5CF2A

Crystal structure of the i80y/l114v/i116v mutant of leh
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the I80Y/L114V/I116V mutant of LEH
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5cf2A00
2Z76A 2HMKB 1Q40B 1UUWB 5IG5A 1O7WB 1OHOA 1NDOB 3OWYA 4X2OA 4K1UA 3GRDA 1JB2A 5AI1A 1Q42A 3RGRA 3F14A 1ISKA 3BLZA 3EX9A 3STDA 3DMCA 1O7PB 4OUQA 5IF6A 1BUQA 3DZLA 4HM3B 2UX0A 4STDA 2BMRB 1E3RA 1GYBA 1O7HB 1ZO2A 3DUKA 3F40A 3KE7A 3MHEA 1ASKA 1W6YA 3A76A 3KSPA 1TUHA 3CU3A 1OHSA 2XSOB 3EN8A 2CHCA 2F98A 2F86B 3EN1B 3K0ZA 3K7CA 4LMIA 5CXOA 2B24B 5IEPA 2OWPA 5KP1A 5FW5A 2IMJA 2GEYA 3SOYA 2XSHB 3GZBA 4L7KA 1O7MB 2Z77A 3ER7A 2JQ5A 5BXQA 4HM1B 7STDA 2BNGA 3MYTA 1JB4A 4X2HA 1W00A 4IIAA 1GY7A 2XR8B 4XBXA 4OVMA 5AEWB 1A2KA 2BMQB 2W2CA 3ECFA 3B7CA 1UUVB 4LGQA 3OWSA 1O7GB 3NXJA 2XRXB 2I9WA 4HM0B 4KVHA 3JUMA 4XM4A 2YFJB 4HZ9B 5JPUA 2YFLB 3D9RA 2HMOB 3UJMA 1AR0A 1JKGA 1VZZA 2HMNB 3NM2A 5CK6A 3GZYB 1E97A 3HK4A 3OV4A 5IG3A 4XDWA 3F8XA 3RGAA 4CDLA 1GS3A 1GY5A 4FCMA 1QMAA 2QIYA 1ULJB 3DXOA 5KP4A 5D81A 1OGXA 4FCJA 2RGQA 1C7HA 3EJVA 1OUNA 3OX9A 1OHPA 3NV0B 3OWUA 3F9SA 5D83A 3MG2A 3EHCA 2GBWB 3F7XA 1JN5A 4L8OA 1Q40A 3JUOA 4HJLB 1CQSA 2QGUA 2R4IA 4L8PA 4R9KA 5CF1A 1OPYA 1NWWA 1OH0A 3FZWA 1JB5A 2CKFB 3CNMA 3G0KA 3G16A 5STDA 4HVNA 5AEUB 1Z1SA 3B4PA 4HM6B 4WYKB 4Q53A 3T8UA 1EG9B 3IPTA 1DMQA 4XB5A 4ORLA 3GWRA 4HM2B 5JPPA 1EA2A 3M8CA 1O7NB 5AIIA 5AIGA 5G2GA 2F99A 1K41A 1OF5B 3FGYA 3G8ZA 3LZAA 2HMJB 4XBTA 2A15A 5AIHA 4HM4B 3EF8A 3MG3A 3H3HA 4MJDA 3VGNA 3FF0A 3JUQA 3I0YA 4R9LA 1OGZA 3H51A 1NU3A 4XBYA 3Q90A 5EVHA 4HM7B 1U5OA 3S5CA 4LEHA 3ROBA 5CF2A 5DRVA 4J8TA 5KP3A 3UNLA 3F8HA 1IDPA 2GEXA 1OCVA 3NBRA 3SEDA 3NUVA 1S5AA 4WYKA 3EBYA 3FSDA 1JN5B 1HKXA 1W01A 4K1VA 5DREA 5TGNA 3F7SA 3OXAA 4R1KA 5AIFA 2PZVA 3NV0A 4WP5A 3FKAA 5IG0A 3WMDA 3KZTA 4XDVA 3FH1A 3MG1A 4GB5A 2BMOB 4N3VA 2B1XB 2Z7AA 1E3VA 5IEOA 3BB9A 5CLKA 1WQLB 1OF5A 4WWUC 1ZX2A 2HMLB 3EQQB 3MSOA 3FLJA 2RCDA 2YFIB 3FF2A 3B4OA 1STDA 1TP6A 3EC9A 4J9AA 4PEJA 3T8NA 3JUNA 6STDA 3VSYA 3HZPA 1DMNA 1DMMA 3KKGA 2RFRA 1ULIB 3CPOA 4HM5B 3CNXA 1W02A 1QJGA 3DM8A 4I4KA 3LYGA 4U13A 1JKGB 3JUPA 3SOAA 4RZMA 5HGRA 3EBTA 2STDA 2HMMB 4H3UA 5IERA 5IENA 3MKIA 2GXFA 3B8LA 3NHXA 5BVBA 5IG4A 2K54A 2INXA 3E99A 3HX8A 2GBXB 4HZBB 5D82A 3GZXB 8CHOA 4HM8B 4HKVB 3GZRA 1GY6A 1SJWA
chains in the Genus database with same CATH superfamily
2Z76A 3FG3A 1J2BA 2LYXA 1FGMA 1O7WB 1OHOA 1NDOB 1RGAA 3DGYA 3OWYA 4ILFA 4RNYA 4AKYA 4EC6A 1JB2A 3FG4A 1Q42A 3WR2A 1TIJA 1I3FA 5LC7A 3BNBA 1UCLA 4N6LA 4HBRA 1ZO2A 3DUKA 3MHEA 3KE7A 3FCSB 1W6YA 1PY3A 1TUHA 1N5PA 1BNJA 2CHCA 1U8CB 1KWIA 2F98A 1BIRA 1IVWA 3DH2A 2CIUA 1HU9A 1YGEA 3IJEB 1YJN3 5RNTA 2KF5A 3UL5A 2XF3A 4J5KA 2BNGA 3MYTA 3S28A 3LTAA 1RN4A 1B2SA 3I563 1A2KA 2BMQB 1W5ZA 3OWSA 3NXJA 2XRXB 3JUMA 5JPUA 2BO9B 2YFJB 1K8A4 2HMOB 1AR0A 1LQGC 5IW9A 1IVXA 1MWSA 1LVNA 1ULJB 2GU3A 3CCL3 1B20A 4R80A 1B3SA 1GOYA 1IVUA 4O2HA 1RGLA 2CK3H 3MG2A 3N8BA 1VQK3 2WOFA 4HJLB 4L8PA 1CQSA 3G6E3 4R9KA 3ZFZA 2OQEA 4K61A 1OPYA 2CFDA 1AVLA 4MMZB 2CKFB 3CNMA 3CCQ3 2F4YA 1I2FA 1Z1SA 3B4PA 1CEWI 3X3YA 1VQO3 2J8XB 3LTDA 1V58A 4XB5A 7GSPA 4ORLA 3SLUA 1RSNA 1V57A 2KRTA 3M8CA 2P09A 1K41A 1OF5B 3G8ZA 5BU4A 3AHWA 2A15A 4HM4B 1BNFA 3MG3A 1N9EA 2FGTA 4MJDA 3VGNA 3FF0A 4FMBA 4R9LA 3NX0A 3J7Yd 3CXC2 3NQYA 1UW1A 1VQQA 2SARA 3Q2PA 2IYJA 3ROBA 3BNCA 3AGOA 1V74A 3UNLA 3F8HA 3SEDA 3CCR3 3EBYA 4BL2A 1JN5B 1HKXA 3KIIA 2KF4A 2RNTA 1M1XB 3AHSA 4K1VA 5DREA 2XFTA 4MMYB 3I553 1BNSA 1IV7A 1US1A 3ALAA 4GHOA 1QVG2 1VQ43 3HIIA 9RNTA 1I8VA 4HOHA 1BAOA 2C4BA 3VF1A 4FMCA 4BL3A 2B1XB 1RGCA 1LNHA 3CD63 1GOUA 5CLKA 2QEX3 1WQLB 1A90A 3BIRA 4MEIA 1T2HA 1PU4A 1MWTA 2K3DA 1TFKA 2RCDA 1STDA 3T8NA 4FCZA 1WMOA 5M18A 1LOVA 1WNHA 1BRJA 1ULIB 3URPA 1K734 3EBTA 2ZHXB 2CC3A 3N54B 1PFPA 3NHXA 2K54A 5G1LA 1N5HA 3HX8A 1LXEA 4WHAA 3WA2X 1I2GA 2OOVC 4NREA 1CYVA 1FUTA 1QALA 4N6UA 5EEOA 2ZDJA 4X2OA 3WOEB 1YJ93 2BIRA 2K0MA 3Q1CA 3RGRA 3F14A 4FR9A 3BLZA 3STDA 1RMSA 3WOFB 1RRLA 3D79A 1TRQA 3S29A 5IG4A 1E3RA 1GYBA 3F40A 3A76A 3KSPA 2HOHA 4KZ1A 3EN8A 1FGOA 2F86B 3EN1B 3DY5A 1EKMA 1T3BA 3SVAA 1B2MA 2IMJA 1MWRA 3MPHA 5GSPA 3SOYA 7STDA 2Z77A 3ER7A 1VQ53 2JQ5A 1B2UA 1D6YA 1EQKA 2IA7A 4X2HA 3LTBA 2D1WA 4G1MB 1D6UA 5AEWB 3HIGA 3B7CA 1UUVB 1RNTA 3DGNA 2ZA4A 3L0RA 1K28A 1RGFA 3O8YA 1JKGA 3MWZA 1VZZA 1FW7A 1I3IA 3IMAB 5CK6A 1UI7A 1BVIA 1X1XA 5IG3A 1TU5A 1YGWA 3RGAA 1A2VA 1M904 1W7CA 1YVSA 2E2VA 1JBTA 3BNDA 5D81A 2YX9A 3CMA3 1Q814 4KFDA 3PCRA 1IVVA 3F9SA 1X1UA 3LTCA 3UB1A 1BU4A 2W56A 4JF8A 1EEJA 1Q40A 1FZUA 2CFKA 2H0HA 4CPKA 2PNCA 1I2EA 5JBSA 1BRGA 2CG1A 1JB5A 1NO3A 4HVNA 4EBGA 2W6JH 2CWVA 3PS8A 2OTL3 4AEQA 1R4CA 1JZDA 3CPW2 3GWRA 3SYUA 5AIGA 5AYSC 3CCE3 5G2GA 1FUSA 1SPUA 1YVBI 3FGYA 3FG1A 2HMJB 3WODG 2W04A 1T2IA 2F56A 3I0YA 3JUQA 3H51A 3U1WA 1NU3A 4EYCA 1D6ZA 3QK9A 4J8TA 4BTWA 2GEXA 1N9JA 1OCVA 2XGNA 4N6V0 5M19A 1R4YA 1G02A 2AADA 3DGLA 5AIFA 4R1KA 1VQP3 2PZVA 4WP5A 5ELJA 4AKZA 3CCJ3 1BSAA 3D5GA 4XDVA 1BNEA 3QRDA 4GB5A 5IEOA 2E2UA 1BRSA 1TTOA 5FGOA 2CFLA 2ZL8A 3EQQB 1ROAA 2YFIB 3ZG0A 1TP6A 3KN4A 1IQYA 4O02B 3JUNA 6STDA 3VSYA 3HZPA 1GD3A 1RJOA 1TJDA 2CFGA 1VQ93 4I4KA 3S27A 1W02A 1QJGA 2ML5A 4U13A 3X40A 3JUPA 4H61A 2STDA 2HMMB 5IENA 3LT8A 4KT3B 1AV4A 3MKIA 4N6OB 1JBRA 4N6MA 3U97A 3PGBA 3E99A 2C11A 5A0OB 2CFWA 4JRFA 3GZRA 1GY6A 2P05A 1B2XA 1SJWA 1RGEA 1HYFA 1UUWB 1BRHA 1UGHI 2CX0A 2KXGA 2RBIA 1BNRA 2Y73A 1UDII 2V1LA 1W6CA 1RDSA 5AI1A 4CCVA 1KD14 1IT8A 4LZIA 4N6TA 3X41A 2H0GA 3WDGB 1BUQA 4QWTA 4BIRA 1AVKA 2UX0A 2IUKA 1ZS7A 4STDA 1FGQA 2M7OA 5AIHA 4EW5A 1Q824 3SXXA 1NB5I 1ASKA 4O8SA 3K0ZA 5CXOA 1YJW3 1IU7A 2B24B 5IEPA 2OWPA 5KP1A 2O9UX 1B27A 3LOYA 4I5QA 1MNLA 2QA43 3CME3 2XSHB 3GZBA 2CWTA 1O7MB 5BXQA 3GSPA 4HM1B 1VQN3 1JB4A 1W00A 2P0MA 1LNIA 2XR8B 4OVMA 2W2CA 3ECFA 1GD4A 2CW9A 1O7GB 4K90B 3KFQC 3EE1A 4DKIA 1I0XA 2UUGC 4HM0B 4KVHA 3CCU3 2YFLB 3D9RA 2AAEA 2HMNB 1K9M4 1QAKA 2LQVA 3GZYB 3NM2A 3HK4A 1BANA 4BTYA 3A5EA 8RNTA 1B21A 1G96A 1GY5A 4FCMA 1UCKA 3LH4A 1WTHA 3CCS3 1RN1A 1KC84 1IT7A 1C7HA 1OUNA 2GU1A 1OHPA 3EJVA 1T5YA 3NV0B 1JRQA 1NNVA 1RGHA 1FYSA 1CH0A 3OWUA 3EHCA 4NPBA 3G713 3F7XA 3K5TA 3V92A 1VQL3 4L8OA 1VQ83 1NB3I 2R4IA 1TRPA 3PZWA 5CF1A 3CCM3 1X1YA 1NWWA 5G1KA 1RGGA 2OQEC 5STDA 2IUJA 5AEUB 3V99A 3PYJA 1L5GB 4MMXB 3WHOA 5M1AA 1BGSA 1DYUA 4WYKB 4HM6B 3T8UA 2KF3A 3K63A 4RBNA 1EG9B 1VQM3 3IPTA 1KQS2 1DMQA 2C10A 4RNZA 3HI7A 4HM2B 2Y74A 3K9MC 1RN7A 5AIIA 1O7NB 1KSIA 2BU4A 5BIRA 4EV2A 1RCLA 1STFI 1MGWA 3D4AA 2KCDA 1W2ZA 3JVCA 3EF8A 1I0VA 1SQWA 1ROVA 3WA3A 1TFOA 6RNTA 1OACA 3Q90A 5EVHA 4HM7B 2CWUA 4HYZA 3S5CA 5CF2A 1LOXA 5ELUA 2CX1A 2FNQA 5KP3A 1BUJA 4FMDA 1IDPA 3NBRA 1FGRA 3NUVA 1S5AA 3DGMA 3FSDA 2W56B 1UI8A 1IQXA 3V98A 1W6GA 3NV0A 2XH9A 1C54A 3MG1A 4N3VA 1RRHA 2Z7AA 1MWUA 1E3VA 3DGOA 3PXMA 2R41A 3BB9A 2KF6A 3GAXA 1OF5A 4WWUC 2MC8A 3NQZA 4ZM8A 1BOXA 3AGNA 3FF2A 3B4OA 1S723 1VQ73 3EC9A 4J9AA 1A67A 1UCIA 1SARA 1LOYA 1DETA 1YIT3 1RHLA 1LOWA 1DMMA 2W9QA 2RFRA 1CYUA 3DM8A 6GSPA 2XEPA 3LYGA 1JKGB 1QAFA 2FXTA 3HOHA 5IERA 1JBSA 2OCTA 3X3ZA 2GXFA 1YHQ3 5BVBA 1MGRA 3X3XA 1GMPA 1UCJA 1BSCA 1A2PA 2P38A 4HZBB 2OOVA 1B2ZA 2BT3A 4HKVB 1RGKA 1JZOA 4R4KA 1Y4KA 3CC23 2HMKB 1Q40B 1SIIA 2D42A 5IG5A 3Q3FA 2WOHA 1HZ1A 2GSPA 1JV2B 1EUIC 1F8NA 2XFSA 3KCHA 3GRDA 4K1UA 2CH9A 3CC43 1ISKA 4IPBA 3EX9A 3DMCA 1O7PB 4OUQA 4J5GA 5IF6A 1G0TA 3G4S3 3DZLA 4HM3B 3EB8A 4XDWA 2BMRB 1O7HB 4HM5B 1IYYA 1PYLA 3CU3A 2P0XA 1OHSA 2XSOB 3K7CA 1Q9EA 4LMIA 3AMOA 4KFEA 3LMLA 3NBJA 5FW5A 2IY2A 2Q07A 2GEYA 1BSDA 1BSBA 4L7KA 1YI23 1DVDA 1Q7Y4 3TDGA 3ZG5A 4KFFA 4LYLB 4IIAA 4XBXA 1GY7A 1FA3A 1MOLA 4LGQA 1M1K4 2Z6BA 2I9WA 1Q864 2MF7A 4XM4A 4HZ9B 1ZGXA 2O3OA 3UJMA 1YIJ3 4RNTA 5HOHA 1E97A 1IV9A 3OV4A 4BTXA 4CJNA 3F8XA 3KSED 4CDLA 1GS3A 1QMAA 2QIYA 3LXUX 3DXOA 4IT7A 5KP4A 3SX1A 3CC73 1OGXA 2W0QA 4FCJA 1W4NA 4N6NB 2RGQA 5I97A 3NBBA 3OX9A 5D83A 1FGTA 2GBWB 1DE3A 1RNBA 1JN5A 3JUOA 1M9GA 3BNEA 2QGUA 4O3VA 1JJ22 1WMPA 3FZWA 1OH0A 1LQMB 3G16A 3G0KA 2W9PA 1RCKA 1SIHA 3NM7A 4Q53A 3S67A 1BNGA 1X1WA 1DVCA 3N9HA 5JPPA 1EA2A 2KAAA 7RNTA 1RKYA 2JDIH 4WFOA 1FUWA 1WMNA 2F99A 3LZAA 4GL6A 4XBTA 2W03A 3D5IA 1RLSA 3H3HA 1OGZA 5LC6A 4XBYA 2BHMA 1I70A 1BRNL 1U5OA 4LEHA 4OK0A 5DRVA 1Q7HA 3T0UA 2OTJ3 1JNQA 4WYKA 4EV5A 2L1SA 1AQZA 1BRKA 1W01A 5TGNA 3F7SA 3OXAA 3AMOB 2UGIA 2RSXA 1GMRA 3FKAA 2F5WA 5IG0A 3RDEA 3WMDA 3KZTA 3FH1A 1GMQA 3D3LA 2BMOB 1UUGB 3LT9A 3PCSA 3UL6A 1BNIA 1IK3A 1ZX2A 2HMLB 3MSOA 1RTUA 3FLJA 2CG0A 4HAAA 1N8R4 1VQ63 4PEJA 3RNTA 1GOVA 2F5MA 1YNVX 5AYRB 1DMNA 3KKGA 1QVF2 4EXRA 3CPOA 1BSEA 1IQ8A 3CNXA 2L4VA 1LRAA 2E2TA 3SOAA 4NHFA 4RZMA 1N8QA 5HGRA 4FMAA 4H3UA 3CCV3 3OW22 4TX4A 4BU4A 4LSOA 2WO0A 1BRIA 3B8LA 2H0IA 4GSPA 5EQLA 3X42A 1AY7A 2INXA 1NJI4 3BU4A 1UGIA 2GBXB 2WGOA 2ML6A 5D82A 3GZXB 8CHOA 1W2B2 2WGQA 1GSPA 2SBLA 2XGLA 4HM8B
chains in the Genus database with same CATH topology
2Z76A 3FG3A 1J2BA 2LYXA 1FGMA 1O7WB 1OHOA 1NDOB 4AKYA 3OWYA 4RNYA 1JB2A 3FG4A 1Q42A 1TIJA 5LC7A 3BNBA 4N6LA 4HBRA 1ZO2A 3DUKA 3MHEA 3KE7A 3FCSB 1W6YA 1TUHA 1N5PA 2CHCA 1U8CB 1KWIA 2F98A 1IVWA 2CIUA 1HU9A 1YGEA 3IJEB 1YJN3 3UL5A 2XF3A 2BNGA 3MYTA 3S28A 3LTAA 3I563 1A2KA 2BMQB 1W5ZA 3OWSA 3NXJA 2XRXB 3JUMA 5JPUA 2BO9B 2YFJB 1K8A4 2HMOB 1AR0A 5IW9A 1IVXA 1LVNA 1ULJB 2GU3A 3CCL3 4R80A 1IVUA 4O2HA 2CK3H 3MG2A 3N8BA 1VQK3 2WOFA 4HJLB 4L8PA 1CQSA 3G6E3 4R9KA 2OQEA 4K61A 1OPYA 2CFDA 1AVLA 4MMZB 2CKFB 3CNMA 3CCQ3 1Z1SA 3B4PA 1CEWI 3X3YA 1VQO3 3LTDA 4XB5A 4ORLA 3SLUA 2KRTA 3M8CA 2P09A 1K41A 1OF5B 3G8ZA 2A15A 4HM4B 3MG3A 1N9EA 2FGTA 4MJDA 3VGNA 3FF0A 4FMBA 4R9LA 3NX0A 3J7Yd 3CXC2 3NQYA 1UW1A 3Q2PA 3ROBA 3BNCA 1V74A 3UNLA 3F8HA 3SEDA 3CCR3 3EBYA 1JN5B 1HKXA 3KIIA 4K1VA 5DREA 1M1XB 2XFTA 4MMYB 3I553 3ALAA 1IV7A 1US1A 1VQ43 1QVG2 3HIIA 3CD63 3VF1A 4FMCA 2B1XB 1LNHA 2QEX3 5CLKA 1WQLB 1A90A 4MEIA 1PU4A 2RCDA 1TFKA 1STDA 3T8NA 4FCZA 1WMOA 1WNHA 1ULIB 1K734 3EBTA 2CC3A 3N54B 1PFPA 3NHXA 2K54A 1N5HA 3HX8A 1LXEA 4WHAA 3WA2X 2OOVC 4NREA 1CYVA 1QALA 4N6UA 5EEOA 2ZDJA 4X2OA 3WOEB 1YJ93 2K0MA 3Q1CA 3RGRA 3F14A 4FR9A 3BLZA 3STDA 3WOFB 1RRLA 3S29A 5IG4A 1E3RA 1GYBA 3F40A 3A76A 3KSPA 4KZ1A 3EN8A 1FGOA 2F86B 3EN1B 3DY5A 1EKMA 3SVAA 2IMJA 3MPHA 3SOYA 7STDA 2Z77A 3ER7A 1VQ53 2JQ5A 1EQKA 1D6YA 2IA7A 4X2HA 3LTBA 2D1WA 4G1MB 1D6UA 5AEWB 3HIGA 3B7CA 1UUVB 3DGNA 3L0RA 1K28A 3O8YA 1JKGA 3MWZA 1VZZA 3IMAB 5CK6A 1UI7A 5IG3A 1TU5A 3RGAA 1A2VA 1M904 1W7CA 2E2VA 3BNDA 5D81A 2YX9A 3CMA3 1Q814 4KFDA 3PCRA 1IVVA 3F9SA 3LTCA 3UB1A 2W56A 4JF8A 2CFKA 1Q40A 2PNCA 5JBSA 2CG1A 1JB5A 1NO3A 4HVNA 4EBGA 2W6JH 2CWVA 3PS8A 2OTL3 4AEQA 1R4CA 3CPW2 3GWRA 5AIGA 5AYSC 3CCE3 5G2GA 3FGYA 1SPUA 1YVBI 3FG1A 2HMJB 3WODG 2W04A 3JUQA 3U1WA 3I0YA 4EYCA 3H51A 1NU3A 1D6ZA 3QK9A 4J8TA 4BTWA 2GEXA 1N9JA 1OCVA 2XGNA 4N6V0 3DGLA 5AIFA 4R1KA 1VQP3 2PZVA 4WP5A 5ELJA 4AKZA 3CCJ3 4XDVA 3QRDA 4GB5A 5IEOA 2E2UA 5FGOA 2CFLA 2ZL8A 3EQQB 1ROAA 2YFIB 1TP6A 3KN4A 1IQYA 4O02B 3JUNA 6STDA 3VSYA 3HZPA 1GD3A 1RJOA 2CFGA 1VQ93 4I4KA 3S27A 1W02A 1QJGA 2ML5A 4U13A 3X40A 3JUPA 4H61A 2STDA 2HMMB 5IENA 3LT8A 1AV4A 3MKIA 4N6OB 4N6MA 3U97A 3PGBA 3E99A 2C11A 5A0OB 2CFWA 4JRFA 3GZRA 2P05A 1GY6A 1SJWA 1UUWB 2KXGA 2Y73A 2V1LA 1W6CA 5AI1A 4CCVA 1KD14 1IT8A 4LZIA 4N6TA 3X41A 3WDGB 1BUQA 4QWTA 4EC6A 1AVKA 2UX0A 2IUKA 4STDA 5AIHA 1FGQA 2M7OA 1Q824 1NB5I 1A67A 3SXXA 1ASKA 4O8SA 3K0ZA 5CXOA 1YJW3 1IU7A 2B24B 5IEPA 2OWPA 5KP1A 2O9UX 3LOYA 1MNLA 2QA43 3CME3 2XSHB 3GZBA 2CWTA 1O7MB 5BXQA 4HM1B 1VQN3 1JB4A 1W00A 2P0MA 2XR8B 4OVMA 2W2CA 3ECFA 1GD4A 2CW9A 1O7GB 4K90B 3KFQC 3EE1A 4HM0B 4KVHA 3CCU3 2YFLB 3D9RA 2HMNB 1K9M4 1QAKA 2LQVA 3GZYB 3NM2A 3HK4A 4BTYA 1G96A 1GY5A 4FCMA 3LH4A 1WTHA 3CCS3 1KC84 1IT7A 1C7HA 1OUNA 2GU1A 1OHPA 3EJVA 1T5YA 3NV0B 1JRQA 3OWUA 5AYRB 3G713 3EHCA 3F7XA 3K5TA 3V92A 1VQL3 4L8OA 1VQ83 1NB3I 2R4IA 3PZWA 5CF1A 3CCM3 1NWWA 2OQEC 5STDA 2IUJA 5AEUB 3V99A 3PYJA 1L5GB 4MMXB 1DYUA 4WYKB 4HM6B 3T8UA 3K63A 4RBNA 1VQM3 1EG9B 1KQS2 3IPTA 1DMQA 2C10A 4RNZA 3HI7A 4HM2B 2Y74A 3K9MC 1RN7A 5AIIA 1O7NB 1KSIA 4EV2A 1STFI 2KCDA 1W2ZA 3JVCA 3EF8A 1SQWA 1ROVA 3WA3A 1TFOA 1OACA 3Q90A 5EVHA 4HM7B 2CWUA 4HYZA 3S5CA 5CF2A 1LOXA 5ELUA 2FNQA 5KP3A 4FMDA 1IDPA 3NBRA 1FGRA 3NUVA 1S5AA 3DGMA 3FSDA 2W56B 1UI8A 1IQXA 3V98A 1W6GA 3NV0A 2XH9A 3MG1A 4N3VA 1RRHA 2Z7AA 3DGOA 1E3VA 3PXMA 3BB9A 3GAXA 1OF5A 4WWUC 2MC8A 3NQZA 4ZM8A 3FF2A 1S723 3B4OA 1VQ73 3EC9A 4J9AA 1YIT3 1DMMA 2W9QA 2RFRA 1CYUA 3DM8A 2XEPA 3LYGA 1JKGB 1QAFA 2FXTA 5IERA 2OCTA 3X3ZA 2GXFA 1YHQ3 5BVBA 3X3XA 4HZBB 2P38A 2OOVA 2BT3A 4HKVB 4R4KA 1Y4KA 3CC23 2HMKB 1Q40B 1SIIA 2D42A 5IG5A 2WOHA 1JV2B 1F8NA 2XFSA 4K1UA 3GRDA 2CH9A 3CC43 1ISKA 4IPBA 3EX9A 3DMCA 1O7PB 4OUQA 5IF6A 3G4S3 3DZLA 4HM3B 3EB8A 4XDWA 2BMRB 1O7HB 4HM5B 3CU3A 2P0XA 1OHSA 2XSOB 3K7CA 4LMIA 3AMOA 4KFEA 3LMLA 3NBJA 5FW5A 2Q07A 2GEYA 4L7KA 1YI23 1DVDA 1Q7Y4 3TDGA 4KFFA 4IIAA 4XBXA 1GY7A 1FA3A 1MOLA 4LGQA 1M1K4 2Z6BA 2I9WA 1Q864 2MF7A 4XM4A 4HZ9B 2O3OA 3UJMA 1YIJ3 1E97A 1IV9A 3OV4A 4BTXA 3F8XA 3KSED 4CDLA 1GS3A 1QMAA 2QIYA 3LXUX 3DXOA 4IT7A 5KP4A 3SX1A 3CC73 1OGXA 2W0QA 4FCJA 1W4NA 4N6NB 2RGQA 5I97A 3NBBA 3OX9A 5D83A 1FGTA 2GBWB 1JN5A 3JUOA 1M9GA 3BNEA 2QGUA 4O3VA 1JJ22 1WMPA 3FZWA 1OH0A 3G16A 3G0KA 2W9PA 1SIHA 3NM7A 3S67A 4Q53A 1DVCA 3N9HA 5JPPA 1EA2A 1RKYA 2JDIH 4WFOA 1FUWA 1WMNA 2F99A 3LZAA 4GL6A 4XBTA 2W03A 3H3HA 1OGZA 5LC6A 4XBYA 2BHMA 1U5OA 4LEHA 4OK0A 5DRVA 2OTJ3 3T0UA 1JNQA 4WYKA 4EV5A 1W01A 5TGNA 3F7SA 3OXAA 3AMOB 2RSXA 3FKAA 5IG0A 3RDEA 3WMDA 3KZTA 3FH1A 3D3LA 2BMOB 3LT9A 3PCSA 3UL6A 1IK3A 1ZX2A 2HMLB 3MSOA 1VQ63 3FLJA 2CG0A 1N8R4 4PEJA 1DMNA 3KKGA 1QVF2 4EXRA 3CPOA 3CNXA 1IQ8A 2L4VA 2E2TA 3SOAA 4NHFA 4RZMA 1N8QA 5HGRA 4FMAA 4H3UA 3CCV3 3OW22 4TX4A 4LSOA 2WO0A 3B8LA 3X42A 5EQLA 2INXA 1NJI4 2GBXB 2WGOA 2ML6A 5D82A 3GZXB 8CHOA 1W2B2 2WGQA 4HM8B 2SBLA 2XGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z76 A;  2HMK B;  1Q40 B;  1UUW B;  5IG5 A;  1O7W B;  1OHO A;  1NDO B;  3OWY A;  4X2O A;  4K1U A;  3GRD A;  1JB2 A;  5AI1 A;  1Q42 A;  3RGR A;  3F14 A;  1ISK A;  3BLZ A;  3EX9 A;  3STD A;  3DMC A;  1O7P B;  4OUQ A;  5IF6 A;  1BUQ A;  3DZL A;  4HM3 B;  2UX0 A;  4STD A;  2BMR B;  1E3R A;  1GYB A;  1O7H B;  1ZO2 A;  3DUK A;  3F40 A;  3KE7 A;  3MHE A;  1ASK A;  1W6Y A;  3A76 A;  3KSP A;  1TUH A;  3CU3 A;  1OHS A;  2XSO B;  3EN8 A;  2CHC A;  2F98 A;  2F86 B;  3EN1 B;  3K0Z A;  3K7C A;  4LMI A;  5CXO A;  2B24 B;  5IEP A;  2OWP A;  5KP1 A;  5FW5 A;  2IMJ A;  2GEY A;  3SOY A;  2XSH B;  3GZB A;  4L7K A;  1O7M B;  2Z77 A;  3ER7 A;  2JQ5 A;  5BXQ A;  4HM1 B;  7STD A;  2BNG A;  3MYT A;  1JB4 A;  4X2H A;  1W00 A;  4IIA A;  1GY7 A;  2XR8 B;  4XBX A;  4OVM A;  5AEW B;  1A2K A;  2BMQ B;  2W2C A;  3ECF A;  3B7C A;  1UUV B;  4LGQ A;  3OWS A;  1O7G B;  3NXJ A;  2XRX B;  2I9W A;  4HM0 B;  4KVH A;  3JUM A;  4XM4 A;  2YFJ B;  4HZ9 B;  5JPU A;  2YFL B;  3D9R A;  2HMO B;  3UJM A;  1AR0 A;  1JKG A;  1VZZ A;  2HMN B;  3NM2 A;  5CK6 A;  3GZY B;  1E97 A;  3HK4 A;  3OV4 A;  5IG3 A;  4XDW A;  3F8X A;  3RGA A;  4CDL A;  1GS3 A;  1GY5 A;  4FCM A;  1QMA A;  2QIY A;  1ULJ B;  3DXO A;  5KP4 A;  5D81 A;  1OGX A;  4FCJ A;  2RGQ A;  1C7H A;  3EJV A;  1OUN A;  3OX9 A;  1OHP A;  3NV0 B;  3OWU A;  3F9S A;  5D83 A;  3MG2 A;  3EHC A;  2GBW B;  3F7X A;  1JN5 A;  4L8O A;  1Q40 A;  3JUO A;  4HJL B;  1CQS A;  2QGU A;  2R4I A;  4L8P A;  4R9K A;  5CF1 A;  1OPY A;  1NWW A;  1OH0 A;  3FZW A;  1JB5 A;  2CKF B;  3CNM A;  3G0K A;  3G16 A;  5STD A;  4HVN A;  5AEU B;  1Z1S A;  3B4P A;  4HM6 B;  4WYK B;  4Q53 A;  3T8U A;  1EG9 B;  3IPT A;  1DMQ A;  4XB5 A;  4ORL A;  3GWR A;  4HM2 B;  5JPP A;  1EA2 A;  3M8C A;  1O7N B;  5AII A;  5AIG A;  5G2G A;  2F99 A;  1K41 A;  1OF5 B;  3FGY A;  3G8Z A;  3LZA A;  2HMJ B;  4XBT A;  2A15 A;  5AIH A;  4HM4 B;  3EF8 A;  3MG3 A;  3H3H A;  4MJD A;  3VGN A;  3FF0 A;  3JUQ A;  3I0Y A;  4R9L A;  1OGZ A;  3H51 A;  1NU3 A;  4XBY A;  3Q90 A;  5EVH A;  4HM7 B;  1U5O A;  3S5C A;  4LEH A;  3ROB A;  5CF2 A;  5DRV A;  4J8T A;  5KP3 A;  3UNL A;  3F8H A;  1IDP A;  2GEX A;  1OCV A;  3NBR A;  3SED A;  3NUV A;  1S5A A;  4WYK A;  3EBY A;  3FSD A;  1JN5 B;  1HKX A;  1W01 A;  4K1V A;  5DRE A;  5TGN A;  3F7S A;  3OXA A;  4R1K A;  5AIF A;  2PZV A;  3NV0 A;  4WP5 A;  3FKA A;  5IG0 A;  3WMD A;  3KZT A;  4XDV A;  3FH1 A;  3MG1 A;  4GB5 A;  2BMO B;  4N3V A;  2B1X B;  2Z7A A;  1E3V A;  5IEO A;  3BB9 A;  5CLK A;  1WQL B;  1OF5 A;  4WWU C;  1ZX2 A;  2HML B;  3EQQ B;  3MSO A;  3FLJ A;  2RCD A;  2YFI B;  3FF2 A;  3B4O A;  1STD A;  1TP6 A;  3EC9 A;  4J9A A;  4PEJ A;  3T8N A;  3JUN A;  6STD A;  3VSY A;  3HZP A;  1DMN A;  1DMM A;  3KKG A;  2RFR A;  1ULI B;  3CPO A;  4HM5 B;  3CNX A;  1W02 A;  1QJG A;  3DM8 A;  4I4K A;  3LYG A;  4U13 A;  1JKG B;  3JUP A;  3SOA A;  4RZM A;  5HGR A;  3EBT A;  2STD A;  2HMM B;  4H3U A;  5IER A;  5IEN A;  3MKI A;  2GXF A;  3B8L A;  3NHX A;  5BVB A;  5IG4 A;  2K54 A;  2INX A;  3E99 A;  3HX8 A;  2GBX B;  4HZB B;  5D82 A;  3GZX B;  8CHO A;  4HM8 B;  4HKV B;  3GZR A;  1GY6 A;  1SJW A; 
#chains in the Genus database with same CATH topology
 2Z76 A;  3FG3 A;  1J2B A;  2LYX A;  1FGM A;  1O7W B;  1OHO A;  1NDO B;  1RGA A;  3DGY A;  3OWY A;  4ILF A;  4RNY A;  4AKY A;  4EC6 A;  1JB2 A;  3FG4 A;  1Q42 A;  3WR2 A;  1TIJ A;  1I3F A;  5LC7 A;  3BNB A;  1UCL A;  4N6L A;  4HBR A;  1ZO2 A;  3DUK A;  3MHE A;  3KE7 A;  3FCS B;  1W6Y A;  1PY3 A;  1TUH A;  1N5P A;  1BNJ A;  2CHC A;  1U8C B;  1KWI A;  2F98 A;  1BIR A;  1IVW A;  3DH2 A;  2CIU A;  1HU9 A;  1YGE A;  3IJE B;  1YJN 3;  5RNT A;  2KF5 A;  3UL5 A;  2XF3 A;  4J5K A;  2BNG A;  3MYT A;  3S28 A;  3LTA A;  1RN4 A;  1B2S A;  3I56 3;  1A2K A;  2BMQ B;  1W5Z A;  3OWS A;  3NXJ A;  2XRX B;  3JUM A;  5JPU A;  2BO9 B;  2YFJ B;  1K8A 4;  2HMO B;  1AR0 A;  1LQG C;  5IW9 A;  1IVX A;  1MWS A;  1LVN A;  1ULJ B;  2GU3 A;  3CCL 3;  1B20 A;  4R80 A;  1B3S A;  1GOY A;  1IVU A;  4O2H A;  1RGL A;  2CK3 H;  3MG2 A;  3N8B A;  1VQK 3;  2WOF A;  4HJL B;  4L8P A;  1CQS A;  3G6E 3;  4R9K A;  3ZFZ A;  2OQE A;  4K61 A;  1OPY A;  2CFD A;  1AVL A;  4MMZ B;  2CKF B;  3CNM A;  3CCQ 3;  2F4Y A;  1I2F A;  1Z1S A;  3B4P A;  1CEW I;  3X3Y A;  1VQO 3;  2J8X B;  3LTD A;  1V58 A;  4XB5 A;  7GSP A;  4ORL A;  3SLU A;  1RSN A;  1V57 A;  2KRT A;  3M8C A;  2P09 A;  1K41 A;  1OF5 B;  3G8Z A;  5BU4 A;  3AHW A;  2A15 A;  4HM4 B;  1BNF A;  3MG3 A;  1N9E A;  2FGT A;  4MJD A;  3VGN A;  3FF0 A;  4FMB A;  4R9L A;  3NX0 A;  3J7Y d;  3CXC 2;  3NQY A;  1UW1 A;  1VQQ A;  2SAR A;  3Q2P A;  2IYJ A;  3ROB A;  3BNC A;  3AGO A;  1V74 A;  3UNL A;  3F8H A;  3SED A;  3CCR 3;  3EBY A;  4BL2 A;  1JN5 B;  1HKX A;  3KII A;  2KF4 A;  2RNT A;  1M1X B;  3AHS A;  4K1V A;  5DRE A;  2XFT A;  4MMY B;  3I55 3;  1BNS A;  1IV7 A;  1US1 A;  3ALA A;  4GHO A;  1QVG 2;  1VQ4 3;  3HII A;  9RNT A;  1I8V A;  4HOH A;  1BAO A;  2C4B A;  3VF1 A;  4FMC A;  4BL3 A;  2B1X B;  1RGC A;  1LNH A;  3CD6 3;  1GOU A;  5CLK A;  2QEX 3;  1WQL B;  1A90 A;  3BIR A;  4MEI A;  1T2H A;  1PU4 A;  1MWT A;  2K3D A;  1TFK A;  2RCD A;  1STD A;  3T8N A;  4FCZ A;  1WMO A;  5M18 A;  1LOV A;  1WNH A;  1BRJ A;  1ULI B;  3URP A;  1K73 4;  3EBT A;  2ZHX B;  2CC3 A;  3N54 B;  1PFP A;  3NHX A;  2K54 A;  5G1L A;  1N5H A;  3HX8 A;  1LXE A;  4WHA A;  3WA2 X;  1I2G A;  2OOV C;  4NRE A;  1CYV A;  1FUT A;  1QAL A;  4N6U A;  5EEO A;  2ZDJ A;  4X2O A;  3WOE B;  1YJ9 3;  2BIR A;  2K0M A;  3Q1C A;  3RGR A;  3F14 A;  4FR9 A;  3BLZ A;  3STD A;  1RMS A;  3WOF B;  1RRL A;  3D79 A;  1TRQ A;  3S29 A;  5IG4 A;  1E3R A;  1GYB A;  3F40 A;  3A76 A;  3KSP A;  2HOH A;  4KZ1 A;  3EN8 A;  1FGO A;  2F86 B;  3EN1 B;  3DY5 A;  1EKM A;  1T3B A;  3SVA A;  1B2M A;  2IMJ A;  1MWR A;  3MPH A;  5GSP A;  3SOY A;  7STD A;  2Z77 A;  3ER7 A;  1VQ5 3;  2JQ5 A;  1B2U A;  1D6Y A;  1EQK A;  2IA7 A;  4X2H A;  3LTB A;  2D1W A;  4G1M B;  1D6U A;  5AEW B;  3HIG A;  3B7C A;  1UUV B;  1RNT A;  3DGN A;  2ZA4 A;  3L0R A;  1K28 A;  1RGF A;  3O8Y A;  1JKG A;  3MWZ A;  1VZZ A;  1FW7 A;  1I3I A;  3IMA B;  5CK6 A;  1UI7 A;  1BVI A;  1X1X A;  5IG3 A;  1TU5 A;  1YGW A;  3RGA A;  1A2V A;  1M90 4;  1W7C A;  1YVS A;  2E2V A;  1JBT A;  3BND A;  5D81 A;  2YX9 A;  3CMA 3;  1Q81 4;  4KFD A;  3PCR A;  1IVV A;  3F9S A;  1X1U A;  3LTC A;  3UB1 A;  1BU4 A;  2W56 A;  4JF8 A;  1EEJ A;  1Q40 A;  1FZU A;  2CFK A;  2H0H A;  4CPK A;  2PNC A;  1I2E A;  5JBS A;  1BRG A;  2CG1 A;  1JB5 A;  1NO3 A;  4HVN A;  4EBG A;  2W6J H;  2CWV A;  3PS8 A;  2OTL 3;  4AEQ A;  1R4C A;  1JZD A;  3CPW 2;  3GWR A;  3SYU A;  5AIG A;  5AYS C;  3CCE 3;  5G2G A;  1FUS A;  1SPU A;  1YVB I;  3FGY A;  3FG1 A;  2HMJ B;  3WOD G;  2W04 A;  1T2I A;  2F56 A;  3I0Y A;  3JUQ A;  3H51 A;  3U1W A;  1NU3 A;  4EYC A;  1D6Z A;  3QK9 A;  4J8T A;  4BTW A;  2GEX A;  1N9J A;  1OCV A;  2XGN A;  4N6V 0;  5M19 A;  1R4Y A;  1G02 A;  2AAD A;  3DGL A;  5AIF A;  4R1K A;  1VQP 3;  2PZV A;  4WP5 A;  5ELJ A;  4AKZ A;  3CCJ 3;  1BSA A;  3D5G A;  4XDV A;  1BNE A;  3QRD A;  4GB5 A;  5IEO A;  2E2U A;  1BRS A;  1TTO A;  5FGO A;  2CFL A;  2ZL8 A;  3EQQ B;  1ROA A;  2YFI B;  3ZG0 A;  1TP6 A;  3KN4 A;  1IQY A;  4O02 B;  3JUN A;  6STD A;  3VSY A;  3HZP A;  1GD3 A;  1RJO A;  1TJD A;  2CFG A;  1VQ9 3;  4I4K A;  3S27 A;  1W02 A;  1QJG A;  2ML5 A;  4U13 A;  3X40 A;  3JUP A;  4H61 A;  2STD A;  2HMM B;  5IEN A;  3LT8 A;  4KT3 B;  1AV4 A;  3MKI A;  4N6O B;  1JBR A;  4N6M A;  3U97 A;  3PGB A;  3E99 A;  2C11 A;  5A0O B;  2CFW A;  4JRF A;  3GZR A;  1GY6 A;  2P05 A;  1B2X A;  1SJW A;  1RGE A;  1HYF A;  1UUW B;  1BRH A;  1UGH I;  2CX0 A;  2KXG A;  2RBI A;  1BNR A;  2Y73 A;  1UDI I;  2V1L A;  1W6C A;  1RDS A;  5AI1 A;  4CCV A;  1KD1 4;  1IT8 A;  4LZI A;  4N6T A;  3X41 A;  2H0G A;  3WDG B;  1BUQ A;  4QWT A;  4BIR A;  1AVK A;  2UX0 A;  2IUK A;  1ZS7 A;  4STD A;  1FGQ A;  2M7O A;  5AIH A;  4EW5 A;  1Q82 4;  3SXX A;  1NB5 I;  1ASK A;  4O8S A;  3K0Z A;  5CXO A;  1YJW 3;  1IU7 A;  2B24 B;  5IEP A;  2OWP A;  5KP1 A;  2O9U X;  1B27 A;  3LOY A;  4I5Q A;  1MNL A;  2QA4 3;  3CME 3;  2XSH B;  3GZB A;  2CWT A;  1O7M B;  5BXQ A;  3GSP A;  4HM1 B;  1VQN 3;  1JB4 A;  1W00 A;  2P0M A;  1LNI A;  2XR8 B;  4OVM A;  2W2C A;  3ECF A;  1GD4 A;  2CW9 A;  1O7G B;  4K90 B;  3KFQ C;  3EE1 A;  4DKI A;  1I0X A;  2UUG C;  4HM0 B;  4KVH A;  3CCU 3;  2YFL B;  3D9R A;  2AAE A;  2HMN B;  1K9M 4;  1QAK A;  2LQV A;  3GZY B;  3NM2 A;  3HK4 A;  1BAN A;  4BTY A;  3A5E A;  8RNT A;  1B21 A;  1G96 A;  1GY5 A;  4FCM A;  1UCK A;  3LH4 A;  1WTH A;  3CCS 3;  1RN1 A;  1KC8 4;  1IT7 A;  1C7H A;  1OUN A;  2GU1 A;  1OHP A;  3EJV A;  1T5Y A;  3NV0 B;  1JRQ A;  1NNV A;  1RGH A;  1FYS A;  1CH0 A;  3OWU A;  3EHC A;  4NPB A;  3G71 3;  3F7X A;  3K5T A;  3V92 A;  1VQL 3;  4L8O A;  1VQ8 3;  1NB3 I;  2R4I A;  1TRP A;  3PZW A;  5CF1 A;  3CCM 3;  1X1Y A;  1NWW A;  5G1K A;  1RGG A;  2OQE C;  5STD A;  2IUJ A;  5AEU B;  3V99 A;  3PYJ A;  1L5G B;  4MMX B;  3WHO A;  5M1A A;  1BGS A;  1DYU A;  4WYK B;  4HM6 B;  3T8U A;  2KF3 A;  3K63 A;  4RBN A;  1EG9 B;  1VQM 3;  3IPT A;  1KQS 2;  1DMQ A;  2C10 A;  4RNZ A;  3HI7 A;  4HM2 B;  2Y74 A;  3K9M C;  1RN7 A;  5AII A;  1O7N B;  1KSI A;  2BU4 A;  5BIR A;  4EV2 A;  1RCL A;  1STF I;  1MGW A;  3D4A A;  2KCD A;  1W2Z A;  3JVC A;  3EF8 A;  1I0V A;  1SQW A;  1ROV A;  3WA3 A;  1TFO A;  6RNT A;  1OAC A;  3Q90 A;  5EVH A;  4HM7 B;  2CWU A;  4HYZ A;  3S5C A;  5CF2 A;  1LOX A;  5ELU A;  2CX1 A;  2FNQ A;  5KP3 A;  1BUJ A;  4FMD A;  1IDP A;  3NBR A;  1FGR A;  3NUV A;  1S5A A;  3DGM A;  3FSD A;  2W56 B;  1UI8 A;  1IQX A;  3V98 A;  1W6G A;  3NV0 A;  2XH9 A;  1C54 A;  3MG1 A;  4N3V A;  1RRH A;  2Z7A A;  1MWU A;  1E3V A;  3DGO A;  3PXM A;  2R41 A;  3BB9 A;  2KF6 A;  3GAX A;  1OF5 A;  4WWU C;  2MC8 A;  3NQZ A;  4ZM8 A;  1BOX A;  3AGN A;  3FF2 A;  3B4O A;  1S72 3;  1VQ7 3;  3EC9 A;  4J9A A;  1A67 A;  1UCI A;  1SAR A;  1LOY A;  1DET A;  1YIT 3;  1RHL A;  1LOW A;  1DMM A;  2W9Q A;  2RFR A;  1CYU A;  3DM8 A;  6GSP A;  2XEP A;  3LYG A;  1JKG B;  1QAF A;  2FXT A;  3HOH A;  5IER A;  1JBS A;  2OCT A;  3X3Z A;  2GXF A;  1YHQ 3;  5BVB A;  1MGR A;  3X3X A;  1GMP A;  1UCJ A;  1BSC A;  1A2P A;  2P38 A;  4HZB B;  2OOV A;  1B2Z A;  2BT3 A;  4HKV B;  1RGK A;  1JZO A;  4R4K A;  1Y4K A;  3CC2 3;  2HMK B;  1Q40 B;  1SII A;  2D42 A;  5IG5 A;  3Q3F A;  2WOH A;  1HZ1 A;  2GSP A;  1JV2 B;  1EUI C;  1F8N A;  2XFS A;  3KCH A;  3GRD A;  4K1U A;  2CH9 A;  3CC4 3;  1ISK A;  4IPB A;  3EX9 A;  3DMC A;  1O7P B;  4OUQ A;  4J5G A;  5IF6 A;  1G0T A;  3G4S 3;  3DZL A;  4HM3 B;  3EB8 A;  4XDW A;  2BMR B;  1O7H B;  4HM5 B;  1IYY A;  1PYL A;  3CU3 A;  2P0X A;  1OHS A;  2XSO B;  3K7C A;  1Q9E A;  4LMI A;  3AMO A;  4KFE A;  3LML A;  3NBJ A;  5FW5 A;  2IY2 A;  2Q07 A;  2GEY A;  1BSD A;  1BSB A;  4L7K A;  1YI2 3;  1DVD A;  1Q7Y 4;  3TDG A;  3ZG5 A;  4KFF A;  4LYL B;  4IIA A;  4XBX A;  1GY7 A;  1FA3 A;  1MOL A;  4LGQ A;  1M1K 4;  2Z6B A;  2I9W A;  1Q86 4;  2MF7 A;  4XM4 A;  4HZ9 B;  1ZGX A;  2O3O A;  3UJM A;  1YIJ 3;  4RNT A;  5HOH A;  1E97 A;  1IV9 A;  3OV4 A;  4BTX A;  4CJN A;  3F8X A;  3KSE D;  4CDL A;  1GS3 A;  1QMA A;  2QIY A;  3LXU X;  3DXO A;  4IT7 A;  5KP4 A;  3SX1 A;  3CC7 3;  1OGX A;  2W0Q A;  4FCJ A;  1W4N A;  4N6N B;  2RGQ A;  5I97 A;  3NBB A;  3OX9 A;  5D83 A;  1FGT A;  2GBW B;  1DE3 A;  1RNB A;  1JN5 A;  3JUO A;  1M9G A;  3BNE A;  2QGU A;  4O3V A;  1JJ2 2;  1WMP A;  3FZW A;  1OH0 A;  1LQM B;  3G16 A;  3G0K A;  2W9P A;  1RCK A;  1SIH A;  3NM7 A;  4Q53 A;  3S67 A;  1BNG A;  1X1W A;  1DVC A;  3N9H A;  5JPP A;  1EA2 A;  2KAA A;  7RNT A;  1RKY A;  2JDI H;  4WFO A;  1FUW A;  1WMN A;  2F99 A;  3LZA A;  4GL6 A;  4XBT A;  2W03 A;  3D5I A;  1RLS A;  3H3H A;  1OGZ A;  5LC6 A;  4XBY A;  2BHM A;  1I70 A;  1BRN L;  1U5O A;  4LEH A;  4OK0 A;  5DRV A;  1Q7H A;  3T0U A;  2OTJ 3;  1JNQ A;  4WYK A;  4EV5 A;  2L1S A;  1AQZ A;  1BRK A;  1W01 A;  5TGN A;  3F7S A;  3OXA A;  3AMO B;  2UGI A;  2RSX A;  1GMR A;  3FKA A;  2F5W A;  5IG0 A;  3RDE A;  3WMD A;  3KZT A;  3FH1 A;  1GMQ A;  3D3L A;  2BMO B;  1UUG B;  3LT9 A;  3PCS A;  3UL6 A;  1BNI A;  1IK3 A;  1ZX2 A;  2HML B;  3MSO A;  1RTU A;  3FLJ A;  2CG0 A;  4HAA A;  1N8R 4;  1VQ6 3;  4PEJ A;  3RNT A;  1GOV A;  2F5M A;  1YNV X;  5AYR B;  1DMN A;  3KKG A;  1QVF 2;  4EXR A;  3CPO A;  1BSE A;  1IQ8 A;  3CNX A;  2L4V A;  1LRA A;  2E2T A;  3SOA A;  4NHF A;  4RZM A;  1N8Q A;  5HGR A;  4FMA A;  4H3U A;  3CCV 3;  3OW2 2;  4TX4 A;  4BU4 A;  4LSO A;  2WO0 A;  1BRI A;  3B8L A;  2H0I A;  4GSP A;  5EQL A;  3X42 A;  1AY7 A;  2INX A;  1NJI 4;  3BU4 A;  1UGI A;  2GBX B;  2WGO A;  2ML6 A;  5D82 A;  3GZX B;  8CHO A;  1W2B 2;  2WGQ A;  1GSP A;  2SBL A;  2XGL A;  4HM8 B; 
#chains in the Genus database with same CATH homology
 2Z76 A;  3FG3 A;  1J2B A;  2LYX A;  1FGM A;  1O7W B;  1OHO A;  1NDO B;  4AKY A;  3OWY A;  4RNY A;  1JB2 A;  3FG4 A;  1Q42 A;  1TIJ A;  5LC7 A;  3BNB A;  4N6L A;  4HBR A;  1ZO2 A;  3DUK A;  3MHE A;  3KE7 A;  3FCS B;  1W6Y A;  1TUH A;  1N5P A;  2CHC A;  1U8C B;  1KWI A;  2F98 A;  1IVW A;  2CIU A;  1HU9 A;  1YGE A;  3IJE B;  1YJN 3;  3UL5 A;  2XF3 A;  2BNG A;  3MYT A;  3S28 A;  3LTA A;  3I56 3;  1A2K A;  2BMQ B;  1W5Z A;  3OWS A;  3NXJ A;  2XRX B;  3JUM A;  5JPU A;  2BO9 B;  2YFJ B;  1K8A 4;  2HMO B;  1AR0 A;  5IW9 A;  1IVX A;  1LVN A;  1ULJ B;  2GU3 A;  3CCL 3;  4R80 A;  1IVU A;  4O2H A;  2CK3 H;  3MG2 A;  3N8B A;  1VQK 3;  2WOF A;  4HJL B;  4L8P A;  1CQS A;  3G6E 3;  4R9K A;  2OQE A;  4K61 A;  1OPY A;  2CFD A;  1AVL A;  4MMZ B;  2CKF B;  3CNM A;  3CCQ 3;  1Z1S A;  3B4P A;  1CEW I;  3X3Y A;  1VQO 3;  3LTD A;  4XB5 A;  4ORL A;  3SLU A;  2KRT A;  3M8C A;  2P09 A;  1K41 A;  1OF5 B;  3G8Z A;  2A15 A;  4HM4 B;  3MG3 A;  1N9E A;  2FGT A;  4MJD A;  3VGN A;  3FF0 A;  4FMB A;  4R9L A;  3NX0 A;  3J7Y d;  3CXC 2;  3NQY A;  1UW1 A;  3Q2P A;  3ROB A;  3BNC A;  1V74 A;  3UNL A;  3F8H A;  3SED A;  3CCR 3;  3EBY A;  1JN5 B;  1HKX A;  3KII A;  4K1V A;  5DRE A;  1M1X B;  2XFT A;  4MMY B;  3I55 3;  3ALA A;  1IV7 A;  1US1 A;  1VQ4 3;  1QVG 2;  3HII A;  3CD6 3;  3VF1 A;  4FMC A;  2B1X B;  1LNH A;  2QEX 3;  5CLK A;  1WQL B;  1A90 A;  4MEI A;  1PU4 A;  2RCD A;  1TFK A;  1STD A;  3T8N A;  4FCZ A;  1WMO A;  1WNH A;  1ULI B;  1K73 4;  3EBT A;  2CC3 A;  3N54 B;  1PFP A;  3NHX A;  2K54 A;  1N5H A;  3HX8 A;  1LXE A;  4WHA A;  3WA2 X;  2OOV C;  4NRE A;  1CYV A;  1QAL A;  4N6U A;  5EEO A;  2ZDJ A;  4X2O A;  3WOE B;  1YJ9 3;  2K0M A;  3Q1C A;  3RGR A;  3F14 A;  4FR9 A;  3BLZ A;  3STD A;  3WOF B;  1RRL A;  3S29 A;  5IG4 A;  1E3R A;  1GYB A;  3F40 A;  3A76 A;  3KSP A;  4KZ1 A;  3EN8 A;  1FGO A;  2F86 B;  3EN1 B;  3DY5 A;  1EKM A;  3SVA A;  2IMJ A;  3MPH A;  3SOY A;  7STD A;  2Z77 A;  3ER7 A;  1VQ5 3;  2JQ5 A;  1EQK A;  1D6Y A;  2IA7 A;  4X2H A;  3LTB A;  2D1W A;  4G1M B;  1D6U A;  5AEW B;  3HIG A;  3B7C A;  1UUV B;  3DGN A;  3L0R A;  1K28 A;  3O8Y A;  1JKG A;  3MWZ A;  1VZZ A;  3IMA B;  5CK6 A;  1UI7 A;  5IG3 A;  1TU5 A;  3RGA A;  1A2V A;  1M90 4;  1W7C A;  2E2V A;  3BND A;  5D81 A;  2YX9 A;  3CMA 3;  1Q81 4;  4KFD A;  3PCR A;  1IVV A;  3F9S A;  3LTC A;  3UB1 A;  2W56 A;  4JF8 A;  2CFK A;  1Q40 A;  2PNC A;  5JBS A;  2CG1 A;  1JB5 A;  1NO3 A;  4HVN A;  4EBG A;  2W6J H;  2CWV A;  3PS8 A;  2OTL 3;  4AEQ A;  1R4C A;  3CPW 2;  3GWR A;  5AIG A;  5AYS C;  3CCE 3;  5G2G A;  3FGY A;  1SPU A;  1YVB I;  3FG1 A;  2HMJ B;  3WOD G;  2W04 A;  3JUQ A;  3U1W A;  3I0Y A;  4EYC A;  3H51 A;  1NU3 A;  1D6Z A;  3QK9 A;  4J8T A;  4BTW A;  2GEX A;  1N9J A;  1OCV A;  2XGN A;  4N6V 0;  3DGL A;  5AIF A;  4R1K A;  1VQP 3;  2PZV A;  4WP5 A;  5ELJ A;  4AKZ A;  3CCJ 3;  4XDV A;  3QRD A;  4GB5 A;  5IEO A;  2E2U A;  5FGO A;  2CFL A;  2ZL8 A;  3EQQ B;  1ROA A;  2YFI B;  1TP6 A;  3KN4 A;  1IQY A;  4O02 B;  3JUN A;  6STD A;  3VSY A;  3HZP A;  1GD3 A;  1RJO A;  2CFG A;  1VQ9 3;  4I4K A;  3S27 A;  1W02 A;  1QJG A;  2ML5 A;  4U13 A;  3X40 A;  3JUP A;  4H61 A;  2STD A;  2HMM B;  5IEN A;  3LT8 A;  1AV4 A;  3MKI A;  4N6O B;  4N6M A;  3U97 A;  3PGB A;  3E99 A;  2C11 A;  5A0O B;  2CFW A;  4JRF A;  3GZR A;  2P05 A;  1GY6 A;  1SJW A;  1UUW B;  2KXG A;  2Y73 A;  2V1L A;  1W6C A;  5AI1 A;  4CCV A;  1KD1 4;  1IT8 A;  4LZI A;  4N6T A;  3X41 A;  3WDG B;  1BUQ A;  4QWT A;  4EC6 A;  1AVK A;  2UX0 A;  2IUK A;  4STD A;  5AIH A;  1FGQ A;  2M7O A;  1Q82 4;  1NB5 I;  1A67 A;  3SXX A;  1ASK A;  4O8S A;  3K0Z A;  5CXO A;  1YJW 3;  1IU7 A;  2B24 B;  5IEP A;  2OWP A;  5KP1 A;  2O9U X;  3LOY A;  1MNL A;  2QA4 3;  3CME 3;  2XSH B;  3GZB A;  2CWT A;  1O7M B;  5BXQ A;  4HM1 B;  1VQN 3;  1JB4 A;  1W00 A;  2P0M A;  2XR8 B;  4OVM A;  2W2C A;  3ECF A;  1GD4 A;  2CW9 A;  1O7G B;  4K90 B;  3KFQ C;  3EE1 A;  4HM0 B;  4KVH A;  3CCU 3;  2YFL B;  3D9R A;  2HMN B;  1K9M 4;  1QAK A;  2LQV A;  3GZY B;  3NM2 A;  3HK4 A;  4BTY A;  1G96 A;  1GY5 A;  4FCM A;  3LH4 A;  1WTH A;  3CCS 3;  1KC8 4;  1IT7 A;  1C7H A;  1OUN A;  2GU1 A;  1OHP A;  3EJV A;  1T5Y A;  3NV0 B;  1JRQ A;  3OWU A;  5AYR B;  3G71 3;  3EHC A;  3F7X A;  3K5T A;  3V92 A;  1VQL 3;  4L8O A;  1VQ8 3;  1NB3 I;  2R4I A;  3PZW A;  5CF1 A;  3CCM 3;  1NWW A;  2OQE C;  5STD A;  2IUJ A;  5AEU B;  3V99 A;  3PYJ A;  1L5G B;  4MMX B;  1DYU A;  4WYK B;  4HM6 B;  3T8U A;  3K63 A;  4RBN A;  1VQM 3;  1EG9 B;  1KQS 2;  3IPT A;  1DMQ A;  2C10 A;  4RNZ A;  3HI7 A;  4HM2 B;  2Y74 A;  3K9M C;  1RN7 A;  5AII A;  1O7N B;  1KSI A;  4EV2 A;  1STF I;  2KCD A;  1W2Z A;  3JVC A;  3EF8 A;  1SQW A;  1ROV A;  3WA3 A;  1TFO A;  1OAC A;  3Q90 A;  5EVH A;  4HM7 B;  2CWU A;  4HYZ A;  3S5C A;  5CF2 A;  1LOX A;  5ELU A;  2FNQ A;  5KP3 A;  4FMD A;  1IDP A;  3NBR A;  1FGR A;  3NUV A;  1S5A A;  3DGM A;  3FSD A;  2W56 B;  1UI8 A;  1IQX A;  3V98 A;  1W6G A;  3NV0 A;  2XH9 A;  3MG1 A;  4N3V A;  1RRH A;  2Z7A A;  3DGO A;  1E3V A;  3PXM A;  3BB9 A;  3GAX A;  1OF5 A;  4WWU C;  2MC8 A;  3NQZ A;  4ZM8 A;  3FF2 A;  1S72 3;  3B4O A;  1VQ7 3;  3EC9 A;  4J9A A;  1YIT 3;  1DMM A;  2W9Q A;  2RFR A;  1CYU A;  3DM8 A;  2XEP A;  3LYG A;  1JKG B;  1QAF A;  2FXT A;  5IER A;  2OCT A;  3X3Z A;  2GXF A;  1YHQ 3;  5BVB A;  3X3X A;  4HZB B;  2P38 A;  2OOV A;  2BT3 A;  4HKV B;  4R4K A;  1Y4K A;  3CC2 3;  2HMK B;  1Q40 B;  1SII A;  2D42 A;  5IG5 A;  2WOH A;  1JV2 B;  1F8N A;  2XFS A;  4K1U A;  3GRD A;  2CH9 A;  3CC4 3;  1ISK A;  4IPB A;  3EX9 A;  3DMC A;  1O7P B;  4OUQ A;  5IF6 A;  3G4S 3;  3DZL A;  4HM3 B;  3EB8 A;  4XDW A;  2BMR B;  1O7H B;  4HM5 B;  3CU3 A;  2P0X A;  1OHS A;  2XSO B;  3K7C A;  4LMI A;  3AMO A;  4KFE A;  3LML A;  3NBJ A;  5FW5 A;  2Q07 A;  2GEY A;  4L7K A;  1YI2 3;  1DVD A;  1Q7Y 4;  3TDG A;  4KFF A;  4IIA A;  4XBX A;  1GY7 A;  1FA3 A;  1MOL A;  4LGQ A;  1M1K 4;  2Z6B A;  2I9W A;  1Q86 4;  2MF7 A;  4XM4 A;  4HZ9 B;  2O3O A;  3UJM A;  1YIJ 3;  1E97 A;  1IV9 A;  3OV4 A;  4BTX A;  3F8X A;  3KSE D;  4CDL A;  1GS3 A;  1QMA A;  2QIY A;  3LXU X;  3DXO A;  4IT7 A;  5KP4 A;  3SX1 A;  3CC7 3;  1OGX A;  2W0Q A;  4FCJ A;  1W4N A;  4N6N B;  2RGQ A;  5I97 A;  3NBB A;  3OX9 A;  5D83 A;  1FGT A;  2GBW B;  1JN5 A;  3JUO A;  1M9G A;  3BNE A;  2QGU A;  4O3V A;  1JJ2 2;  1WMP A;  3FZW A;  1OH0 A;  3G16 A;  3G0K A;  2W9P A;  1SIH A;  3NM7 A;  3S67 A;  4Q53 A;  1DVC A;  3N9H A;  5JPP A;  1EA2 A;  1RKY A;  2JDI H;  4WFO A;  1FUW A;  1WMN A;  2F99 A;  3LZA A;  4GL6 A;  4XBT A;  2W03 A;  3H3H A;  1OGZ A;  5LC6 A;  4XBY A;  2BHM A;  1U5O A;  4LEH A;  4OK0 A;  5DRV A;  2OTJ 3;  3T0U A;  1JNQ A;  4WYK A;  4EV5 A;  1W01 A;  5TGN A;  3F7S A;  3OXA A;  3AMO B;  2RSX A;  3FKA A;  5IG0 A;  3RDE A;  3WMD A;  3KZT A;  3FH1 A;  3D3L A;  2BMO B;  3LT9 A;  3PCS A;  3UL6 A;  1IK3 A;  1ZX2 A;  2HML B;  3MSO A;  1VQ6 3;  3FLJ A;  2CG0 A;  1N8R 4;  4PEJ A;  1DMN A;  3KKG A;  1QVF 2;  4EXR A;  3CPO A;  3CNX A;  1IQ8 A;  2L4V A;  2E2T A;  3SOA A;  4NHF A;  4RZM A;  1N8Q A;  5HGR A;  4FMA A;  4H3U A;  3CCV 3;  3OW2 2;  4TX4 A;  4LSO A;  2WO0 A;  3B8L A;  3X42 A;  5EQL A;  2INX A;  1NJI 4;  2GBX B;  2WGO A;  2ML6 A;  5D82 A;  3GZX B;  8CHO A;  1W2B 2;  2WGQ A;  4HM8 B;  2SBL A;  2XGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...