A;  1DET A;  1QMA A;  3S5C A;  4BU4 A;  1RN7 A;  2O3O A;  1SPU A;  2Z76 A;  3LT8 A;  2KRT A;  1K73 4;  3RDE A;  4BL3 A;  3D5G A;  3MSO A;  2RCD A;  3DGY A;  2OQE A;  1K9M 4;  1O7W B;  5LC6 A;  1N5H A;  1T2I A;  1UDI I;  3NX0 A;  4HZ9 B;  1O7P B;  3NBJ A;  2B1X B;  2W0Q A;  5DRV A;  1JNQ A;  1Q40 A;  1IQ8 A;  2BIR A;  2R4I A;  3CCQ 3;  1PY3 A;  1ZO2 A;  2WO0 A;  2HMM B;  4Q53 A;  1RKY A;  3NHX A;  5D83 A;  3ZFZ A;  1E3R A;  2CFD A;  1Q7H A;  2GBX B;  1UUG B;  2P0M A;  3D4A A;  1DE3 A;  1FUT A;  2FGT A;  4ILF A;  1FGM A;  4LSO A;  1U8C B;  1NB5 I;  2MC8 A;  1KWI A;  1JB5 A;  1W5Z A;  2UUG C;  3GZR A;  4IPB A;  3KKG A;  1M9G A;  4CCV A;  3CXC 2;  2XH9 A;  1N5P A;  3BIR A;  4EW5 A;  2CC3 A;  3FG1 A;  4R9L A;  1UCK A;  1S72 3;  1JBT A;  4XDV A;  4N6O B;  3DH2 A;  4WP5 A;  1O7G B;  2XFT A;  3JUO A;  3L0R A;  1B2S A;  1YVS A;  4HM1 B;  1LNI A;  4JRF A;  1YGW A;  4WYK A;  4HM3 B;  2CKF B;  2F99 A;  2CWT A;  1RGL A;  1AY7 A;  1CEW I;  1U5O A;  4XB5 A;  3ZG0 A;  1OF5 A;  1D6U A;  3RGA A;  3CC7 3;  3OW2 2;  3MPH A;  3AGN A;  1JN5 B;  1W6G A;  1KSI A;  2C10 A;  1QAF A;  2P09 A;  4O3V A;  3NBR A;  3CCJ 3;  2BU4 A;  1I3I A;  3SX1 A;  2CH9 A;  1RNB A;  2PZV A;  1G96 A;  4K90 B;  1BNE A;  2P05 A;  4J5G A;  2QIY A;  4L8O A;  5AEU B;  2KF6 A;  1FGQ A;  3CME 3;  4EYC A;  1DVD A;  1RCK A;  5LC7 A;  1WMN A;  2GSP A;  2XRX B;  2M7O A;  1BRJ A;  3WHO A;  1VQ5 3;  4RNT A;  3PZW A;  1BNS A;  1QAL A;  1YVB I;  1VQQ A;  2Z7A A;  1TP6 A;  4GB5 A;  4PEJ A;  1TRP A;  1JB4 A;  1OAC A;  2K0M A;  3FZW A;  1MGR A;  2E2V A;  2BHM A;  1BRN L;  3WA3 A;  2XR8 B;  1VQP 3;  1JKG A;  3FG4 A;  3URP A;  3K9M C;  1VQ4 3;  4EV2 A;  1W00 A;  1A2P A;  3NXJ A;  4BL2 A;  3LYG A;  2XGL A;  1QVG 2;  1CYU A;  1JB2 A;  3LML A;  2OCT A;  1W2B 2;  3MYT A;  2GBW B;  5G1L A;  1V74 A;  3SOA A;  3DZL A;  4LYL B;  3GRD A;  1X1U A;  1NB3 I;  1ZS7 A;  3DUK A;  3EF8 A;  3F40 A;  1W6Y A;  3LOY A;  5FGO A;  1T2H A;  1TFK A;  3WR2 A;  1W01 A;  1S5A A;  3CPW 2;  1NO3 A;  1SAR A;  2CFW A;  2UGI A;  1JBS A;  1BNR A;  3NM2 A;  1BU4 A;  2RSX A;  4RNZ A;  2C4B A;  2BNG A;  1Z1S A;  1R4Y A;  1YIJ 3;  3OWU A;  5AIH A;  1GD4 A;  1STD A;  3FKA A;  1WQL B;  5AII A;  1MOL A;  2STD A;  1TIJ A;  1IV9 A;  4HM4 B;  1UCL A;  1IT7 A;  3DGM A;  2LYX A;  2OWP A;  3KCH A;  1G02 A;  2W9Q A;  1UGI A;  3BNC A;  4X2H A;  3F9S A;  3LXU X;  4WWU C;  5STD A;  3UNL A;  5AIF A;  3F7S A;  3CNM A;  3NM7 A;  2UX0 A;  1X1X A;  3WOE B;  1BUJ A;  4KFF A;  4GHO A;  8CHO A;  3JUQ A;  1OCV A;  1BAN A;  1C54 A;  3D3L A;  3AHW A;  4N6L A;  5D82 A;  1IK3 A;  5AYR B;  3KZT A;  4FCZ A;  2GXF A;  3EBY A;  1M1K 4;  3PXM A;  4R4K A;  5HOH A;  2WOH A;  1Q40 B;  1B2Z A;  2BMR B;  1JZO A;  3IJE B;  1PU4 A;  1SQW A;  1RGC A;  3A76 A;  2OOV C;  2CWU A;  1B2M A;  1BSD A;  1OHO A;  2OQE C;  4FMD A;  1VQ8 3;  4O8S A;  2QEX 3;  4GSP A;  2IUJ A;  3EE1 A;  3SVA A;  4N3V A;  3KE7 A;  4DKI A;  3LT9 A;  1RGG A;  4XDW A;  1YIT 3;  3DGN A;  1VQ6 3;  2F86 B;  1VQK 3;  1BRS A;  1E97 A;  1OHP A;  2Z6B A;  3BND A;  3X3Z A;  1VQL 3;  1FA3 A;  1MGW A;  2HMJ B;  2ML6 A;  1B20 A;  4MEI A;  1ASK A;  1US1 A;  2YFL B;  3STD A;  2XSH B;  1TFO A;  1O7M B;  2OOV A;  2QA4 3;  1IVW A;  3DMC A;  3CC4 3;  1FGR A;  1IDP A;  2ZA4 A;  3X42 A;  2Z77 A;  3I56 3;  1QVF 2;  1NJI 4;  2KCD A;  3RGR A;  5M1A A;  4WYK B;  2PNC A;  1BAO A;  4XBT A;  1OF5 B;  1IVV A;  1KC8 4;  4N6N B;  1LOX A;  1BNI A;  1UUV B;  2KF4 A;  3JUP A;  1BVI A;  4HM5 B;  1F8N A;  1UW1 A;  2AAD A;  3QK9 A;  7RNT A;  1WTH A;  2MF7 A;  3EC9 A;  1VQ7 3;  4H3U A;  1NWW A;  4N6T A;  4R80 A;  3CCS 3;  2IY2 A;  1BIR A;  3MG3 A;  3VSY A;  4AKY A;  1Y4K A;  2K3D A;  1DMM A;  3MG1 A;  1MWT A;  3S27 A;  1GMR A;  2K54 A;  3VF1 A;  1WNH A;  3T8U A;  3DY5 A;  2E2T A;  1LOV A;  3A5E A;  4XBY A;  2FXT A;  3FSD A;  1YGE A;  3B4P A;  1PFP A;  1EEJ A;  1JKG B;  1FUS A;  1JZD A;  1EQK A;  1BRH A;  1HZ1 A;  2R41 A;  1JV2 B;  3GSP A;  3J7Y d;  1NNV A;  2B24 B;  3CU3 A;  1RGF A;  1RGH A;  2RFR A;  4TX4 A;  3VGN A;  2CFK A;  5D81 A;  3N8B A;  4KZ1 A;  1FGO A;  3SLU A;  5IG4 A;  4HM0 B;  5CF1 A;  3CCR 3;  1Q42 A;  1Q9E A;  1VQ9 3;  2FNQ A;  2GEX A;  4CPK A;  3HOH A;  1FGT A;  1BSB A;  2ZL8 A;  5JPU A;  1Q81 4;  8RNT A;  1GOV A;  3LTC A;  3CPO A;  3F14 A;  2F5W A;  3K0Z A;  2F4Y A;  2CG0 A;  3LTA A;  3G0K A;  4HOH A;  2CX0 A;  2OTJ 3;  3Q1C A;  1I3F A;  1LQG C;  1UI8 A;  1EKM A;  4BTW A;  1DVC A;  4L8P A;  3UB1 A;  1RJO A;  5AYS C;  2GU1 A;  3K63 A;  3X40 A;  3DM8 A;  1I0V A;  3FCS B;  2GEY A;  5TGN A;  1AV4 A;  3NV0 A;  3PS8 A;  5KP4 A;  1TUH A;  3HZP A;  1K41 A;  2CK3 H;  1W6C A;  3G16 A;  4LMI A;  2IA7 A;  1RDS A;  3GZB A;  4I5Q A;  1RRH A;  1BNJ A;  2QGU A;  1TU5 A;  1KQS 2;  7GSP A;  1RMS A;  4MJD A;  1AVK A;  1LOW A;  4HM8 B;  4LEH A;  1RRL A;  2KF5 A;  1BUQ A;  2CHC A;  1IU7 A;  1J2B A;  1MWS A;  3F8X A;  1IVX A;  3T8N A;  4EBG A;  1BRK A;  3HI7 A;  3MHE A;  4WFO A;  1O7H B;  1IVU A;  1KD1 4;  1I70 A;  3FLJ A;  3B7C A;  3CCM 3;  1X1Y A;  2W9P A;  5HGR A;  3GZX B;  1SJW A;  3CNX A;  3KFQ C;  3FH1 A;  5IG0 A;  3ROB A;  1B2U A;  1Q82 4;  1LVN A;  4R9K A;  1GY7 A;  1N9E A;  4BTX A;  2SBL A;  1YI2 3;  1UI7 A;  1TRQ A;  3RNT A;  4EV5 A;  1IV7 A;  1ULI B;  4QWT A;  1BNF A;  2L1S A;  3U1W A;  3EN1 B;  4RBN A;  3SOY A;  2H0H A;  3I55 3;  2CFL A;  3BNB A;  3BNE A;  3N54 B;  2W56 A;  1YHQ 3;  1N8R 4;  2CIU A;  4KT3 B;  4HBR A;  4EXR A;  3HIG A;  1DMN A;  1GS3 A;  1Q86 4;  5BXQ A;  4MMY B;  2Y73 A;  1B27 A;  1BGS A;  3NQY A;  3ALA A;  1IQY A;  5ELU A;  3UL5 A;  3CCU 3;  1GOU A;  2O9U X;  3U97 A;  5IEO A;  2F98 A;  1BSA A;  2CX1 A;  1RN1 A;  4U13 A;  2CFG A;  3KII A;  3SED A;  1TTO A;  3JUM A;  4MMZ B;  9RNT A;  3NQZ A;  3I0Y A;  3G4S 3;  1STF I;  1V58 A;  3HK4 A;  1NU3 A;  2I9W A;  4FCM A;  2F5M A;  1UUW B;  2W03 A;  1V57 A;  3D79 A;  1JRQ A;  3MWZ A;  1L5G B;  2XEP A;  2WGQ A;  4NPB A;  1W4N A;  1YNV X;  1GOY A;  4LGQ A;  2L4V A;  3D9R A;  1FUW A;  5IG3 A;  1YJN 3;  3IMA B;  1BRI A;  3BU4 A;  4FCJ A;  3SXX A;  4FMC A;  5CF2 A;  4G1M B;  5G2G A;  2HMK B;  4HZB B;  3V99 A;  4CDL A;  3JVC A;  1R4C A;  1QAK A;  4IIA A;  1FW7 A;  4OUQ A;  3NBB A;  4NRE A;  2GU3 A;  3S28 A;  4FMA A;  3PCR A;  1GMQ A;  1WMP A;  3MKI A;  4X2O A;  3M8C A;  5KP3 A;  5JPP A;  1DYU A;  1NDO B;  2KAA A;  1RTU A;  3GWR A;  2Q07 A;  2WGO A;  1BSC A;  1I2G A;  1SIH A;  2W2C A;  3Q90 A;  3LTD A;  2ZHX B;  1BOX A;  1GD3 A;  1QJG A;  2P0X A;  3F7X A;  3UJM A;  4EC6 A;  2BO9 B;  1IYY A;  3X3Y A;  1AQZ A;  1EUI C;  1Q7Y 4;  1VQO 3;  1RSN A;  6STD A;  2IUK A;  1RGE A;  4N6U A;  3ECF A;  3SYU A;  2RNT A;  4H61 A;  3WA2 X;  3OV4 A;  1CH0 A;  3D5I A;  1LRA A;  4HM7 B;  1G0T A;  2IMJ A;  5BIR A;  1UCJ A;  1B2X A;  4HKV B;  1FYS A;  5I97 A;  3NUV A;  4HM2 B;  4KFE A;  2WOF A;  5AI1 A;  2RGQ A;  3DGO A;  1JJ2 2;  1OH0 A;  3FGY A;  3V92 A;  3CCE 3;  3CCL 3;  3CMA 3;  3AGO A;  2RBI A;  1N9J A;  4HM6 B;  5CXO A;  2V1L A; 
#chains in the Genus database with same CATH homology
 2YX9 A;  4LZI A;  3H3H A;  4AEQ A;  3OWY A;  1A67 A;  1MNL A;  5JBS A;  3WOD G;  3LTB A;  5AEW B;  1CQS A;  3NV0 B;  1IQX A;  3CCV 3;  3EHC A;  1OGX A;  4K61 A;  4KVH A;  1D6Z A;  1E3V A;  3LH4 A;  3WDG B;  3WMD A;  3S29 A;  1W02 A;  1O7N B;  1ULJ B;  2JDI H;  1LNH A;  3DXO A;  5IW9 A;  5EQL A;  3B4O A;  3OXA A;  2CW9 A;  1OHS A;  4N6V 0;  3GZY B;  2KXG A;  3KSE D;  3DGL A;  3EBT A;  1OUN A;  5IEN A;  5IEP A;  4FMB A;  4GL6 A;  1EG9 B;  2CWV A;  3GAX A;  1GY5 A;  1DMQ A;  4XBX A;  5EVH A;  1M1X B;  1SII A;  2LQV A;  3FG3 A;  3E99 A;  3HII A;  4STD A;  4ZM8 A;  3FF0 A;  4N6M A;  1AVL A;  4J8T A;  1IT8 A;  1A90 A;  2BMO B;  2ZDJ A;  4JF8 A;  3AMO B;  2Y74 A;  2OTL 3;  1OPY A;  1WMO A;  2W56 B;  1HU9 A;  2W6J H;  3UL6 A;  2P38 A;  5ELJ A;  1AR0 A;  1OGZ A;  4ORL A;  4O02 B;  2CG1 A;  2YFJ B;  4HJL B;  5FW5 A;  1HKX A;  4OK0 A;  1YJW 3;  3TDG A;  1M90 4;  3HX8 A;  3T0U A;  3EJV A;  5A0O B;  4RNY A;  5BVB A;  2HMO B;  1JN5 A;  4K1U A;  5AIG A;  1C7H A;  3EB8 A;  1W7C A;  5IER A;  2XF3 A;  3BB9 A;  3WOF B;  3FF2 A;  1VZZ A;  3H51 A;  3PCS A;  1ROV A;  2D42 A;  5CLK A;  3K7C A;  3X3X A;  3CD6 3;  1YJ9 3;  2INX A;  4XM4 A;  4HYZ A;  3BLZ A;  3KN4 A;  3X41 A;  2HML B;  4WHA A;  4AKZ A;  4I4K A;  3CC2 3;  2ML5 A;  4K1V A;  1VQN 3;  4BTY A;  5IG5 A;  2XGN A;  3AMO A;  2A15 A;  3MG2 A;  3QRD A;  1ZX2 A;  3O8Y A;  2JQ5 A;  1VQM 3;  2XSO B;  4FR9 A;  1D6Y A;  4R1K A;  4IT7 A;  1EA2 A;  2D1W A;  3JUN A;  3OWS A;  3LZA A;  1CYV A;  2BMQ B;  5CK6 A;  1GY6 A;  1A2K A;  3G8Z A;  1W2Z A;  3K5T A;  3PYJ A;  3PGB A;  5EEO A;  2BT3 A;  2YFI B;  5DRE A;  1ISK A;  4RZM A;  4OVM A;  3EQQ B;  3EX9 A;  5KP1 A;  7STD A;  3N9H A;  4HVN A;  4J9A A;  4L7K A;  3G71 3;  1GYB A;  2XFS A;  4O2H A;  3ER7 A;  1T5Y A;  3G6E 3;  2E2U A;  3EN8 A;  3IPT A;  4NHF A;  1A2V A;  3OX9 A;  4MMX B;  1K28 A;  1LXE A;  3V98 A;  2W04 A;  3S67 A;  3Q2P A;  2C11 A;  3KSP A;  4KFD A;  1N8Q A;  1K8A 4;  3B8L A;  5IF6 A;  1ROA A;  2HMN B;  3F8H A;  1QMA A;  3S5C A;  1RN7 A;  2O3O A;  1SPU A;  2Z76 A;  3LT8 A;  2KRT A;  1K73 4;  3RDE A;  3MSO A;  2RCD A;  1K9M 4;  2OQE A;  1O7W B;  5LC6 A;  1N5H A;  3NX0 A;  4HZ9 B;  1O7P B;  3NBJ A;  2B1X B;  2W0Q A;  5DRV A;  1JNQ A;  1Q40 A;  1IQ8 A;  2R4I A;  3CCQ 3;  1ZO2 A;  2WO0 A;  2HMM B;  4Q53 A;  1RKY A;  3NHX A;  5D83 A;  1E3R A;  2CFD A;  2GBX B;  2P0M A;  2FGT A;  1FGM A;  4LSO A;  1U8C B;  2MC8 A;  1KWI A;  1JB5 A;  1W5Z A;  3GZR A;  4IPB A;  3KKG A;  1M9G A;  4CCV A;  3CXC 2;  2XH9 A;  1N5P A;  2CC3 A;  3FG1 A;  4R9L A;  1S72 3;  4XDV A;  4N6O B;  4WP5 A;  1O7G B;  2XFT A;  3JUO A;  3L0R A;  4HM1 B;  4JRF A;  4WYK A;  4HM3 B;  2CKF B;  2F99 A;  2CWT A;  1CEW I;  1U5O A;  4XB5 A;  1OF5 A;  1D6U A;  3RGA A;  3CC7 3;  3OW2 2;  3MPH A;  1JN5 B;  1W6G A;  1KSI A;  2C10 A;  1QAF A;  2P09 A;  4O3V A;  3NBR A;  3CCJ 3;  3SX1 A;  2CH9 A;  2PZV A;  1G96 A;  4K90 B;  2P05 A;  2QIY A;  4L8O A;  5AEU B;  1FGQ A;  3CME 3;  4EYC A;  1DVD A;  5LC7 A;  1WMN A;  2XRX B;  2M7O A;  1VQ5 3;  3PZW A;  1QAL A;  1YVB I;  2Z7A A;  1TP6 A;  4GB5 A;  4PEJ A;  1JB4 A;  1OAC A;  2K0M A;  3FZW A;  2E2V A;  2BHM A;  3WA3 A;  2XR8 B;  1VQP 3;  1JKG A;  3FG4 A;  1VQ4 3;  3K9M C;  4EV2 A;  1W00 A;  3NXJ A;  3LYG A;  2XGL A;  1QVG 2;  1CYU A;  1JB2 A;  3LML A;  2OCT A;  1W2B 2;  3MYT A;  2GBW B;  1V74 A;  3SOA A;  3DZL A;  3GRD A;  1NB3 I;  3DUK A;  3EF8 A;  3F40 A;  1W6Y A;  3LOY A;  5FGO A;  1TFK A;  1W01 A;  1S5A A;  3CPW 2;  1NO3 A;  2CFW A;  3NM2 A;  2RSX A;  4RNZ A;  2BNG A;  1Z1S A;  1YIJ 3;  3OWU A;  5AIH A;  1GD4 A;  1STD A;  3FKA A;  1WQL B;  5AII A;  2STD A;  1MOL A;  1TIJ A;  1IV9 A;  4HM4 B;  3DGM A;  1IT7 A;  5AYR B;  2LYX A;  2OWP A;  4X2H A;  2W9Q A;  5STD A;  3BNC A;  1NB5 I;  3F9S A;  3LXU X;  4WWU C;  3UNL A;  5AIF A;  3F7S A;  3CNM A;  3NM7 A;  2UX0 A;  3WOE B;  4KFF A;  8CHO A;  3JUQ A;  1OCV A;  3D3L A;  4N6L A;  5D82 A;  1IK3 A;  3KZT A;  4FCZ A;  2GXF A;  3EBY A;  1M1K 4;  3PXM A;  4R4K A;  2WOH A;  1Q40 B;  2BMR B;  3IJE B;  1PU4 A;  1SQW A;  3A76 A;  2OOV C;  2CWU A;  1OHO A;  2OQE C;  4FMD A;  1VQ8 3;  4O8S A;  2QEX 3;  2IUJ A;  3EE1 A;  3SVA A;  4N3V A;  3KE7 A;  3LT9 A;  4XDW A;  1YIT 3;  3DGN A;  1VQ6 3;  2F86 B;  1VQK 3;  1E97 A;  1OHP A;  2Z6B A;  3BND A;  3X3Z A;  1VQL 3;  1FA3 A;  2HMJ B;  2ML6 A;  4MEI A;  1ASK A;  1US1 A;  2YFL B;  3STD A;  2XSH B;  1TFO A;  1O7M B;  2OOV A;  2QA4 3;  1IVW A;  3DMC A;  3CC4 3;  1FGR A;  1IDP A;  3X42 A;  3I56 3;  2Z77 A;  1QVF 2;  1NJI 4;  2KCD A;  3RGR A;  4WYK B;  2PNC A;  4XBT A;  1OF5 B;  1IVV A;  1KC8 4;  4N6N B;  1LOX A;  1UUV B;  3JUP A;  4HM5 B;  1F8N A;  1UW1 A;  3QK9 A;  1WTH A;  2MF7 A;  3EC9 A;  1VQ7 3;  4H3U A;  1NWW A;  4N6T A;  4R80 A;  3CCS 3;  3MG3 A;  3VSY A;  4AKY A;  1Y4K A;  1DMM A;  3MG1 A;  3S27 A;  2K54 A;  3VF1 A;  1WNH A;  3T8U A;  3DY5 A;  2E2T A;  4XBY A;  2FXT A;  3FSD A;  1YGE A;  3B4P A;  1PFP A;  1JKG B;  1EQK A;  1JV2 B;  3J7Y d;  2B24 B;  3CU3 A;  2RFR A;  4TX4 A;  3VGN A;  2CFK A;  5D81 A;  3N8B A;  4KZ1 A;  1FGO A;  3SLU A;  5IG4 A;  4HM0 B;  5CF1 A;  3CCR 3;  1Q42 A;  1VQ9 3;  2FNQ A;  2GEX A;  1FGT A;  2ZL8 A;  5JPU A;  1Q81 4;  3LTC A;  3CPO A;  3F14 A;  3K0Z A;  2CG0 A;  3LTA A;  3G0K A;  2OTJ 3;  3Q1C A;  1UI8 A;  1EKM A;  4BTW A;  1DVC A;  4L8P A;  3UB1 A;  1RJO A;  5AYS C;  2GU1 A;  3K63 A;  3X40 A;  3DM8 A;  3FCS B;  2GEY A;  5TGN A;  1AV4 A;  3NV0 A;  3PS8 A;  5KP4 A;  1TUH A;  3HZP A;  1K41 A;  2CK3 H;  1W6C A;  3G16 A;  4LMI A;  2IA7 A;  3GZB A;  1KQS 2;  1RRH A;  1TU5 A;  2QGU A;  4MJD A;  1AVK A;  4HM8 B;  4LEH A;  1RRL A;  1BUQ A;  2CHC A;  1IU7 A;  1J2B A;  3F8X A;  3T8N A;  1IVX A;  4EBG A;  3HI7 A;  3MHE A;  4WFO A;  1O7H B;  1IVU A;  1KD1 4;  3FLJ A;  3CCM 3;  3B7C A;  2W9P A;  5HGR A;  3GZX B;  1SJW A;  3CNX A;  3KFQ C;  3FH1 A;  5IG0 A;  3ROB A;  1Q82 4;  1LVN A;  4R9K A;  1GY7 A;  1N9E A;  4BTX A;  2SBL A;  1YI2 3;  1UI7 A;  4EV5 A;  1IV7 A;  1ULI B;  4QWT A;  3U1W A;  3EN1 B;  4RBN A;  3SOY A;  3I55 3;  2CFL A;  3BNB A;  3BNE A;  3N54 B;  2W56 A;  1YHQ 3;  1N8R 4;  2CIU A;  4HBR A;  4EXR A;  3HIG A;  1DMN A;  1GS3 A;  1Q86 4;  5BXQ A;  4MMY B;  2Y73 A;  3NQY A;  3ALA A;  1IQY A;  5ELU A;  3UL5 A;  3CCU 3;  2O9U X;  3U97 A;  5IEO A;  2F98 A;  4U13 A;  2CFG A;  3KII A;  3SED A;  3JUM A;  4MMZ B;  3NQZ A;  3I0Y A;  3G4S 3;  1STF I;  3HK4 A;  1NU3 A;  2I9W A;  4FCM A;  1UUW B;  2W03 A;  3MWZ A;  1JRQ A;  1L5G B;  2XEP A;  2WGQ A;  1W4N A;  4LGQ A;  2L4V A;  3D9R A;  1FUW A;  5IG3 A;  1YJN 3;  3IMA B;  4FCJ A;  3SXX A;  4FMC A;  5CF2 A;  4G1M B;  5G2G A;  2HMK B;  4HZB B;  3V99 A;  4CDL A;  3JVC A;  1R4C A;  1QAK A;  4IIA A;  4OUQ A;  3NBB A;  4NRE A;  2GU3 A;  3S28 A;  4FMA A;  3PCR A;  1WMP A;  4X2O A;  3MKI A;  3M8C A;  5KP3 A;  5JPP A;  1DYU A;  1NDO B;  3GWR A;  2Q07 A;  2WGO A;  1SIH A;  2W2C A;  3Q90 A;  3LTD A;  1GD3 A;  4EC6 A;  1QJG A;  2P0X A;  3F7X A;  3UJM A;  2BO9 B;  3X3Y A;  1Q7Y 4;  1VQO 3;  6STD A;  2IUK A;  4N6U A;  3ECF A;  4H61 A;  3WA2 X;  3OV4 A;  4HM7 B;  2IMJ A;  5I97 A;  4HKV B;  3NUV A;  4HM2 B;  4KFE A;  2WOF A;  5AI1 A;  2RGQ A;  3DGO A;  1JJ2 2;  1OH0 A;  3FGY A;  3V92 A;  3CCE 3;  3CCL 3;  3CMA 3;  1N9J A;  4HM6 B;  5CXO A;  2V1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...