5CF2A

Crystal structure of the i80y/l114v/i116v mutant of leh
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal Structure of the I80Y/L114V/I116V mutant of LEH
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5cf2A00
4RZMA 4HM0B 6STDA 1ZO2A 3KZTA 1BUQA 2K54A 1OCVA 4MJDA 1OHSA 1OPYA 3JUOA 1NDOB 1ULJB 4HM5B 3MSOA 5AIHA 3KSPA 5DRVA 1W02A 2HMOB 3SOAA 3DZLA 4OUQA 4R9KA 3IPTA 3OWYA 2R4IA 4LEHA 4J9AA 3DM8A 2F86B 3NBRA 4K1VA 2INXA 5DREA 4FCMA 1NU3A 2F99A 3T8NA 3FLJA 3FZWA 2XRXB 3UJMA 3MHEA 4LMIA 3HZPA 4I4KA 3EX9A 3CU3A 1TP6A 2BMRB 3HX8A 3EN8A 3GWRA 5STDA 3B8LA 3CNMA 1GY6A 3HK4A 5AIGA 3E99A 1Z1SA 1Q40B 3FF0A 3EF8A 1OGXA 3NV0B 1SJWA 5AI1A 1JB4A 3OXAA 2B1XB 4HM4B 5IG5A 4WYKA 4L8OA 3FKAA 3WMDA 4XBYA 3B7CA 3JUMA 3EHCA 2RCDA 4R9LA 4X2OA 4KVHA 5IG3A 2CHCA 3LYGA 3CNXA 3K0ZA 1ZX2A 3F8HA 3JUPA 1QJGA 3F8XA 2YFJB 3OWSA 2W2CA 3DXOA 3NV0A 3NM2A 3H51A 2UX0A 3D9RA 3M8CA 4J8TA 3A76A 3OX9A 5AEUB 3JUQA 1OF5A 3ER7A 1NWWA 1STDA 2PZVA 2Z76A 4OVMA 4X2HA 2GBXB 5JPPA 5IERA 3F14A 1E3RA 2QIYA 1A2KA 1GY7A 1ULIB 3LZAA 4H3UA 4HM2B 2GBWB 5AEWB 4XDVA 1OH0A 5IENA 2STDA 3GRDA 4HZBB 3BB9A 1QMAA 1ISKA 3F40A 1ASKA 3F7SA 5IG4A 3MG2A 5IG0A 1JB5A 1W01A 5KP4A 4WP5A 4ORLA 3T8UA 3DMCA 1W00A 1O7HB 4WYKB 3FSDA 1JN5A 1AR0A 2RFRA 4HKVB 1TUHA 2B24B 4HM3B 1EG9B 1OHOA 3I0YA 4R1KA 1U5OA 3SOYA 5HGRA 5D81A 3GZBA 3RGRA 2YFLB 4U13A 1IDPA 3H3HA 3EQQB 4WWUC 3VSYA 7STDA 3OWUA 5G2GA 5EVHA 3K7CA 2QGUA 1GY5A 1JKGA 2HMKB 2GXFA 1OF5B 2I9WA 2Z77A 2CKFB 4HM8B 3S5CA 2Z7AA 3FGYA 1WQLB 1HKXA 1VZZA 2HMLB 1S5AA 3Q90A 3ECFA 3GZYB 3DUKA 1C7HA 1O7MB 5D82A 4XDWA 3B4OA 3GZRA 5CXOA 3JUNA 2XSHB 1O7NB 1UUWB 5KP3A 4PEJA 2YFIB 5CF2A 5AIIA 1OGZA 4HM1B 1UUVB 4HM6B 4L8PA 4XM4A 4HM7B 4FCJA 2BMOB 4N3VA 1O7WB 4L7KA 1Q42A 4XB5A 4HZ9B 4STDA 2BNGA 3ROBA 3NXJA 1O7GB 1E3VA 3NUVA 1E97A 4GB5A 5IF6A 1O7PB 2JQ5A 1DMMA 4CDLA 3G8ZA 2HMJB 3EC9A 3EJVA 3G16A 2GEYA 4IIAA 4XBXA 3MG3A 3KE7A 2GEXA 3FH1A 3EBTA 4HVNA 3EN1B 5CK6A 1OHPA 1DMQA 1JKGB 3STDA 2HMNB 5CLKA 3BLZA 2XSOB 3F9SA 3VGNA 1CQSA 5BVBA 2A15A 3KKGA 1W6YA 3MYTA 3UNLA 2XR8B 4HJLB 5IEPA 3F7XA 5JPUA 2OWPA 2BMQB 1OUNA 1GS3A 3CPOA 5IEOA 1GYBA 2IMJA 3SEDA 3MKIA 8CHOA 3G0KA 3EBYA 3RGAA 5CF1A 5TGNA 1JN5B 5FW5A 4LGQA 3B4PA 1Q40A 3NHXA 2RGQA 2HMMB 2F98A 5KP1A 3OV4A 1K41A 3GZXB 5D83A 5BXQA 4K1UA 3FF2A 4Q53A 1DMNA 5AIFA 1EA2A 1JB2A 4XBTA 3MG1A
chains in the Genus database with same CATH superfamily
2CG1A 2CFGA 2ML6A 4N6V0 4RZMA 2P0XA 3J7Yd 1JNQA 1YHQ3 1ROVA 3D4AA 2CX1A 4HM0B 1W2ZA 4H61A 6STDA 1ZO2A 1HU9A 3PCSA 3KZTA 2E2VA 3ZG5A 1BUQA 4CJNA 2K54A 1OCVA 4N6NB 1K8A4 4MJDA 1OHSA 1OPYA 2KF6A 3S27A 1RRHA 1D6YA 1EKMA 2GU1A 4ILFA 3CCL3 3JUOA 1B2ZA 1NDOB 1ULJB 2CFLA 3AHWA 3MSOA 4HAAA 1B21A 4HM5B 5AIHA 2F56A 3HIGA 3NBBA 3KSPA 4O02B 2Z6BA 5DRVA 1KSIA 1LOYA 1RDSA 1IT7A 2KCDA 1W02A 2CK3H 1AQZA 3CMA3 2HMOB 3SOAA 1JBRA 4N6TA 3DZLA 4OUQA 4R9KA 3IPTA 3V98A 2CFWA 4RNTA 3OWYA 1RGHA 2R4IA 1I3IA 2CWTA 4LEHA 3WOEB 4J9AA 1JRQA 1ROAA 3DM8A 1LOWA 2F86B 1RGFA 3NBRA 3UB1A 3ALAA 1GOVA 3FCSB 2UUGC 5G1KA 8RNTA 4K1VA 2INXA 1BSBA 4N6OB 5DREA 2XGLA 3LTAA 4FCMA 3O8YA 3LT9A 2KRTA 1NU3A 2F99A 3T8NA 3MG1A 4LSOA 1Q9EA 1BSCA 1BRJA 3FLJA 1A90A 3FZWA 1D6UA 1RN7A 1KD14 1GMPA 1LQGC 1LNHA 1MNLA 2Q07A 1UGIA 5GSPA 1BRHA 2XRXB 3UJMA 2CX0A 4JF8A 1VQO3 1BIRA 1VQ93 1M1XB 2BO9B 3MHEA 2FXTA 1TRQA 1BNRA 1BNGA 3A5EA 2O3OA 4LMIA 1BSAA 2GU3A 3HZPA 3X3ZA 4I4KA 3EX9A 3CU3A 3CC43 1FZUA 2BMRB 1TP6A 1QVG2 3CCJ3 1FYSA 1SARA 3FG4A 3EN8A 1HZ1A 3HX8A 3GWRA 3IMAB 3KCHA 3LT8A 1IQXA 1WNHA 4KFEA 3NBJA 5STDA 1S723 1X1XA 3HI7A 2IY2A 2AAEA 3B8LA 4K61A 1T2IA 1FGQA 1RKYA 1QVF2 3CNMA 1GY6A 2LQVA 3HK4A 3D5IA 3DGMA 1JBSA 1T5YA 4NHFA 3E99A 2W03A 1RLSA 5AIGA 1Z1SA 1Q40B 3FF0A 3K9MC 4WHAA 1YJW3 2CFKA 1SIIA 1BRKA 1UI7A 3EF8A 1K9M4 1OGXA 1B3SA 1SJWA 3NV0B 1JB4A 5AI1A 2P09A 3OXAA 2B1XB 7GSPA 1NJI4 4HM4B 1RN1A 3PYJA 1QALA 4WYKA 5M1AA 3SXXA 4L8OA 3FKAA 1WMPA 5IG5A 1Q814 1VQ43 4EV2A 1DE3A 3WMDA 1QAKA 1BNJA 1IV9A 1I2FA 1PY3A 1B2UA 2P38A 4XBYA 3B7CA 1M9GA 3JUMA 3CCS3 3EHCA 2RCDA 4R9LA 1GOYA 4X2OA 4BTXA 7RNTA 4KVHA 4IPBA 1I0XA 1WMOA 1L5GB 3HOHA 3G713 2ZL8A 2C11A 5IG3A 1I8VA 2CHCA 1J2BA 1BANA 3LYGA 3CNXA 5LC6A 3K0ZA 1I2EA 1ZX2A 3SX1A 5M19A 3F8HA 2BT3A 2H0IA 3JUPA 1QJGA 1EEJA 3FG3A 4WFOA 3V92A 1FGTA 1LNIA 2L4VA 3F8XA 1LOVA 1G0TA 1NO3A 2YFJB 3OWSA 2W2CA 1FUSA 3AGNA 1W6GA 3DXOA 2W9QA 3NM2A 1LQMB 2FNQA 3NV0A 3H51A 3V99A 3I553 2J8XB 2UX0A 4R4KA 3D9RA 1VQL3 3D3LA 4G1MB 1IVWA 1Q7HA 2CIUA 1JZDA 3M8CA 1N5HA 1RCKA 4J8TA 3N54B 3GAXA 3QK9A 1IVXA 4FR9A 4ZM8A 4BU4A 3A76A 3OX9A 2CH9A 3JUQA 4FMAA 3WA2X 5FGOA 1RNTA 1RTUA 1MGRA 2KF3A 1OF5A 3ER7A 4CCVA 1NWWA 1CYUA 1BNSA 1FGOA 1ZS7A 1VQ63 1G96A 2Y74A 1STDA 2PZVA 2Z76A 4OVMA 2MF7A 1DVDA 3DGLA 3TDGA 2BU4A 4X2HA 2GBXB 2E2UA 1RCLA 2D1WA 1FA3A 2XF3A 2KF4A 3AHSA 5JPPA 5IERA 2HOHA 3F14A 4FCZA 1E3RA 2QIYA 4KFDA 1A2KA 1B27A 3X42A 1NB5I 2CW9A 1OACA 1JJ22 3UL5A 1GY7A 2K0MA 1ULIB 3LZAA 1DETA 1GD3A 4H3UA 4HM2B 3T0UA 3CC23 1JBTA 2GBWB 3Q3FA 5AEWB 1BNIA 1W5ZA 1A2PA 4IT7A 4XDVA 2WGQA 2RSXA 3S28A 9RNTA 1OH0A 3DY5A 1IV7A 1BVIA 2R41A 5IENA 2SARA 5G1LA 2STDA 3GRDA 4N6LA 4HZBB 4FMDA 5RNTA 1RRLA 1QAFA 3BB9A 2JDIH 1STFI 1V57A 2BHMA 1PFPA 1QMAA 4J5KA 5EQLA 4KZ1A 1ISKA 3F40A 2Y73A 1ASKA 1JZOA 2C4BA 3F7SA 1YJ93 1MWSA 1YVSA 2P0MA 5IG4A 1Q864 1RGAA 3MG2A 5IG0A 1JB5A 1W01A 3GSPA 5KP4A 3NX0A 2QA43 4WP5A 2AADA 4LYLB 1US1A 4MMZB 4NREA 4ORLA 3T8UA 3ZG0A 1TTOA 2OTJ3 3DMCA 1W00A 1K734 1O7HB 4WYKB 3FSDA 3Q2PA 3N8BA 2KAAA 1AR0A 2RFRA 5EEOA 1MGWA 1BU4A 1RMSA 5AYSC 4HKVB 1TUHA 3OW22 4MMXB 2B24B 4HM3B 1EG9B 1X1YA 1R4YA 1CYVA 3KN4A 4BTYA 2CC3A 3RNTA 1OHOA 1BUJA 1Q7Y4 3I0YA 2IUJA 4R1KA 1U5OA 1AVKA 3KSED 2C10A 3SOYA 1WTHA 3CME3 3QRDA 1UGHI 3HIIA 1X1UA 4N6UA 1BGSA 2XFTA 5HGRA 1VQ73 5D81A 3GZBA 3U97A 3X3YA 2IYJA 3RGRA 3CD63 2YFLB 3RDEA 4OK0A 1GMRA 4U13A 1RSNA 4BL2A 1BSEA 3PCRA 1IDPA 3CXC2 3EB8A 3H3HA 1X1WA 3EQQB 4WWUC 1BNFA 3VSYA 7STDA 2BIRA 3OWUA 1SQWA 5LC7A 5G2GA 5EVHA 3K7CA 2OTL3 2QGUA 1GY5A 1JKGA 1VQP3 2HMKB 2GXFA 1T3BA 2YX9A 3WOFB 2SBLA 1RJOA 2W6JH 1OF5B 2I9WA 1VQ53 4NPBA 4GHOA 2Z77A 2CKFB 4HM8B 3S5CA 4BIRA 2WGOA 2Z7AA 3FGYA 1WQLB 4EC6A 2M7OA 3WHOA 5HOHA 1I0VA 1LVNA 1HKXA 1VZZA 2HMLB 2UGIA 3DGOA 4AEQA 4EW5A 1S5AA 1TU5A 3PXMA 1M904 1UCJA 1CEWI 1TFOA 1G02A 1AV4A 1U8CB 3FG1A 3K5TA 3Q90A 2F5MA 3ECFA 4FMBA 3GZYB 4AKZA 3ZFZA 3DUKA 3SVAA 3MPHA 1C7HA 1O7MB 5D82A 3VF1A 3WODG 1C54A 4XDWA 4EV5A 2WO0A 3B4OA 3GZRA 1D6ZA 5CXOA 1IK3A 1FW7A 3LH4A 3BU4A 3JUNA 2OQEC 1GOUA 3BNCA 3DGNA 1YGEA 1N8QA 1W2B2 2XSHB 2OQEA 1O7NB 2GSPA 1UUWB 5KP3A 1KWIA 2W56B 1SPUA 4PEJA 2YFIB 5CF2A 5AIIA 1OGZA 4HM1B 4MEIA 1AVLA 1UUVB 3LTBA 2CWUA 4HM6B 4L8PA 5A0OB 3PS8A 4RBNA 1BAOA 2W0QA 3X3XA 1NNVA 1T2HA 1FGMA 3CCE3 1HYFA 2ZDJA 3BNDA 4XM4A 2D42A 1KC84 2OCTA 4HM7B 4FCJA 3X40A 4EBGA 2BMOB 2FGTA 4N3VA 1O7WB 2KXGA 2XFSA 3WA3A 1VQK3 4O2HA 1TJDA 3DGYA 1EUIC 4L7KA 1LOXA 1Q42A 6GSPA 3LOYA 4HYZA 4XB5A 5I97A 4HZ9B 1Q824 1UCIA 5IW9A 1N9EA 4GL6A 4STDA 1IVVA 2BNGA 4O3VA 3ROBA 1WMNA 1TIJA 1VQM3 1RGKA 3NXJA 3G6E3 3CCU3 1SIHA 1YI23 1FGRA 1O7GB 2ZHXB 2RBIA 3EE1A 1E3VA 1MWRA 2W56A 3NUVA 1E97A 4GB5A 5ELJA 5IF6A 5BIRA 1O7PB 3IJEB 1W4NA 2JQ5A 1DMMA 1FUWA 2CFDA 4CDLA 1LXEA 3G8ZA 1BRSA 1BNEA 2F4YA 2HMJB 3URPA 1DYUA 2V1LA 3S67A 3EC9A 3WR2A 5BU4A 3EJVA 3G16A 2GEYA 1RHLA 1VQN3 2CG0A 1UDII 4IIAA 4XBXA 1V58A 1I2GA 3LMLA 3MG3A 5JBSA 1IT8A 3LTDA 3BIRA 4AKYA 1UCLA 1VQQA 2O9UX 3K63A 3KE7A 3N9HA 2GEXA 3FH1A 3EBTA 4HVNA 1DVCA 3EN1B 5CK6A 1A2VA 1OHPA 1YNVX 1DMQA 1RGEA 2CWVA 4EXRA 1NB3I 1JKGB 1FUTA 3BNBA 1IQ8A 3NQYA 4QWTA 2F5WA 3STDA 5ELUA 3BNEA 2HMNB 4N6MA 5CLKA 3BLZA 2XSOB 3F9SA 3VGNA 4KT3B 4TX4A 1CQSA 5BVBA 2A15A 3KKGA 1B2XA 4R80A 1W6YA 2H0GA 3MYTA 3CCQ3 1YIJ3 3UNLA 2XR8B 3NM7A 4HJLB 5IEPA 1RGCA 4DKIA 1RN4A 1RGGA 2L1SA 3F7XA 1TRPA 1BRIA 2LYXA 5JPUA 2OWPA 3AMOB 4HBRA 1EQKA 1VQ83 1YGWA 1IVUA 1TFKA 6RNTA 1B20A 1CH0A 2BMQB 3KIIA 1PU4A 3G4S3 2ML5A 1IYYA 4GSPA 2KF5A 4JRFA 3I563 1OUNA 1GS3A 1W7CA 4BL3A 1B2MA 1K28A 3CPOA 5IEOA 3AGOA 2IUKA 3CC73 4FMCA 1ZGXA 4KFFA 1BRGA 3CCV3 4EYCA 1GYBA 1UUGB 2XH9A 1M1K4 3MWZA 1GSPA 1BRNL 4RNYA 2IA7A 2E2TA 2K3DA 1N8R4 2P05A 2IMJA 2H0HA 3CCR3 4LZIA 3SEDA 1R4CA 1IU7A 1YJN3 3MKIA 1N5PA 1N9JA 3LTCA 1BSDA 5AYRB 3SYUA 1KQS2 8CHOA 1V74A 1IQYA 1B2SA 1MWTA 3EBYA 3G0KA 4RNZA 3DH2A 3WDGB 1RNBA 3AMOA 3CPW2 4O8SA 3RGAA 5CF1A 5TGNA 1AY7A 1JN5B 5FW5A 1BOXA 2WOFA 3L0RA 2ZA4A 3PZWA 4I5QA 2OOVC 4MMYB 1PYLA 3U1WA 4LGQA 2PNCA 3S29A 3B4PA 1UW1A 1LRAA 4HOHA 1Y4KA 3D5GA 2OOVA 1I3FA 1Q40A 2QEX3 3JVCA 3NHXA 1YVBI 2RNTA 3CCM3 4BTWA 2RGQA 2WOHA 2HMMB 2XEPA 1GD4A 1F8NA 2F98A 2W04A 5KP1A 1YIT3 1MOLA 3PGBA 3OV4A 3Q1CA 1GMQA 1K41A 1RGLA 2W9PA 3LXUX 3GZXB 5D83A 3D79A 5BXQA 4K1UA 1UCKA 3KFQC 3FF2A 1MWUA 4Q53A 1W6CA 3X41A 1DMNA 1I70A 4CPKA 2XGNA 2MC8A 5AIFA 5M18A 1EA2A 3UL6A 4J5GA 1A67A 1JB2A 4K90B 1UI8A 4XBTA 5AEUB 1JV2B 1JN5A 3SLUA 3NQZA
chains in the Genus database with same CATH topology
2CG1A 2CFGA 2ML6A 4N6V0 4RZMA 2P0XA 3J7Yd 1JNQA 1YHQ3 1ROVA 4HM0B 1W2ZA 4H61A 6STDA 1ZO2A 1HU9A 3PCSA 3KZTA 2E2VA 1BUQA 2K54A 1OCVA 4N6NB 1K8A4 4MJDA 1OHSA 1OPYA 3S27A 1RRHA 1D6YA 1EKMA 2GU1A 3CCL3 3JUOA 1NDOB 1ULJB 2CFLA 4HM5B 3MSOA 5AIHA 3HIGA 3NBBA 3KSPA 4O02B 2Z6BA 5DRVA 1KSIA 1IT7A 2KCDA 1W02A 2CK3H 3CMA3 2HMOB 3SOAA 4N6TA 3DZLA 4OUQA 4R9KA 3IPTA 3V98A 2CFWA 3OWYA 2R4IA 2CWTA 4LEHA 3WOEB 4J9AA 1JRQA 1ROAA 3DM8A 2F86B 3NBRA 3UB1A 3ALAA 3FCSB 4K1VA 2INXA 4N6OB 5DREA 2XGLA 3LTAA 4FCMA 3O8YA 3LT9A 2KRTA 1NU3A 2F99A 3T8NA 3MG1A 4LSOA 3FLJA 3FZWA 1D6UA 1RN7A 1KD14 1LNHA 1MNLA 2Q07A 2XRXB 3UJMA 4JF8A 1VQO3 1VQ93 1M1XB 2BO9B 3MHEA 2FXTA 2O3OA 4LMIA 3HZPA 2GU3A 3X3ZA 4I4KA 3EX9A 3CU3A 3CC43 1TP6A 2BMRB 1QVG2 3CCJ3 3FG4A 3HX8A 3EN8A 3LT8A 3GWRA 3IMAB 4KFEA 5STDA 1IQXA 1WNHA 1S723 3NBJA 3HI7A 4K61A 3B8LA 1FGQA 1RKYA 1QVF2 3CNMA 1GY6A 2LQVA 3HK4A 3DGMA 1JJ22 1T5YA 4NHFA 3E99A 2W03A 5AIGA 1Z1SA 1Q40B 3FF0A 3K9MC 4WHAA 1YJW3 2CFKA 1SIIA 1UI7A 3EF8A 1K9M4 1OGXA 3NV0B 1SJWA 5AI1A 1JB4A 2P09A 3OXAA 2B1XB 1NJI4 4HM4B 3PYJA 1QALA 4WYKA 3SXXA 5IG5A 4L8OA 3FKAA 1WMPA 1VQ43 1Q814 4EV2A 3WMDA 1QAKA 1IV9A 2P38A 4XBYA 3B7CA 1M9GA 3JUMA 3CCS3 3EHCA 2RCDA 4R9LA 4X2OA 4BTXA 4KVHA 4IPBA 1WMOA 1L5GB 3G713 2ZL8A 2C11A 5IG3A 2CHCA 1J2BA 3LYGA 3CNXA 5LC6A 3K0ZA 1ZX2A 3SX1A 3F8HA 2BT3A 3JUPA 1QJGA 3FG3A 4WFOA 3V92A 1FGTA 2L4VA 3F8XA 2YFJB 1NO3A 3OWSA 2W2CA 3DXOA 3NV0A 1W6GA 3NM2A 2W9QA 2FNQA 3H51A 3V99A 3I553 2UX0A 4R4KA 3D9RA 1VQL3 3D3LA 4G1MB 1IVWA 2CIUA 3M8CA 1N5HA 4J8TA 3N54B 3GAXA 3QK9A 1IVXA 4FR9A 4ZM8A 3A76A 3OX9A 2CH9A 3JUQA 4FMAA 3WA2X 5FGOA 5AEUB 1A67A 1OF5A 3ER7A 4CCVA 1NWWA 1CYUA 1FGOA 1VQ63 1G96A 2Y74A 1STDA 2PZVA 2Z76A 4OVMA 2MF7A 1DVDA 3DGLA 3TDGA 4X2HA 2GBXB 2E2UA 2D1WA 1FA3A 2XF3A 5JPPA 5IERA 3F14A 4FCZA 1E3RA 2QIYA 4KFDA 1A2KA 3X42A 1NB5I 2CW9A 1OACA 3UL5A 1GY7A 2K0MA 1ULIB 3LZAA 1GD3A 4H3UA 4HM2B 3T0UA 3CC23 2GBWB 5AEWB 1W5ZA 4IT7A 4XDVA 2WGQA 2RSXA 3S28A 1OH0A 3DY5A 1IV7A 5IENA 2STDA 3GRDA 4N6LA 4HZBB 4FMDA 1RRLA 1QAFA 3BB9A 2JDIH 1STFI 2BHMA 1PFPA 1QMAA 5EQLA 1ISKA 4KZ1A 3F40A 2Y73A 1ASKA 3F7SA 1YJ93 2P0MA 5IG4A 1Q864 3MG2A 5IG0A 1JB5A 1W01A 5KP4A 3NX0A 2QA43 4WP5A 1US1A 4MMZB 4NREA 4ORLA 3T8UA 2OTJ3 3DMCA 1W00A 1K734 1O7HB 4WYKB 3FSDA 3Q2PA 3N8BA 1AR0A 2RFRA 5EEOA 5AYSC 4HKVB 1TUHA 3OW22 4MMXB 2B24B 4HM3B 1EG9B 1CYVA 3KN4A 4BTYA 2CC3A 1OHOA 1Q7Y4 3I0YA 2IUJA 4R1KA 1U5OA 1AVKA 3KSED 2C10A 3SOYA 1WTHA 3CME3 3QRDA 3HIIA 4N6UA 5HGRA 1VQ73 2XFTA 5D81A 3GZBA 3U97A 3X3YA 3RGRA 3CD63 2YFLB 3RDEA 4OK0A 4U13A 3PCRA 1IDPA 3CXC2 3EB8A 3H3HA 3EQQB 4WWUC 3VSYA 7STDA 3OWUA 1SQWA 5LC7A 5G2GA 5EVHA 3K7CA 2OTL3 2QGUA 1GY5A 1JKGA 1VQP3 2HMKB 2GXFA 2YX9A 3WOFB 2SBLA 1RJOA 2W6JH 1OF5B 2I9WA 1VQ53 2Z77A 2CKFB 4HM8B 3S5CA 2WGOA 2Z7AA 3FGYA 1WQLB 4EC6A 2M7OA 1LVNA 1HKXA 1VZZA 2HMLB 3DGOA 4AEQA 1S5AA 1TU5A 3PXMA 1M904 1CEWI 1TFOA 1U8CB 1AV4A 3FG1A 3K5TA 3Q90A 3ECFA 4FMBA 3GZYB 4AKZA 3DUKA 3SVAA 3MPHA 1C7HA 1O7MB 5D82A 3VF1A 3WODG 4XDWA 4EV5A 2WO0A 3B4OA 3GZRA 1D6ZA 5CXOA 1IK3A 3LH4A 3JUNA 2OQEC 3BNCA 3DGNA 1YGEA 1N8QA 1W2B2 2XSHB 2OQEA 1O7NB 1UUWB 5KP3A 1KWIA 2W56B 1SPUA 4PEJA 2YFIB 5CF2A 5AIIA 1OGZA 4HM1B 4MEIA 1AVLA 1UUVB 3LTBA 2CWUA 4HM6B 4L8PA 5A0OB 3PS8A 4RBNA 3X3XA 2W0QA 3CCE3 1FGMA 2ZDJA 3BNDA 4XM4A 2D42A 1KC84 2OCTA 4HM7B 4FCJA 3X40A 4EBGA 2BMOB 2FGTA 4N3VA 1O7WB 2KXGA 2XFSA 3WA3A 1VQK3 4O2HA 4L7KA 1LOXA 1Q42A 3LOYA 4HYZA 4XB5A 5I97A 4HZ9B 1Q824 5IW9A 1N9EA 4GL6A 4STDA 1IVVA 2BNGA 4O3VA 3ROBA 1WMNA 1TIJA 1VQM3 3NXJA 3G6E3 3CCU3 1SIHA 1YI23 1FGRA 1O7GB 3EE1A 1E3VA 2W56A 3NUVA 1E97A 4GB5A 5ELJA 5IF6A 1O7PB 3IJEB 1W4NA 2JQ5A 1DMMA 1FUWA 2CFDA 4CDLA 1LXEA 3G8ZA 2HMJB 1DYUA 2V1LA 3S67A 3EC9A 3EJVA 3G16A 2GEYA 1VQN3 2CG0A 4IIAA 4XBXA 3LMLA 3MG3A 5JBSA 1IT8A 3LTDA 4AKYA 1A90A 3N9HA 2O9UX 3K63A 3KE7A 2GEXA 3FH1A 3EBTA 4HVNA 1DVCA 3EN1B 5CK6A 1A2VA 1OHPA 2CWVA 1DMQA 4EXRA 1NB3I 1JKGB 3BNBA 1IQ8A 3NQYA 4QWTA 3STDA 5ELUA 3BNEA 2HMNB 4N6MA 5CLKA 3BLZA 2XSOB 3F9SA 3VGNA 4TX4A 1CQSA 5BVBA 2A15A 3KKGA 1YIJ3 4R80A 1W6YA 3CCQ3 3MYTA 3UNLA 2XR8B 3NM7A 4HJLB 5IEPA 3F7XA 2LYXA 5JPUA 2OWPA 3AMOB 4HBRA 1EQKA 1VQ83 1IVUA 1TFKA 1PU4A 2BMQB 3KIIA 3G4S3 2ML5A 4JRFA 3I563 1OUNA 1GS3A 1W7CA 1K28A 3CPOA 5IEOA 2IUKA 3CC73 4FMCA 4KFFA 3CCV3 4EYCA 1GYBA 2XH9A 1M1K4 3MWZA 4RNYA 2IA7A 2E2TA 1N8R4 2P05A 2IMJA 3CCR3 1YJN3 4LZIA 3SEDA 1R4CA 1IU7A 3MKIA 1N5PA 1N9JA 3LTCA 5AYRB 1KQS2 8CHOA 1V74A 1IQYA 3G0KA 3EBYA 4RNZA 3WDGB 3AMOA 3CPW2 4O8SA 3RGAA 5CF1A 5TGNA 1JN5B 5FW5A 2WOFA 3L0RA 3PZWA 2OOVC 4MMYB 3U1WA 4LGQA 2PNCA 3S29A 3B4PA 1UW1A 2OOVA 1Y4KA 1Q40A 2QEX3 3JVCA 3NHXA 1YVBI 3CCM3 4BTWA 2RGQA 2WOHA 2HMMB 2XEPA 1GD4A 1F8NA 2F98A 2W04A 5KP1A 1YIT3 1MOLA 3PGBA 3OV4A 3Q1CA 2W9PA 1K41A 3LXUX 3GZXB 5D83A 5BXQA 4K1UA 3KFQC 3FF2A 4Q53A 1W6CA 3X41A 1DMNA 2XGNA 2MC8A 5AIFA 1EA2A 3UL6A 1JB2A 4K90B 1UI8A 4XBTA 1JV2B 1JN5A 3SLUA 3NQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZM A;  4HM0 B;  6STD A;  1ZO2 A;  3KZT A;  1BUQ A;  2K54 A;  1OCV A;  4MJD A;  1OHS A;  1OPY A;  3JUO A;  1NDO B;  1ULJ B;  4HM5 B;  3MSO A;  5AIH A;  3KSP A;  5DRV A;  1W02 A;  2HMO B;  3SOA A;  3DZL A;  4OUQ A;  4R9K A;  3IPT A;  3OWY A;  2R4I A;  4LEH A;  4J9A A;  3DM8 A;  2F86 B;  3NBR A;  4K1V A;  2INX A;  5DRE A;  4FCM A;  1NU3 A;  2F99 A;  3T8N A;  3FLJ A;  3FZW A;  2XRX B;  3UJM A;  3MHE A;  4LMI A;  3HZP A;  4I4K A;  3EX9 A;  3CU3 A;  1TP6 A;  2BMR B;  3HX8 A;  3EN8 A;  3GWR A;  5STD A;  3B8L A;  3CNM A;  1GY6 A;  3HK4 A;  5AIG A;  3E99 A;  1Z1S A;  1Q40 B;  3FF0 A;  3EF8 A;  1OGX A;  3NV0 B;  1SJW A;  5AI1 A;  1JB4 A;  3OXA A;  2B1X B;  4HM4 B;  5IG5 A;  4WYK A;  4L8O A;  3FKA A;  3WMD A;  4XBY A;  3B7C A;  3JUM A;  3EHC A;  2RCD A;  4R9L A;  4X2O A;  4KVH A;  5IG3 A;  2CHC A;  3LYG A;  3CNX A;  3K0Z A;  1ZX2 A;  3F8H A;  3JUP A;  1QJG A;  3F8X A;  2YFJ B;  3OWS A;  2W2C A;  3DXO A;  3NV0 A;  3NM2 A;  3H51 A;  2UX0 A;  3D9R A;  3M8C A;  4J8T A;  3A76 A;  3OX9 A;  5AEU B;  3JUQ A;  1OF5 A;  3ER7 A;  1NWW A;  1STD A;  2PZV A;  2Z76 A;  4OVM A;  4X2H A;  2GBX B;  5JPP A;  5IER A;  3F14 A;  1E3R A;  2QIY A;  1A2K A;  1GY7 A;  1ULI B;  3LZA A;  4H3U A;  4HM2 B;  2GBW B;  5AEW B;  4XDV A;  1OH0 A;  5IEN A;  2STD A;  3GRD A;  4HZB B;  3BB9 A;  1QMA A;  1ISK A;  3F40 A;  1ASK A;  3F7S A;  5IG4 A;  3MG2 A;  5IG0 A;  1JB5 A;  1W01 A;  5KP4 A;  4WP5 A;  4ORL A;  3T8U A;  3DMC A;  1W00 A;  1O7H B;  4WYK B;  3FSD A;  1JN5 A;  1AR0 A;  2RFR A;  4HKV B;  1TUH A;  2B24 B;  4HM3 B;  1EG9 B;  1OHO A;  3I0Y A;  4R1K A;  1U5O A;  3SOY A;  5HGR A;  5D81 A;  3GZB A;  3RGR A;  2YFL B;  4U13 A;  1IDP A;  3H3H A;  3EQQ B;  4WWU C;  3VSY A;  7STD A;  3OWU A;  5G2G A;  5EVH A;  3K7C A;  2QGU A;  1GY5 A;  1JKG A;  2HMK B;  2GXF A;  1OF5 B;  2I9W A;  2Z77 A;  2CKF B;  4HM8 B;  3S5C A;  2Z7A A;  3FGY A;  1WQL B;  1HKX A;  1VZZ A;  2HML B;  1S5A A;  3Q90 A;  3ECF A;  3GZY B;  3DUK A;  1C7H A;  1O7M B;  5D82 A;  4XDW A;  3B4O A;  3GZR A;  5CXO A;  3JUN A;  2XSH B;  1O7N B;  1UUW B;  5KP3 A;  4PEJ A;  2YFI B;  5CF2 A;  5AII A;  1OGZ A;  4HM1 B;  1UUV B;  4HM6 B;  4L8P A;  4XM4 A;  4HM7 B;  4FCJ A;  2BMO B;  4N3V A;  1O7W B;  4L7K A;  1Q42 A;  4XB5 A;  4HZ9 B;  4STD A;  2BNG A;  3ROB A;  3NXJ A;  1O7G B;  1E3V A;  3NUV A;  1E97 A;  4GB5 A;  5IF6 A;  1O7P B;  2JQ5 A;  1DMM A;  4CDL A;  3G8Z A;  2HMJ B;  3EC9 A;  3EJV A;  3G16 A;  2GEY A;  4IIA A;  4XBX A;  3MG3 A;  3KE7 A;  2GEX A;  3FH1 A;  3EBT A;  4HVN A;  3EN1 B;  5CK6 A;  1OHP A;  1DMQ A;  1JKG B;  3STD A;  2HMN B;  5CLK A;  3BLZ A;  2XSO B;  3F9S A;  3VGN A;  1CQS A;  5BVB A;  2A15 A;  3KKG A;  1W6Y A;  3MYT A;  3UNL A;  2XR8 B;  4HJL B;  5IEP A;  3F7X A;  5JPU A;  2OWP A;  2BMQ B;  1OUN A;  1GS3 A;  3CPO A;  5IEO A;  1GYB A;  2IMJ A;  3SED A;  3MKI A;  8CHO A;  3G0K A;  3EBY A;  3RGA A;  5CF1 A;  5TGN A;  1JN5 B;  5FW5 A;  4LGQ A;  3B4P A;  1Q40 A;  3NHX A;  2RGQ A;  2HMM B;  2F98 A;  5KP1 A;  3OV4 A;  1K41 A;  3GZX B;  5D83 A;  5BXQ A;  4K1U A;  3FF2 A;  4Q53 A;  1DMN A;  5AIF A;  1EA2 A;  1JB2 A;  4XBT A;  3MG1 A; 
#chains in the Genus database with same CATH topology
 2CG1 A;  2CFG A;  2ML6 A;  4N6V 0;  4RZM A;  2P0X A;  3J7Y d;  1JNQ A;  1YHQ 3;  1ROV A;  3D4A A;  2CX1 A;  4HM0 B;  1W2Z A;  4H61 A;  6STD A;  1ZO2 A;  1HU9 A;  3PCS A;  3KZT A;  2E2V A;  3ZG5 A;  1BUQ A;  4CJN A;  2K54 A;  1OCV A;  4N6N B;  1K8A 4;  4MJD A;  1OHS A;  1OPY A;  2KF6 A;  3S27 A;  1RRH A;  1D6Y A;  1EKM A;  2GU1 A;  4ILF A;  3CCL 3;  3JUO A;  1B2Z A;  1NDO B;  1ULJ B;  2CFL A;  3AHW A;  3MSO A;  4HAA A;  1B21 A;  4HM5 B;  5AIH A;  2F56 A;  3HIG A;  3NBB A;  3KSP A;  4O02 B;  2Z6B A;  5DRV A;  1KSI A;  1LOY A;  1RDS A;  1IT7 A;  2KCD A;  1W02 A;  2CK3 H;  1AQZ A;  3CMA 3;  2HMO B;  3SOA A;  1JBR A;  4N6T A;  3DZL A;  4OUQ A;  4R9K A;  3IPT A;  3V98 A;  2CFW A;  4RNT A;  3OWY A;  1RGH A;  2R4I A;  1I3I A;  2CWT A;  4LEH A;  3WOE B;  4J9A A;  1JRQ A;  1ROA A;  3DM8 A;  1LOW A;  2F86 B;  1RGF A;  3NBR A;  3UB1 A;  3ALA A;  1GOV A;  3FCS B;  2UUG C;  5G1K A;  8RNT A;  4K1V A;  2INX A;  1BSB A;  4N6O B;  5DRE A;  2XGL A;  3LTA A;  4FCM A;  3O8Y A;  3LT9 A;  2KRT A;  1NU3 A;  2F99 A;  3T8N A;  3MG1 A;  4LSO A;  1Q9E A;  1BSC A;  1BRJ A;  3FLJ A;  1A90 A;  3FZW A;  1D6U A;  1RN7 A;  1KD1 4;  1GMP A;  1LQG C;  1LNH A;  1MNL A;  2Q07 A;  1UGI A;  5GSP A;  1BRH A;  2XRX B;  3UJM A;  2CX0 A;  4JF8 A;  1VQO 3;  1BIR A;  1VQ9 3;  1M1X B;  2BO9 B;  3MHE A;  2FXT A;  1TRQ A;  1BNR A;  1BNG A;  3A5E A;  2O3O A;  4LMI A;  1BSA A;  2GU3 A;  3HZP A;  3X3Z A;  4I4K A;  3EX9 A;  3CU3 A;  3CC4 3;  1FZU A;  2BMR B;  1TP6 A;  1QVG 2;  3CCJ 3;  1FYS A;  1SAR A;  3FG4 A;  3EN8 A;  1HZ1 A;  3HX8 A;  3GWR A;  3IMA B;  3KCH A;  3LT8 A;  1IQX A;  1WNH A;  4KFE A;  3NBJ A;  5STD A;  1S72 3;  1X1X A;  3HI7 A;  2IY2 A;  2AAE A;  3B8L A;  4K61 A;  1T2I A;  1FGQ A;  1RKY A;  1QVF 2;  3CNM A;  1GY6 A;  2LQV A;  3HK4 A;  3D5I A;  3DGM A;  1JBS A;  1T5Y A;  4NHF A;  3E99 A;  2W03 A;  1RLS A;  5AIG A;  1Z1S A;  1Q40 B;  3FF0 A;  3K9M C;  4WHA A;  1YJW 3;  2CFK A;  1SII A;  1BRK A;  1UI7 A;  3EF8 A;  1K9M 4;  1OGX A;  1B3S A;  1SJW A;  3NV0 B;  1JB4 A;  5AI1 A;  2P09 A;  3OXA A;  2B1X B;  7GSP A;  1NJI 4;  4HM4 B;  1RN1 A;  3PYJ A;  1QAL A;  4WYK A;  5M1A A;  3SXX A;  4L8O A;  3FKA A;  1WMP A;  5IG5 A;  1Q81 4;  1VQ4 3;  4EV2 A;  1DE3 A;  3WMD A;  1QAK A;  1BNJ A;  1IV9 A;  1I2F A;  1PY3 A;  1B2U A;  2P38 A;  4XBY A;  3B7C A;  1M9G A;  3JUM A;  3CCS 3;  3EHC A;  2RCD A;  4R9L A;  1GOY A;  4X2O A;  4BTX A;  7RNT A;  4KVH A;  4IPB A;  1I0X A;  1WMO A;  1L5G B;  3HOH A;  3G71 3;  2ZL8 A;  2C11 A;  5IG3 A;  1I8V A;  2CHC A;  1J2B A;  1BAN A;  3LYG A;  3CNX A;  5LC6 A;  3K0Z A;  1I2E A;  1ZX2 A;  3SX1 A;  5M19 A;  3F8H A;  2BT3 A;  2H0I A;  3JUP A;  1QJG A;  1EEJ A;  3FG3 A;  4WFO A;  3V92 A;  1FGT A;  1LNI A;  2L4V A;  3F8X A;  1LOV A;  1G0T A;  1NO3 A;  2YFJ B;  3OWS A;  2W2C A;  1FUS A;  3AGN A;  1W6G A;  3DXO A;  2W9Q A;  3NM2 A;  1LQM B;  2FNQ A;  3NV0 A;  3H51 A;  3V99 A;  3I55 3;  2J8X B;  2UX0 A;  4R4K A;  3D9R A;  1VQL 3;  3D3L A;  4G1M B;  1IVW A;  1Q7H A;  2CIU A;  1JZD A;  3M8C A;  1N5H A;  1RCK A;  4J8T A;  3N54 B;  3GAX A;  3QK9 A;  1IVX A;  4FR9 A;  4ZM8 A;  4BU4 A;  3A76 A;  3OX9 A;  2CH9 A;  3JUQ A;  4FMA A;  3WA2 X;  5FGO A;  1RNT A;  1RTU A;  1MGR A;  2KF3 A;  1OF5 A;  3ER7 A;  4CCV A;  1NWW A;  1CYU A;  1BNS A;  1FGO A;  1ZS7 A;  1VQ6 3;  1G96 A;  2Y74 A;  1STD A;  2PZV A;  2Z76 A;  4OVM A;  2MF7 A;  1DVD A;  3DGL A;  3TDG A;  2BU4 A;  4X2H A;  2GBX B;  2E2U A;  1RCL A;  2D1W A;  1FA3 A;  2XF3 A;  2KF4 A;  3AHS A;  5JPP A;  5IER A;  2HOH A;  3F14 A;  4FCZ A;  1E3R A;  2QIY A;  4KFD A;  1A2K A;  1B27 A;  3X42 A;  1NB5 I;  2CW9 A;  1OAC A;  1JJ2 2;  3UL5 A;  1GY7 A;  2K0M A;  1ULI B;  3LZA A;  1DET A;  1GD3 A;  4H3U A;  4HM2 B;  3T0U A;  3CC2 3;  1JBT A;  2GBW B;  3Q3F A;  5AEW B;  1BNI A;  1W5Z A;  1A2P A;  4IT7 A;  4XDV A;  2WGQ A;  2RSX A;  3S28 A;  9RNT A;  1OH0 A;  3DY5 A;  1IV7 A;  1BVI A;  2R41 A;  5IEN A;  2SAR A;  5G1L A;  2STD A;  3GRD A;  4N6L A;  4HZB B;  4FMD A;  5RNT A;  1RRL A;  1QAF A;  3BB9 A;  2JDI H;  1STF I;  1V57 A;  2BHM A;  1PFP A;  1QMA A;  4J5K A;  5EQL A;  4KZ1 A;  1ISK A;  3F40 A;  2Y73 A;  1ASK A;  1JZO A;  2C4B A;  3F7S A;  1YJ9 3;  1MWS A;  1YVS A;  2P0M A;  5IG4 A;  1Q86 4;  1RGA A;  3MG2 A;  5IG0 A;  1JB5 A;  1W01 A;  3GSP A;  5KP4 A;  3NX0 A;  2QA4 3;  4WP5 A;  2AAD A;  4LYL B;  1US1 A;  4MMZ B;  4NRE A;  4ORL A;  3T8U A;  3ZG0 A;  1TTO A;  2OTJ 3;  3DMC A;  1W00 A;  1K73 4;  1O7H B;  4WYK B;  3FSD A;  3Q2P A;  3N8B A;  2KAA A;  1AR0 A;  2RFR A;  5EEO A;  1MGW A;  1BU4 A;  1RMS A;  5AYS C;  4HKV B;  1TUH A;  3OW2 2;  4MMX B;  2B24 B;  4HM3 B;  1EG9 B;  1X1Y A;  1R4Y A;  1CYV A;  3KN4 A;  4BTY A;  2CC3 A;  3RNT A;  1OHO A;  1BUJ A;  1Q7Y 4;  3I0Y A;  2IUJ A;  4R1K A;  1U5O A;  1AVK A;  3KSE D;  2C10 A;  3SOY A;  1WTH A;  3CME 3;  3QRD A;  1UGH I;  3HII A;  1X1U A;  4N6U A;  1BGS A;  2XFT A;  5HGR A;  1VQ7 3;  5D81 A;  3GZB A;  3U97 A;  3X3Y A;  2IYJ A;  3RGR A;  3CD6 3;  2YFL B;  3RDE A;  4OK0 A;  1GMR A;  4U13 A;  1RSN A;  4BL2 A;  1BSE A;  3PCR A;  1IDP A;  3CXC 2;  3EB8 A;  3H3H A;  1X1W A;  3EQQ B;  4WWU C;  1BNF A;  3VSY A;  7STD A;  2BIR A;  3OWU A;  1SQW A;  5LC7 A;  5G2G A;  5EVH A;  3K7C A;  2OTL 3;  2QGU A;  1GY5 A;  1JKG A;  1VQP 3;  2HMK B;  2GXF A;  1T3B A;  2YX9 A;  3WOF B;  2SBL A;  1RJO A;  2W6J H;  1OF5 B;  2I9W A;  1VQ5 3;  4NPB A;  4GHO A;  2Z77 A;  2CKF B;  4HM8 B;  3S5C A;  4BIR A;  2WGO A;  2Z7A A;  3FGY A;  1WQL B;  4EC6 A;  2M7O A;  3WHO A;  5HOH A;  1I0V A;  1LVN A;  1HKX A;  1VZZ A;  2HML B;  2UGI A;  3DGO A;  4AEQ A;  4EW5 A;  1S5A A;  1TU5 A;  3PXM A;  1M90 4;  1UCJ A;  1CEW I;  1TFO A;  1G02 A;  1AV4 A;  1U8C B;  3FG1 A;  3K5T A;  3Q90 A;  2F5M A;  3ECF A;  4FMB A;  3GZY B;  4AKZ A;  3ZFZ A;  3DUK A;  3SVA A;  3MPH A;  1C7H A;  1O7M B;  5D82 A;  3VF1 A;  3WOD G;  1C54 A;  4XDW A;  4EV5 A;  2WO0 A;  3B4O A;  3GZR A;  1D6Z A;  5CXO A;  1IK3 A;  1FW7 A;  3LH4 A;  3BU4 A;  3JUN A;  2OQE C;  1GOU A;  3BNC A;  3DGN A;  1YGE A;  1N8Q A;  1W2B 2;  2XSH B;  2OQE A;  1O7N B;  2GSP A;  1UUW B;  5KP3 A;  1KWI A;  2W56 B;  1SPU A;  4PEJ A;  2YFI B;  5CF2 A;  5AII A;  1OGZ A;  4HM1 B;  4MEI A;  1AVL A;  1UUV B;  3LTB A;  2CWU A;  4HM6 B;  4L8P A;  5A0O B;  3PS8 A;  4RBN A;  1BAO A;  2W0Q A;  3X3X A;  1NNV A;  1T2H A;  1FGM A;  3CCE 3;  1HYF A;  2ZDJ A;  3BND A;  4XM4 A;  2D42 A;  1KC8 4;  2OCT A;  4HM7 B;  4FCJ A;  3X40 A;  4EBG A;  2BMO B;  2FGT A;  4N3V A;  1O7W B;  2KXG A;  2XFS A;  3WA3 A;  1VQK 3;  4O2H A;  1TJD A;  3DGY A;  1EUI C;  4L7K A;  1LOX A;  1Q42 A;  6GSP A;  3LOY A;  4HYZ A;  4XB5 A;  5I97 A;  4HZ9 B;  1Q82 4;  1UCI A;  5IW9 A;  1N9E A;  4GL6 A;  4STD A;  1IVV A;  2BNG A;  4O3V A;  3ROB A;  1WMN A;  1TIJ A;  1VQM 3;  1RGK A;  3NXJ A;  3G6E 3;  3CCU 3;  1SIH A;  1YI2 3;  1FGR A;  1O7G B;  2ZHX B;  2RBI A;  3EE1 A;  1E3V A;  1MWR A;  2W56 A;  3NUV A;  1E97 A;  4GB5 A;  5ELJ A;  5IF6 A;  5BIR A;  1O7P B;  3IJE B;  1W4N A;  2JQ5 A;  1DMM A;  1FUW A;  2CFD A;  4CDL A;  1LXE A;  3G8Z A;  1BRS A;  1BNE A;  2F4Y A;  2HMJ B;  3URP A;  1DYU A;  2V1L A;  3S67 A;  3EC9 A;  3WR2 A;  5BU4 A;  3EJV A;  3G16 A;  2GEY A;  1RHL A;  1VQN 3;  2CG0 A;  1UDI I;  4IIA A;  4XBX A;  1V58 A;  1I2G A;  3LML A;  3MG3 A;  5JBS A;  1IT8 A;  3LTD A;  3BIR A;  4AKY A;  1UCL A;  1VQQ A;  2O9U X;  3K63 A;  3KE7 A;  3N9H A;  2GEX A;  3FH1 A;  3EBT A;  4HVN A;  1DVC A;  3EN1 B;  5CK6 A;  1A2V A;  1OHP A;  1YNV X;  1DMQ A;  1RGE A;  2CWV A;  4EXR A;  1NB3 I;  1JKG B;  1FUT A;  3BNB A;  1IQ8 A;  3NQY A;  4QWT A;  2F5W A;  3STD A;  5ELU A;  3BNE A;  2HMN B;  4N6M A;  5CLK A;  3BLZ A;  2XSO B;  3F9S A;  3VGN A;  4KT3 B;  4TX4 A;  1CQS A;  5BVB A;  2A15 A;  3KKG A;  1B2X A;  4R80 A;  1W6Y A;  2H0G A;  3MYT A;  3CCQ 3;  1YIJ 3;  3UNL A;  2XR8 B;  3NM7 A;  4HJL B;  5IEP A;  1RGC A;  4DKI A;  1RN4 A;  1RGG A;  2L1S A;  3F7X A;  1TRP A;  1BRI A;  2LYX A;  5JPU A;  2OWP A;  3AMO B;  4HBR A;  1EQK A;  1VQ8 3;  1YGW A;  1IVU A;  1TFK A;  6RNT A;  1B20 A;  1CH0 A;  2BMQ B;  3KII A;  1PU4 A;  3G4S 3;  2ML5 A;  1IYY A;  4GSP A;  2KF5 A;  4JRF A;  3I56 3;  1OUN A;  1GS3 A;  1W7C A;  4BL3 A;  1B2M A;  1K28 A;  3CPO A;  5IEO A;  3AGO A;  2IUK A;  3CC7 3;  4FMC A;  1ZGX A;  4KFF A;  1BRG A;  3CCV 3;  4EYC A;  1GYB A;  1UUG B;  2XH9 A;  1M1K 4;  3MWZ A;  1GSP A;  1BRN L;  4RNY A;  2IA7 A;  2E2T A;  2K3D A;  1N8R 4;  2P05 A;  2IMJ A;  2H0H A;  3CCR 3;  4LZI A;  3SED A;  1R4C A;  1IU7 A;  1YJN 3;  3MKI A;  1N5P A;  1N9J A;  3LTC A;  1BSD A;  5AYR B;  3SYU A;  1KQS 2;  8CHO A;  1V74 A;  1IQY A;  1B2S A;  1MWT A;  3EBY A;  3G0K A;  4RNZ A;  3DH2 A;  3WDG B;  1RNB A;  3AMO A;  3CPW 2;  4O8S A;  3RGA A;  5CF1 A;  5TGN A;  1AY7 A;  1JN5 B;  5FW5 A;  1BOX A;  2WOF A;  3L0R A;  2ZA4 A;  3PZW A;  4I5Q A;  2OOV C;  4MMY B;  1PYL A;  3U1W A;  4LGQ A;  2PNC A;  3S29 A;  3B4P A;  1UW1 A;  1LRA A;  4HOH A;  1Y4K A;  3D5G A;  2OOV A;  1I3F A;  1Q40 A;  2QEX 3;  3JVC A;  3NHX A;  1YVB I;  2RNT A;  3CCM 3;  4BTW A;  2RGQ A;  2WOH A;  2HMM B;  2XEP A;  1GD4 A;  1F8N A;  2F98 A;  2W04 A;  5KP1 A;  1YIT 3;  1MOL A;  3PGB A;  3OV4 A;  3Q1C A;  1GMQ A;  1K41 A;  1RGL A;  2W9P A;  3LXU X;  3GZX B;  5D83 A;  3D79 A;  5BXQ A;  4K1U A;  1UCK A;  3KFQ C;  3FF2 A;  1MWU A;  4Q53 A;  1W6C A;  3X41 A;  1DMN A;  1I70 A;  4CPK A;  2XGN A;  2MC8 A;  5AIF A;  5M18 A;  1EA2 A;  3UL6 A;  4J5G A;  1A67 A;  1JB2 A;  4K90 B;  1UI8 A;  4XBT A;  5AEU B;  1JV2 B;  1JN5 A;  3SLU A;  3NQZ A; 
#chains in the Genus database with same CATH homology
 2CG1 A;  2CFG A;  2ML6 A;  4N6V 0;  4RZM A;  2P0X A;  3J7Y d;  1JNQ A;  1YHQ 3;  1ROV A;  4HM0 B;  1W2Z A;  4H61 A;  6STD A;  1ZO2 A;  1HU9 A;  3PCS A;  3KZT A;  2E2V A;  1BUQ A;  2K54 A;  1OCV A;  4N6N B;  1K8A 4;  4MJD A;  1OHS A;  1OPY A;  3S27 A;  1RRH A;  1D6Y A;  1EKM A;  2GU1 A;  3CCL 3;  3JUO A;  1NDO B;  1ULJ B;  2CFL A;  4HM5 B;  3MSO A;  5AIH A;  3HIG A;  3NBB A;  3KSP A;  4O02 B;  2Z6B A;  5DRV A;  1KSI A;  1IT7 A;  2KCD A;  1W02 A;  2CK3 H;  3CMA 3;  2HMO B;  3SOA A;  4N6T A;  3DZL A;  4OUQ A;  4R9K A;  3IPT A;  3V98 A;  2CFW A;  3OWY A;  2R4I A;  2CWT A;  4LEH A;  3WOE B;  4J9A A;  1JRQ A;  1ROA A;  3DM8 A;  2F86 B;  3NBR A;  3UB1 A;  3ALA A;  3FCS B;  4K1V A;  2INX A;  4N6O B;  5DRE A;  2XGL A;  3LTA A;  4FCM A;  3O8Y A;  3LT9 A;  2KRT A;  1NU3 A;  2F99 A;  3T8N A;  3MG1 A;  4LSO A;  3FLJ A;  3FZW A;  1D6U A;  1RN7 A;  1KD1 4;  1LNH A;  1MNL A;  2Q07 A;  2XRX B;  3UJM A;  4JF8 A;  1VQO 3;  1VQ9 3;  1M1X B;  2BO9 B;  3MHE A;  2FXT A;  2O3O A;  4LMI A;  3HZP A;  2GU3 A;  3X3Z A;  4I4K A;  3EX9 A;  3CU3 A;  3CC4 3;  1TP6 A;  2BMR B;  1QVG 2;  3CCJ 3;  3FG4 A;  3HX8 A;  3EN8 A;  3LT8 A;  3GWR A;  3IMA B;  4KFE A;  5STD A;  1IQX A;  1WNH A;  1S72 3;  3NBJ A;  3HI7 A;  4K61 A;  3B8L A;  1FGQ A;  1RKY A;  1QVF 2;  3CNM A;  1GY6 A;  2LQV A;  3HK4 A;  3DGM A;  1JJ2 2;  1T5Y A;  4NHF A;  3E99 A;  2W03 A;  5AIG A;  1Z1S A;  1Q40 B;  3FF0 A;  3K9M C;  4WHA A;  1YJW 3;  2CFK A;  1SII A;  1UI7 A;  3EF8 A;  1K9M 4;  1OGX A;  3NV0 B;  1SJW A;  5AI1 A;  1JB4 A;  2P09 A;  3OXA A;  2B1X B;  1NJI 4;  4HM4 B;  3PYJ A;  1QAL A;  4WYK A;  3SXX A;  5IG5 A;  4L8O A;  3FKA A;  1WMP A;  1VQ4 3;  1Q81 4;  4EV2 A;  3WMD A;  1QAK A;  1IV9 A;  2P38 A;  4XBY A;  3B7C A;  1M9G A;  3JUM A;  3CCS 3;  3EHC A;  2RCD A;  4R9L A;  4X2O A;  4BTX A;  4KVH A;  4IPB A;  1WMO A;  1L5G B;  3G71 3;  2ZL8 A;  2C11 A;  5IG3 A;  2CHC A;  1J2B A;  3LYG A;  3CNX A;  5LC6 A;  3K0Z A;  1ZX2 A;  3SX1 A;  3F8H A;  2BT3 A;  3JUP A;  1QJG A;  3FG3 A;  4WFO A;  3V92 A;  1FGT A;  2L4V A;  3F8X A;  2YFJ B;  1NO3 A;  3OWS A;  2W2C A;  3DXO A;  3NV0 A;  1W6G A;  3NM2 A;  2W9Q A;  2FNQ A;  3H51 A;  3V99 A;  3I55 3;  2UX0 A;  4R4K A;  3D9R A;  1VQL 3;  3D3L A;  4G1M B;  1IVW A;  2CIU A;  3M8C A;  1N5H A;  4J8T A;  3N54 B;  3GAX A;  3QK9 A;  1IVX A;  4FR9 A;  4ZM8 A;  3A76 A;  3OX9 A;  2CH9 A;  3JUQ A;  4FMA A;  3WA2 X;  5FGO A;  5AEU B;  1A67 A;  1OF5 A;  3ER7 A;  4CCV A;  1NWW A;  1CYU A;  1FGO A;  1VQ6 3;  1G96 A;  2Y74 A;  1STD A;  2PZV A;  2Z76 A;  4OVM A;  2MF7 A;  1DVD A;  3DGL A;  3TDG A;  4X2H A;  2GBX B;  2E2U A;  2D1W A;  1FA3 A;  2XF3 A;  5JPP A;  5IER A;  3F14 A;  4FCZ A;  1E3R A;  2QIY A;  4KFD A;  1A2K A;  3X42 A;  1NB5 I;  2CW9 A;  1OAC A;  3UL5 A;  1GY7 A;  2K0M A;  1ULI B;  3LZA A;  1GD3 A;  4H3U A;  4HM2 B;  3T0U A;  3CC2 3;  2GBW B;  5AEW B;  1W5Z A;  4IT7 A;  4XDV A;  2WGQ A;  2RSX A;  3S28 A;  1OH0 A;  3DY5 A;  1IV7 A;  5IEN A;  2STD A;  3GRD A;  4N6L A;  4HZB B;  4FMD A;  1RRL A;  1QAF A;  3BB9 A;  2JDI H;  1STF I;  2BHM A;  1PFP A;  1QMA A;  5EQL A;  1ISK A;  4KZ1 A;  3F40 A;  2Y73 A;  1ASK A;  3F7S A;  1YJ9 3;  2P0M A;  5IG4 A;  1Q86 4;  3MG2 A;  5IG0 A;  1JB5 A;  1W01 A;  5KP4 A;  3NX0 A;  2QA4 3;  4WP5 A;  1US1 A;  4MMZ B;  4NRE A;  4ORL A;  3T8U A;  2OTJ 3;  3DMC A;  1W00 A;  1K73 4;  1O7H B;  4WYK B;  3FSD A;  3Q2P A;  3N8B A;  1AR0 A;  2RFR A;  5EEO A;  5AYS C;  4HKV B;  1TUH A;  3OW2 2;  4MMX B;  2B24 B;  4HM3 B;  1EG9 B;  1CYV A;  3KN4 A;  4BTY A;  2CC3 A;  1OHO A;  1Q7Y 4;  3I0Y A;  2IUJ A;  4R1K A;  1U5O A;  1AVK A;  3KSE D;  2C10 A;  3SOY A;  1WTH A;  3CME 3;  3QRD A;  3HII A;  4N6U A;  5HGR A;  1VQ7 3;  2XFT A;  5D81 A;  3GZB A;  3U97 A;  3X3Y A;  3RGR A;  3CD6 3;  2YFL B;  3RDE A;  4OK0 A;  4U13 A;  3PCR A;  1IDP A;  3CXC 2;  3EB8 A;  3H3H A;  3EQQ B;  4WWU C;  3VSY A;  7STD A;  3OWU A;  1SQW A;  5LC7 A;  5G2G A;  5EVH A;  3K7C A;  2OTL 3;  2QGU A;  1GY5 A;  1JKG A;  1VQP 3;  2HMK B;  2GXF A;  2YX9 A;  3WOF B;  2SBL A;  1RJO A;  2W6J H;  1OF5 B;  2I9W A;  1VQ5 3;  2Z77 A;  2CKF B;  4HM8 B;  3S5C A;  2WGO A;  2Z7A A;  3FGY A;  1WQL B;  4EC6 A;  2M7O A;  1LVN A;  1HKX A;  1VZZ A;  2HML B;  3DGO A;  4AEQ A;  1S5A A;  1TU5 A;  3PXM A;  1M90 4;  1CEW I;  1TFO A;  1U8C B;  1AV4 A;  3FG1 A;  3K5T A;  3Q90 A;  3ECF A;  4FMB A;  3GZY B;  4AKZ A;  3DUK A;  3SVA A;  3MPH A;  1C7H A;  1O7M B;  5D82 A;  3VF1 A;  3WOD G;  4XDW A;  4EV5 A;  2WO0 A;  3B4O A;  3GZR A;  1D6Z A;  5CXO A;  1IK3 A;  3LH4 A;  3JUN A;  2OQE C;  3BNC A;  3DGN A;  1YGE A;  1N8Q A;  1W2B 2;  2XSH B;  2OQE A;  1O7N B;  1UUW B;  5KP3 A;  1KWI A;  2W56 B;  1SPU A;  4PEJ A;  2YFI B;  5CF2 A;  5AII A;  1OGZ A;  4HM1 B;  4MEI A;  1AVL A;  1UUV B;  3LTB A;  2CWU A;  4HM6 B;  4L8P A;  5A0O B;  3PS8 A;  4RBN A;  3X3X A;  2W0Q A;  3CCE 3;  1FGM A;  2ZDJ A;  3BND A;  4XM4 A;  2D42 A;  1KC8 4;  2OCT A;  4HM7 B;  4FCJ A;  3X40 A;  4EBG A;  2BMO B;  2FGT A;  4N3V A;  1O7W B;  2KXG A;  2XFS A;  3WA3 A;  1VQK 3;  4O2H A;  4L7K A;  1LOX A;  1Q42 A;  3LOY A;  4HYZ A;  4XB5 A;  5I97 A;  4HZ9 B;  1Q82 4;  5IW9 A;  1N9E A;  4GL6 A;  4STD A;  1IVV A;  2BNG A;  4O3V A;  3ROB A;  1WMN A;  1TIJ A;  1VQM 3;  3NXJ A;  3G6E 3;  3CCU 3;  1SIH A;  1YI2 3;  1FGR A;  1O7G B;  3EE1 A;  1E3V A;  2W56 A;  3NUV A;  1E97 A;  4GB5 A;  5ELJ A;  5IF6 A;  1O7P B;  3IJE B;  1W4N A;  2JQ5 A;  1DMM A;  1FUW A;  2CFD A;  4CDL A;  1LXE A;  3G8Z A;  2HMJ B;  1DYU A;  2V1L A;  3S67 A;  3EC9 A;  3EJV A;  3G16 A;  2GEY A;  1VQN 3;  2CG0 A;  4IIA A;  4XBX A;  3LML A;  3MG3 A;  5JBS A;  1IT8 A;  3LTD A;  4AKY A;  1A90 A;  3N9H A;  2O9U X;  3K63 A;  3KE7 A;  2GEX A;  3FH1 A;  3EBT A;  4HVN A;  1DVC A;  3EN1 B;  5CK6 A;  1A2V A;  1OHP A;  2CWV A;  1DMQ A;  4EXR A;  1NB3 I;  1JKG B;  3BNB A;  1IQ8 A;  3NQY A;  4QWT A;  3STD A;  5ELU A;  3BNE A;  2HMN B;  4N6M A;  5CLK A;  3BLZ A;  2XSO B;  3F9S A;  3VGN A;  4TX4 A;  1CQS A;  5BVB A;  2A15 A;  3KKG A;  1YIJ 3;  4R80 A;  1W6Y A;  3CCQ 3;  3MYT A;  3UNL A;  2XR8 B;  3NM7 A;  4HJL B;  5IEP A;  3F7X A;  2LYX A;  5JPU A;  2OWP A;  3AMO B;  4HBR A;  1EQK A;  1VQ8 3;  1IVU A;  1TFK A;  1PU4 A;  2BMQ B;  3KII A;  3G4S 3;  2ML5 A;  4JRF A;  3I56 3;  1OUN A;  1GS3 A;  1W7C A;  1K28 A;  3CPO A;  5IEO A;  2IUK A;  3CC7 3;  4FMC A;  4KFF A;  3CCV 3;  4EYC A;  1GYB A;  2XH9 A;  1M1K 4;  3MWZ A;  4RNY A;  2IA7 A;  2E2T A;  1N8R 4;  2P05 A;  2IMJ A;  3CCR 3;  1YJN 3;  4LZI A;  3SED A;  1R4C A;  1IU7 A;  3MKI A;  1N5P A;  1N9J A;  3LTC A;  5AYR B;  1KQS 2;  8CHO A;  1V74 A;  1IQY A;  3G0K A;  3EBY A;  4RNZ A;  3WDG B;  3AMO A;  3CPW 2;  4O8S A;  3RGA A;  5CF1 A;  5TGN A;  1JN5 B;  5FW5 A;  2WOF A;  3L0R A;  3PZW A;  2OOV C;  4MMY B;  3U1W A;  4LGQ A;  2PNC A;  3S29 A;  3B4P A;  1UW1 A;  2OOV A;  1Y4K A;  1Q40 A;  2QEX 3;  3JVC A;  3NHX A;  1YVB I;  3CCM 3;  4BTW A;  2RGQ A;  2WOH A;  2HMM B;  2XEP A;  1GD4 A;  1F8N A;  2F98 A;  2W04 A;  5KP1 A;  1YIT 3;  1MOL A;  3PGB A;  3OV4 A;  3Q1C A;  2W9P A;  1K41 A;  3LXU X;  3GZX B;  5D83 A;  5BXQ A;  4K1U A;  3KFQ C;  3FF2 A;  4Q53 A;  1W6C A;  3X41 A;  1DMN A;  2XGN A;  2MC8 A;  5AIF A;  1EA2 A;  3UL6 A;  1JB2 A;  4K90 B;  1UI8 A;  4XBT A;  1JV2 B;  1JN5 A;  3SLU A;  3NQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...