3GZBA

Crystal structure of putative snoal-like polyketide cyclase (yp_001182657.1) from shewanella putrefaciens cn-32 at 1.44 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
154
structure length
154
Chain Sequence
b'GMFASLVIPVSAQANSGEMPQEQQLAVKYMDALTEHDYKTLITFYNRDSIFFDKTANRKYTGGRFIIDFLERAHQGVLEYDFNIEHMYNAGSLVVMIGNYHFKGPGEQFGKPGKIIDVAIPAVTSLKLDMLNRRVTEHVDLIDYQTMSDQLAMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative SnoaL-like polyketide cyclase
publication title Crystal structure of putative SnoaL-like polyketide cyclase (YP_001182657.1) from Shewanella putrefaciens CN-32 at 1.44 A resolution
rcsb
source organism Shewanella putrefaciens
molecule tags Lyase
total genus 42
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3gzbA00
1E97A 1ZO2A 1E3RA 1W01A 2BMQB 1OF5A 3EN1B 3UJMA 3JUOA 4X2HA 1CQSA 1O7MB 3F9SA 1TUHA 2YFLB 1JN5B 4RZMA 1K41A 5IENA 1OHSA 1OF5B 1EG9B 4I4KA 3G0KA 2GBXB 2OWPA 2QIYA 1JB2A 3S5CA 3H3HA 5D83A 4HM4B 4HM3B 2XRXB 5CK6A 4XM4A 3T8NA 3D9RA 3FF2A 4GB5A 4XDWA 3LYGA 3MYTA 2XSHB 2Z7AA 3MG3A 4LEHA 3FGYA 5IERA 2PZVA 4HM1B 3GWRA 2IMJA 4K1VA 4X2OA 4CDLA 3DMCA 4FCJA 3DZLA 5D81A 5KP1A 3EX9A 2F86B 4L8OA 1QMAA 5JPPA 1W00A 2R4IA 5CLKA 4J8TA 4OVMA 4XBTA 3HX8A 5IG3A 1S5AA 2BMOB 1Z1SA 1NWWA 5HGRA 4OUQA 3JUPA 4HZBB 3ROBA 1BUQA 2B1XB 2UX0A 3FSDA 3F14A 2HMMB 3JUNA 3KE7A 4HM7B 4HVNA 2GEXA 4LMIA 3OXAA 4WP5A 3MKIA 1UUVB 3BLZA 2I9WA 2BNGA 5IF6A 1O7HB 3GZBA 3EC9A 5AIGA 5AEUB 2QGUA 2BMRB 3UNLA 2RGQA 3G8ZA 1DMNA 3OWUA 4U13A 5AI1A 4Q53A 3B8LA 4IIAA 1E3VA 4HM5B 1GY6A 5AIFA 3EQQB 2XR8B 2RCDA 3EHCA 3I0YA 5IG4A 5CF2A 3NBRA 1JB5A 5BXQA 5IEPA 3VSYA 1OUNA 5JPUA 5KP4A 1A2KA 2F99A 3BB9A 7STDA 4N3VA 2A15A 1WQLB 3CNXA 3OV4A 3M8CA 3ECFA 4HJLB 3EBTA 1GY5A 2GBWB 3HZPA 4H3UA 4STDA 2F98A 2HMJB 1GS3A 1O7GB 1NDOB 3NHXA 1OH0A 5AEWB 3GZYB 3FLJA 1O7WB 5STDA 3Q90A 3K7CA 4R9KA 3WMDA 3MHEA 4LGQA 3STDA 5G2GA 4MJDA 3H51A 3T8UA 3NUVA 1OHOA 4K1UA 4HZ9B 4HM2B 5EVHA 3HK4A 3ER7A 3MG2A 3OWYA 1Q42A 3KSPA 4HM6B 4HKVB 5AIHA 6STDA 1O7NB 1O7PB 2STDA 1IDPA 2JQ5A 3GRDA 3EJVA 3FH1A 1DMQA 3NM2A 5CF1A 1DMMA 1NU3A 3F7SA 2HMKB 5IEOA 4L8PA 4KVHA 1OGZA 2GXFA 3B4PA 1Q40A 4PEJA 3SOAA 2K54A 4XBXA 1W6YA 5FW5A 2XSOB 2YFJB 3F7XA 3A76A 1UUWB 1JB4A 1JKGA 3MG1A 2W2CA 1Q40B 5DRVA 3SOYA 1EA2A 1OCVA 3G16A 3CNMA 1U5OA 4L7KA 3FZWA 1ULJB 3FF0A 5D82A 4HM0B 1JKGB 3EBYA 3EF8A 4XB5A 3DUKA 3CU3A 2Z76A 3JUMA 1STDA 2INXA 4HM8B 3OX9A 1QJGA 2YFIB 1C7HA 4WWUC 3GZRA 3EN8A 5IG5A 1VZZA 5KP3A 1OPYA 1ASKA 1W02A 4R9LA 1HKXA 3RGAA 4XDVA 2CKFB 5DREA 3F40A 1ULIB 5TGNA 3F8XA 3SEDA 4XBYA 3K0ZA 5AIIA 3FKAA 4ORLA 3E99A 3CPOA 4WYKA 5IG0A 3JUQA 3KZTA 3LZAA 4FCMA 1ISKA 3DXOA 1TP6A 2HMNB 8CHOA 5BVBA 1GY7A 1SJWA 2HMOB 1OGXA 3NV0A 3F8HA 2GEYA 4WYKB 2HMLB 2CHCA 2Z77A 3GZXB 2RFRA 1AR0A 1GYBA 3MSOA 4J9AA 3KKGA 3IPTA 2B24B 3B7CA 3NV0B 3DM8A 4R1KA 3B4OA 1ZX2A 3OWSA 3NXJA 3RGRA 5CXOA 3VGNA 1JN5A 1OHPA
chains in the Genus database with same CATH superfamily
1E97A 1N8R4 3GSPA 1ZO2A 1LOYA 1GSPA 1E3RA 1W01A 2BMQB 1OF5A 1IVXA 1JNQA 2H0IA 3EN1B 3UJMA 1G0TA 2CFKA 3CXC2 4LSOA 3HIIA 4R4KA 5IW9A 2MC8A 3CME3 2V1LA 3JUOA 4X2HA 1CQSA 2UUGC 1GOYA 2XEPA 3U97A 3ALAA 1T3BA 3BNBA 1O7MB 3KIIA 1CYUA 2LYXA 3F9SA 1TUHA 2YFLB 1JN5B 3PXMA 4RZMA 5BIRA 5M18A 1MWTA 3Q1CA 1K41A 1C54A 1AY7A 5IENA 1I0XA 4FMCA 4O02B 1OHSA 2HOHA 1OF5B 1EG9B 3D5IA 1RHLA 4I4KA 1I8VA 1UI7A 2CH9A 3G0KA 4EBGA 2GBXB 2OWPA 4GSPA 2QIYA 1JB2A 1UCKA 4IPBA 4QWTA 1ZS7A 3S5CA 2XF3A 3H3HA 5D83A 2P38A 9RNTA 3IJEB 1Q824 4N6MA 3V99A 1UDII 4HM4B 1RKYA 4HM3B 3I553 1ROAA 2XRXB 5CK6A 4XM4A 2IA7A 3T8NA 1BOXA 3D9RA 3BNDA 1J2BA 3FF2A 4GB5A 3NBBA 4XDWA 2FGTA 3LYGA 4KT3B 2BHMA 2BU4A 3MYTA 7GSPA 2XSHB 2Z7AA 3KN4A 4ILFA 1IK3A 2C10A 3MG3A 2SBLA 4LEHA 1B27A 3FGYA 1BNGA 1RJOA 3U1WA 4AEQA 5IERA 2PZVA 4JRFA 1VQM3 1M9GA 3T0UA 2KF6A 2UGIA 4HM1B 1WNHA 3GWRA 2IMJA 1TRPA 3CCQ3 1MWSA 2PNCA 4K1VA 3ZFZA 2KCDA 4BL2A 1BU4A 4X2OA 3X41A 2OQEC 3DMCA 1T5YA 3QK9A 4NREA 4CDLA 4FCJA 3DGOA 1YIJ3 1D6UA 1KSIA 3DZLA 5D81A 1V58A 1RRHA 3V92A 3G6E3 1WMOA 2RNTA 2OTJ3 1BRNL 5KP1A 2IUKA 3EX9A 1RN4A 4EYCA 1PU4A 2F86B 4L8OA 3S29A 2FXTA 1RMSA 1LOXA 1QMAA 1F8NA 2O9UX 1WMNA 1W00A 5JPPA 3OW22 2R4IA 1X1YA 5CLKA 3X3XA 1JBRA 4J8TA 4OVMA 1Q7HA 4XBTA 1N9JA 1RN1A 3AHWA 5EEOA 1FGOA 3HX8A 2WOFA 1QVF2 1EQKA 5IG3A 1S5AA 4J5GA 3CCV3 2F4YA 4EV5A 2P05A 4LYLB 3CD63 2BMOB 1Z1SA 1GOVA 1NWWA 5HGRA 1A67A 1RGKA 4BTYA 3ZG0A 1TJDA 1JBSA 4OUQA 3JUPA 3N9HA 4BTWA 4HZBB 4NPBA 4RNYA 3ROBA 8RNTA 1VQ93 1YVBI 1BUQA 3LTCA 2W9QA 1GD3A 1I3IA 3WR2A 1G96A 1B20A 2B1XB 2UX0A 4GL6A 3FSDA 1FUSA 4DKIA 1BGSA 2W56A 2E2VA 5BU4A 4JF8A 3J7Yd 3FG4A 1NB3I 3AMOA 1LRAA 3AGOA 1BNJA 3F14A 1S723 3X40A 3FCSB 3LT9A 2Q07A 4N6V0 2P0MA 2HMMB 1BIRA 3JUNA 1MNLA 1FGMA 1N9EA 1RGGA 3KE7A 4R80A 3PZWA 1RGHA 1RLSA 4HM7B 1MWRA 4HVNA 2GEXA 1NB5I 1LQGC 4LMIA 3OXAA 4N6TA 1B3SA 4WP5A 1QVG2 3MKIA 1IVWA 2XFSA 1YJ93 3G713 1UUVB 1UCIA 2W56B 3BLZA 2CG0A 1BSCA 2I9WA 2BNGA 2WO0A 3K9MC 5IF6A 1LXEA 3WA2X 1B21A 1O7HB 4J5KA 3AMOB 1FGTA 1FYSA 3GZBA 3SXXA 2Y74A 2BIRA 2KF3A 3EC9A 5AIGA 1WMPA 1A90A 4GHOA 5AEUB 1BRSA 5RNTA 1W7CA 3SLUA 1W2ZA 1US1A 2QGUA 4HYZA 4K90B 3EE1A 1W2B2 4EC6A 1TFKA 1CYVA 2BMRB 3BIRA 1IT8A 1K8A4 1DVCA 5M1AA 2CWVA 3UNLA 2RGQA 3G8ZA 4FMDA 1DMNA 3O8YA 3OWUA 4U13A 5AI1A 2OQEA 4HBRA 2C4BA 4Q53A 3B8LA 4IIAA 2ZA4A 1E3VA 1JZOA 3DGYA 4HM5B 1GY6A 4KFDA 3WDGB 5AIFA 6RNTA 4WHAA 3EQQB 2LQVA 2ZL8A 1TTOA 3NQZA 2XR8B 3D79A 3WOEB 2RCDA 1BVIA 3PCSA 5LC7A 2H0GA 3WODG 4N6NB 3EHCA 2E2TA 3UL6A 3I0YA 1BRIA 1QAKA 1W5ZA 1R4YA 3HOHA 3SVAA 5IG4A 2CFLA 1FGQA 1IV9A 5CF2A 2GU3A 3NBRA 1JB5A 5BXQA 5IEPA 1YI23 3VSYA 1OUNA 1RNTA 1JZDA 5JPUA 5KP4A 1FGRA 1A2KA 1WTHA 2F99A 3AHSA 3VF1A 3BB9A 4CPKA 4NHFA 4BU4A 3CMA3 1RGAA 4O3VA 7STDA 1VQN3 1BAOA 1R4CA 1IV7A 4N3VA 2A15A 1WQLB 3CNXA 4EW5A 1IVUA 1QAFA 1RGLA 3OV4A 1N5HA 3M8CA 1TFOA 1IT7A 3ECFA 4HJLB 3EBTA 1AQZA 2F5WA 4BIRA 2KRTA 2ML5A 2W03A 3SYUA 4H61A 1GY5A 3N8BA 1NO3A 1SIIA 2GBWB 1BSDA 4I5QA 3HZPA 3I563 1RGEA 4H3UA 3CCS3 1K28A 2IY2A 4STDA 2F98A 2HMJB 1AVKA 1K9M4 3MPHA 1W6GA 5ELJA 1AVLA 1BANA 1GS3A 1RCLA 3PS8A 2L4VA 1N8QA 1DVDA 1Y4KA 1KWIA 5FGOA 1O7GB 1RDSA 1NDOB 4O8SA 3NHXA 1OH0A 4HAAA 5AEWB 3GZYB 2WOHA 5ELUA 3CC43 3FLJA 3LOYA 1O7WB 1PYLA 3TDGA 3ZG5A 1VQ63 4MMYB 1LOWA 5STDA 1KC84 3Q3FA 3Q90A 1BSBA 3LTBA 1SARA 1ZGXA 3K7CA 3LTAA 1UGHI 2CFWA 3MHEA 2CWTA 3HI7A 4R9KA 4RNTA 3WMDA 3BU4A 1BNSA 5JBSA 4EXRA 4LGQA 4BL3A 2P0XA 3WHOA 3LT8A 1YHQ3 3CCM3 3LTDA 2ZDJA 3STDA 5G2GA 1FW7A 4N6UA 2E2UA 1B2XA 2KF5A 1Q9EA 2KXGA 5GSPA 1BRKA 2SARA 4MJDA 3H51A 3T8UA 1GMRA 1UCLA 2CX1A 2YX9A 2CFDA 2M7OA 3NUVA 1OHOA 2D1WA 3CC73 1W4NA 1VQ83 1UI8A 4KZ1A 4K1UA 1FA3A 2K3DA 1MWUA 1HZ1A 4HM2B 4HZ9B 5EVHA 1X1XA 1LVNA 3HK4A 4HOHA 3ER7A 2L1SA 3MG2A 1Q864 3OWYA 1B2SA 2IUJA 1Q42A 1N5PA 1FZUA 4ZM8A 2BT3A 2C11A 1MOLA 1STFI 1V74A 3KSPA 4HM6B 4N6LA 4RNZA 4HKVB 1B2MA 2WGQA 1A2PA 1IU7A 1LQMB 1RGCA 1IQYA 1VQQA 3S27A 2MF7A 3KSED 5AIHA 1OACA 1BSAA 1BUJA 3GAXA 1GMPA 1LNIA 6STDA 1V57A 1D6ZA 5EQLA 1X1WA 1O7NB 1K734 2BO9B 3DGNA 4FCZA 2CG1A 3N54B 1O7PB 1M904 1PFPA 1IDPA 2STDA 3D4AA 1UW1A 2JQ5A 4FMAA 2K0MA 1D6YA 2FNQA 1EEJA 3RNTA 3GRDA 1BRGA 3X3YA 3EJVA 3DGMA 3FH1A 2JDIH 3K63A 1DMQA 3UL5A 3NM2A 3QRDA 3UB1A 1ROVA 1BNRA 2P09A 1GOUA 3CC23 5G1KA 4K61A 1Q7Y4 5CF1A 1DMMA 1NU3A 2CW9A 3F7SA 2HMKB 5IEOA 4L8PA 4KVHA 1OGZA 1AV4A 2GXFA 2RSXA 1VQ43 2OTL3 1TRQA 1MGRA 3NQYA 3B4PA 1Q40A 3DH2A 4PEJA 3SOAA 1SQWA 1I3FA 2K54A 4XBXA 5A0OB 1VQ73 1W6YA 1W6CA 5FW5A 2XSOB 2YFJB 3SX1A 3CCE3 2OOVC 1DE3A 1RCKA 2QEX3 3F7XA 1FUTA 3A76A 1RGFA 3LH4A 1I2GA 2Z6BA 1IQXA 3AGNA 1IVVA 1UUWB 1JB4A 1JKGA 1I0VA 3FG3A 1HU9A 3NM7A 3MG1A 2W2CA 3BNEA 2W04A 1Q40B 6GSPA 2XFTA 5DRVA 1YJW3 1TU5A 3URPA 2O3OA 2AADA 3SOYA 1EA2A 1OCVA 1B2UA 1DETA 3G16A 1G02A 3CNMA 1U5OA 3HIGA 3Q2PA 1VQO3 4CCVA 2IYJA 1SPUA 4L7KA 3FZWA 1ULJB 1HYFA 3FF0A 1VQK3 1YJN3 1YGWA 5D82A 4HM0B 4RBNA 3WOFB 1JKGB 2RBIA 1JBTA 2H0HA 3EBYA 2W9PA 3EF8A 4XB5A 1QALA 1UUGB 3DUKA 1A2VA 3CU3A 1IQ8A 2Z76A 3JUMA 1STDA 3D3LA 2INXA 4HM8B 7RNTA 5M19A 3OX9A 4MMZB 1QJGA 2ML6A 2YFIB 1C7HA 2AAEA 4WFOA 1X1UA 4CJNA 4WWUC 1Q814 3GZRA 1FUWA 1I70A 3X3ZA 1DYUA 1JV2B 3EN8A 3S28A 3CCL3 5I97A 2R41A 3D5GA 5IG5A 1VZZA 1KD14 5KP3A 1OPYA 1ASKA 1SIHA 1W02A 1YNVX 4R9LA 1EKMA 1HKXA 4BTXA 3RGAA 3PGBA 4XDVA 5LC6A 4FMBA 4TX4A 1I2EA 2CKFB 3IMAB 3LMLA 4MEIA 3WA3A 3LXUX 3DGLA 3JVCA 5DREA 2F5MA 1JRQA 5G1LA 3F40A 1ULIB 3A5EA 5TGNA 1GD4A 3F8XA 3CPW2 1BNFA 1YVSA 1LOVA 3BNCA 3SEDA 1RRLA 4XBYA 3FG1A 3K0ZA 1VQP3 2W0QA 5AIIA 4LZIA 3FKAA 4ORLA 3CCJ3 1M1XB 1RNBA 3NBJA 2ZHXB 3E99A 3PYJA 2CWUA 3CPOA 4OK0A 1BNIA 3K5TA 4WYKA 3X42A 1I2FA 5IG0A 1RTUA 1CH0A 3JUQA 3KZTA 4FR9A 1T2HA 3LZAA 3S67A 2QA43 4MMXB 2F56A 4EV2A 4FCMA 1ISKA 3DXOA 3PCRA 1TP6A 4IT7A 1U8CB 2HMNB 2XGNA 8CHOA 2OOVA 1NJI4 5BVBA 1L5GB 1GY7A 1RN7A 1PY3A 1SJWA 2HMOB 3V98A 5AYRB 1OGXA 4AKYA 3NV0A 3F8HA 5AYSC 2CX0A 1VQ53 2OCTA 2GEYA 3RDEA 1JJ22 2HMLB 4WYKB 2CHCA 2Z77A 2D42A 2CIUA 3GZXB 2CFGA 1LNHA 1UCJA 1BSEA 1BNEA 3EB8A 2RFRA 1EUIC 2KAAA 1AR0A 2Y73A 4N6OB 2KF4A 2W6JH 1GMQA 2CC3A 1CEWI 1GYBA 3CCR3 3L0RA 3MSOA 1YIT3 4J9AA 3KKGA 3IPTA 4O2HA 1UGIA 2B24B 1YGEA 2XH9A 3B7CA 3NV0B 2GSPA 4G1MB 5HOHA 2J8XB 3MWZA 2GU1A 3DY5A 3KFQC 2XGLA 1RSNA 2WGOA 1IYYA 4KFFA 1T2IA 3DM8A 2CK3H 4R1KA 3B4OA 1ZX2A 3KCHA 1BRHA 1B2ZA 3NXJA 3OWSA 5CXOA 3RGRA 3VGNA 1KQS2 1M1K4 1NNVA 1JN5A 1VQL3 4KFEA 4AKZA 1OHPA 3G4S3 3NX0A 1TIJA 1BRJA 3CCU3 1MGWA
chains in the Genus database with same CATH topology
1E97A 1ZO2A 1E3RA 1W01A 2BMQB 1OF5A 1IVXA 1JNQA 3EN1B 3UJMA 2CFKA 3CXC2 4LSOA 3HIIA 4R4KA 5IW9A 2MC8A 3CME3 2V1LA 3JUOA 4X2HA 1CQSA 2XEPA 3U97A 3ALAA 3BNBA 1O7MB 3KIIA 1CYUA 2LYXA 3F9SA 1TUHA 2YFLB 1JN5B 3PXMA 4RZMA 3Q1CA 1K41A 5IENA 4FMCA 4O02B 1OHSA 1OF5B 1EG9B 4I4KA 1UI7A 2CH9A 3G0KA 4EBGA 2GBXB 2OWPA 2QIYA 1JB2A 4IPBA 4QWTA 3S5CA 2XF3A 3H3HA 5D83A 2P38A 3IJEB 1Q824 4N6MA 3V99A 4HM4B 1RKYA 4HM3B 3I553 1ROAA 2XRXB 5CK6A 4XM4A 2IA7A 3T8NA 3D9RA 3BNDA 1J2BA 3FF2A 4GB5A 3NBBA 4XDWA 2FGTA 3LYGA 2BHMA 3MYTA 2XSHB 2Z7AA 3KN4A 1IK3A 2C10A 3MG3A 2SBLA 4LEHA 3FGYA 4AEQA 1RJOA 5IERA 2PZVA 4JRFA 1VQM3 1M9GA 3T0UA 4HM1B 1WNHA 3GWRA 2IMJA 3CCQ3 2PNCA 4K1VA 2KCDA 4X2OA 3X41A 2OQEC 3DMCA 1T5YA 3QK9A 4NREA 4CDLA 4FCJA 3DGOA 1YIJ3 1D6UA 1KSIA 3DZLA 5D81A 1RRHA 3V92A 3G6E3 1WMOA 2OTJ3 5KP1A 2IUKA 3EX9A 4EYCA 1PU4A 2F86B 4L8OA 3S29A 2FXTA 1LOXA 1QMAA 1F8NA 2O9UX 1WMNA 1W00A 5JPPA 3OW22 2R4IA 5CLKA 3X3XA 4J8TA 4OVMA 4XBTA 1N9JA 5EEOA 1FGOA 3HX8A 2WOFA 1QVF2 1EQKA 5IG3A 1S5AA 3CCV3 4EV5A 2P05A 1A67A 3CD63 2BMOB 1Z1SA 1NWWA 5HGRA 4BTYA 4OUQA 3JUPA 3N9HA 4BTWA 4HZBB 4RNYA 3ROBA 1VQ93 1YVBI 1BUQA 3LTCA 2W9QA 1GD3A 1G96A 2B1XB 2UX0A 4GL6A 3FSDA 2W56A 2E2VA 4JF8A 3J7Yd 3FG4A 1NB3I 3AMOA 3F14A 1S723 3X40A 3FCSB 3LT9A 2Q07A 4N6V0 2P0MA 2HMMB 3JUNA 3KE7A 1MNLA 1FGMA 1N9EA 4R80A 3PZWA 4HM7B 1NB5I 4HVNA 2GEXA 4LMIA 3OXAA 4N6TA 4WP5A 1QVG2 3MKIA 1IVWA 2XFSA 1YJ93 3G713 1UUVB 2W56B 3BLZA 2CG0A 2I9WA 2WO0A 2BNGA 3K9MC 5IF6A 1LXEA 3WA2X 1O7HB 3AMOB 1FGTA 3GZBA 1A90A 3SXXA 2Y74A 3EC9A 5AIGA 1WMPA 5AEUB 1W7CA 3SLUA 1W2ZA 1US1A 2QGUA 4HYZA 4K90B 3EE1A 1W2B2 4EC6A 1TFKA 1CYVA 2BMRB 1K8A4 1IT8A 1DVCA 2CWVA 3UNLA 2RGQA 3G8ZA 4FMDA 1DMNA 3O8YA 3OWUA 4U13A 5AI1A 2OQEA 4HBRA 4Q53A 3B8LA 4IIAA 1E3VA 4HM5B 1GY6A 4KFDA 3WDGB 5AIFA 4WHAA 3EQQB 2LQVA 2ZL8A 3NQZA 2XR8B 3WOEB 2RCDA 3PCSA 5LC7A 3WODG 4N6NB 3EHCA 2E2TA 3UL6A 3I0YA 1QAKA 1W5ZA 3SVAA 5IG4A 2CFLA 1FGQA 1IV9A 5CF2A 2GU3A 3NBRA 1JB5A 5BXQA 5IEPA 1YI23 3VSYA 1OUNA 5JPUA 5KP4A 1FGRA 1A2KA 1WTHA 2F99A 3VF1A 3BB9A 3CMA3 4NHFA 4O3VA 7STDA 1VQN3 1R4CA 1IV7A 4N3VA 2A15A 1WQLB 3CNXA 1IVUA 1QAFA 3OV4A 1N5HA 3M8CA 1TFOA 1IT7A 3ECFA 4HJLB 3EBTA 2KRTA 2ML5A 2W03A 4H61A 1GY5A 3N8BA 1NO3A 1SIIA 2GBWB 3HZPA 3I563 4H3UA 3CCS3 1K28A 4STDA 2F98A 2HMJB 1AVKA 1K9M4 3MPHA 1W6GA 5ELJA 1AVLA 1GS3A 3PS8A 2L4VA 1N8QA 1DVDA 1Y4KA 1KWIA 5FGOA 1O7GB 1NDOB 4O8SA 3NHXA 1OH0A 5AEWB 3GZYB 2WOHA 5ELUA 3CC43 3FLJA 3LOYA 1O7WB 3TDGA 1VQ63 4MMYB 1KC84 5STDA 3Q90A 3LTBA 3K7CA 3LTAA 4R9KA 2CFWA 3MHEA 2CWTA 3HI7A 3WMDA 1N8R4 5JBSA 4LGQA 2P0XA 3LT8A 1YHQ3 3CCM3 3LTDA 2ZDJA 3STDA 5G2GA 4N6UA 2E2UA 2KXGA 4MJDA 3H51A 3T8UA 2YX9A 2CFDA 2M7OA 3NUVA 1OHOA 2D1WA 3CC73 1W4NA 1VQ83 1UI8A 4KZ1A 4K1UA 1FA3A 4HZ9B 4HM2B 5EVHA 1LVNA 3HK4A 3ER7A 3MG2A 1Q864 3OWYA 2IUJA 1Q42A 1N5PA 4ZM8A 2BT3A 2C11A 1MOLA 1STFI 1V74A 3KSPA 4HM6B 4N6LA 4RNZA 4HKVB 2WGQA 1IU7A 1IQYA 3S27A 2MF7A 3KSED 5AIHA 1OACA 3GAXA 6STDA 1D6ZA 5EQLA 1O7NB 1K734 2BO9B 3DGNA 4FCZA 2CG1A 3N54B 1O7PB 1M904 1PFPA 1IDPA 2STDA 1UW1A 2JQ5A 4FMAA 2K0MA 1D6YA 2FNQA 3GRDA 3X3YA 3EJVA 3DGMA 3FH1A 2JDIH 3K63A 1DMQA 3UL5A 3NM2A 3QRDA 3UB1A 1ROVA 2P09A 3CC23 4K61A 1Q7Y4 5CF1A 1DMMA 1NU3A 2CW9A 3F7SA 2HMKB 5IEOA 4L8PA 4KVHA 1OGZA 1AV4A 2GXFA 2RSXA 1VQ43 2OTL3 3NQYA 3B4PA 1Q40A 4PEJA 3SOAA 1SQWA 2K54A 4XBXA 5A0OB 1VQ73 1W6YA 1W6CA 5FW5A 2XSOB 2YFJB 3SX1A 3CCE3 2OOVC 2QEX3 3F7XA 3LH4A 3A76A 2Z6BA 1IQXA 1IVVA 1UUWB 1JB4A 1JKGA 3FG3A 1HU9A 3NM7A 3MG1A 2W2CA 3BNEA 2W04A 1Q40B 2XFTA 5DRVA 1YJW3 1TU5A 2O3OA 3SOYA 1EA2A 1OCVA 3G16A 3Q2PA 3HIGA 3CNMA 1U5OA 1VQO3 4CCVA 1SPUA 4L7KA 3FZWA 1ULJB 3FF0A 1VQK3 1YJN3 5D82A 4HM0B 4RBNA 3WOFB 1JKGB 3EBYA 2W9PA 3EF8A 4XB5A 1QALA 3DUKA 1A2VA 3CU3A 1IQ8A 2Z76A 3JUMA 1STDA 3D3LA 2INXA 4HM8B 3OX9A 4MMZB 1QJGA 2ML6A 2YFIB 1C7HA 4WFOA 1Q814 1FUWA 4WWUC 3GZRA 3X3ZA 1DYUA 1JV2B 3EN8A 3S28A 3CCL3 5I97A 5IG5A 1VZZA 1KD14 5KP3A 1OPYA 1ASKA 1SIHA 1W02A 4R9LA 4BTXA 1EKMA 1HKXA 4EXRA 3RGAA 3PGBA 4XDVA 5LC6A 4FMBA 4TX4A 2CKFB 3IMAB 4MEIA 3LMLA 3WA3A 3LXUX 3DGLA 3JVCA 5DREA 1JRQA 3F40A 1ULIB 5TGNA 1GD4A 3F8XA 3CPW2 3BNCA 3SEDA 1RRLA 4XBYA 3FG1A 3K0ZA 1VQP3 2W0QA 5AIIA 4LZIA 3FKAA 4ORLA 3CCJ3 1M1XB 3NBJA 3E99A 3PYJA 2CWUA 3CPOA 4OK0A 3K5TA 4WYKA 3X42A 5IG0A 3JUQA 3KZTA 4FR9A 3S67A 3LZAA 2QA43 4MMXB 4EV2A 4FCMA 1ISKA 3DXOA 3PCRA 1TP6A 4IT7A 1U8CB 2HMNB 2XGNA 8CHOA 2OOVA 1NJI4 5BVBA 1L5GB 1GY7A 1RN7A 1SJWA 2HMOB 3V98A 5AYRB 1OGXA 4AKYA 3NV0A 3F8HA 5AYSC 1VQ53 2OCTA 2GEYA 3RDEA 1JJ22 2HMLB 4WYKB 2CHCA 2Z77A 2D42A 2CIUA 3GZXB 2CFGA 1LNHA 3EB8A 2RFRA 1AR0A 2Y73A 4N6OB 2W6JH 2CC3A 1CEWI 1GYBA 3CCR3 3L0RA 3MSOA 1YIT3 4J9AA 3KKGA 3IPTA 4O2HA 2XH9A 2B24B 1YGEA 3B7CA 4G1MB 3NV0B 3MWZA 2GU1A 3DY5A 3KFQC 2XGLA 2WGOA 4KFFA 3DM8A 2CK3H 4R1KA 3B4OA 1ZX2A 3OWSA 3NXJA 3RGRA 5CXOA 3VGNA 1KQS2 1M1K4 1JN5A 1VQL3 4KFEA 4AKZA 1OHPA 3G4S3 3NX0A 1TIJA 3U1WA 3CCU3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E97 A;  1ZO2 A;  1E3R A;  1W01 A;  2BMQ B;  1OF5 A;  3EN1 B;  3UJM A;  3JUO A;  4X2H A;  1CQS A;  1O7M B;  3F9S A;  1TUH A;  2YFL B;  1JN5 B;  4RZM A;  1K41 A;  5IEN A;  1OHS A;  1OF5 B;  1EG9 B;  4I4K A;  3G0K A;  2GBX B;  2OWP A;  2QIY A;  1JB2 A;  3S5C A;  3H3H A;  5D83 A;  4HM4 B;  4HM3 B;  2XRX B;  5CK6 A;  4XM4 A;  3T8N A;  3D9R A;  3FF2 A;  4GB5 A;  4XDW A;  3LYG A;  3MYT A;  2XSH B;  2Z7A A;  3MG3 A;  4LEH A;  3FGY A;  5IER A;  2PZV A;  4HM1 B;  3GWR A;  2IMJ A;  4K1V A;  4X2O A;  4CDL A;  3DMC A;  4FCJ A;  3DZL A;  5D81 A;  5KP1 A;  3EX9 A;  2F86 B;  4L8O A;  1QMA A;  5JPP A;  1W00 A;  2R4I A;  5CLK A;  4J8T A;  4OVM A;  4XBT A;  3HX8 A;  5IG3 A;  1S5A A;  2BMO B;  1Z1S A;  1NWW A;  5HGR A;  4OUQ A;  3JUP A;  4HZB B;  3ROB A;  1BUQ A;  2B1X B;  2UX0 A;  3FSD A;  3F14 A;  2HMM B;  3JUN A;  3KE7 A;  4HM7 B;  4HVN A;  2GEX A;  4LMI A;  3OXA A;  4WP5 A;  3MKI A;  1UUV B;  3BLZ A;  2I9W A;  2BNG A;  5IF6 A;  1O7H B;  3GZB A;  3EC9 A;  5AIG A;  5AEU B;  2QGU A;  2BMR B;  3UNL A;  2RGQ A;  3G8Z A;  1DMN A;  3OWU A;  4U13 A;  5AI1 A;  4Q53 A;  3B8L A;  4IIA A;  1E3V A;  4HM5 B;  1GY6 A;  5AIF A;  3EQQ B;  2XR8 B;  2RCD A;  3EHC A;  3I0Y A;  5IG4 A;  5CF2 A;  3NBR A;  1JB5 A;  5BXQ A;  5IEP A;  3VSY A;  1OUN A;  5JPU A;  5KP4 A;  1A2K A;  2F99 A;  3BB9 A;  7STD A;  4N3V A;  2A15 A;  1WQL B;  3CNX A;  3OV4 A;  3M8C A;  3ECF A;  4HJL B;  3EBT A;  1GY5 A;  2GBW B;  3HZP A;  4H3U A;  4STD A;  2F98 A;  2HMJ B;  1GS3 A;  1O7G B;  1NDO B;  3NHX A;  1OH0 A;  5AEW B;  3GZY B;  3FLJ A;  1O7W B;  5STD A;  3Q90 A;  3K7C A;  4R9K A;  3WMD A;  3MHE A;  4LGQ A;  3STD A;  5G2G A;  4MJD A;  3H51 A;  3T8U A;  3NUV A;  1OHO A;  4K1U A;  4HZ9 B;  4HM2 B;  5EVH A;  3HK4 A;  3ER7 A;  3MG2 A;  3OWY A;  1Q42 A;  3KSP A;  4HM6 B;  4HKV B;  5AIH A;  6STD A;  1O7N B;  1O7P B;  2STD A;  1IDP A;  2JQ5 A;  3GRD A;  3EJV A;  3FH1 A;  1DMQ A;  3NM2 A;  5CF1 A;  1DMM A;  1NU3 A;  3F7S A;  2HMK B;  5IEO A;  4L8P A;  4KVH A;  1OGZ A;  2GXF A;  3B4P A;  1Q40 A;  4PEJ A;  3SOA A;  2K54 A;  4XBX A;  1W6Y A;  5FW5 A;  2XSO B;  2YFJ B;  3F7X A;  3A76 A;  1UUW B;  1JB4 A;  1JKG A;  3MG1 A;  2W2C A;  1Q40 B;  5DRV A;  3SOY A;  1EA2 A;  1OCV A;  3G16 A;  3CNM A;  1U5O A;  4L7K A;  3FZW A;  1ULJ B;  3FF0 A;  5D82 A;  4HM0 B;  1JKG B;  3EBY A;  3EF8 A;  4XB5 A;  3DUK A;  3CU3 A;  2Z76 A;  3JUM A;  1STD A;  2INX A;  4HM8 B;  3OX9 A;  1QJG A;  2YFI B;  1C7H A;  4WWU C;  3GZR A;  3EN8 A;  5IG5 A;  1VZZ A;  5KP3 A;  1OPY A;  1ASK A;  1W02 A;  4R9L A;  1HKX A;  3RGA A;  4XDV A;  2CKF B;  5DRE A;  3F40 A;  1ULI B;  5TGN A;  3F8X A;  3SED A;  4XBY A;  3K0Z A;  5AII A;  3FKA A;  4ORL A;  3E99 A;  3CPO A;  4WYK A;  5IG0 A;  3JUQ A;  3KZT A;  3LZA A;  4FCM A;  1ISK A;  3DXO A;  1TP6 A;  2HMN B;  8CHO A;  5BVB A;  1GY7 A;  1SJW A;  2HMO B;  1OGX A;  3NV0 A;  3F8H A;  2GEY A;  4WYK B;  2HML B;  2CHC A;  2Z77 A;  3GZX B;  2RFR A;  1AR0 A;  1GYB A;  3MSO A;  4J9A A;  3KKG A;  3IPT A;  2B24 B;  3B7C A;  3NV0 B;  3DM8 A;  4R1K A;  3B4O A;  1ZX2 A;  3OWS A;  3NXJ A;  3RGR A;  5CXO A;  3VGN A;  1JN5 A;  1OHP A; 
#chains in the Genus database with same CATH topology
 1E97 A;  1N8R 4;  3GSP A;  1ZO2 A;  1LOY A;  1GSP A;  1E3R A;  1W01 A;  2BMQ B;  1OF5 A;  1IVX A;  1JNQ A;  2H0I A;  3EN1 B;  3UJM A;  1G0T A;  2CFK A;  3CXC 2;  4LSO A;  3HII A;  4R4K A;  5IW9 A;  2MC8 A;  3CME 3;  2V1L A;  3JUO A;  4X2H A;  1CQS A;  2UUG C;  1GOY A;  2XEP A;  3U97 A;  3ALA A;  1T3B A;  3BNB A;  1O7M B;  3KII A;  1CYU A;  2LYX A;  3F9S A;  1TUH A;  2YFL B;  1JN5 B;  3PXM A;  4RZM A;  5BIR A;  5M18 A;  1MWT A;  3Q1C A;  1K41 A;  1C54 A;  1AY7 A;  5IEN A;  1I0X A;  4FMC A;  4O02 B;  1OHS A;  2HOH A;  1OF5 B;  1EG9 B;  3D5I A;  1RHL A;  4I4K A;  1I8V A;  1UI7 A;  2CH9 A;  3G0K A;  4EBG A;  2GBX B;  2OWP A;  4GSP A;  2QIY A;  1JB2 A;  1UCK A;  4IPB A;  4QWT A;  1ZS7 A;  3S5C A;  2XF3 A;  3H3H A;  5D83 A;  2P38 A;  9RNT A;  3IJE B;  1Q82 4;  4N6M A;  3V99 A;  1UDI I;  4HM4 B;  1RKY A;  4HM3 B;  3I55 3;  1ROA A;  2XRX B;  5CK6 A;  4XM4 A;  2IA7 A;  3T8N A;  1BOX A;  3D9R A;  3BND A;  1J2B A;  3FF2 A;  4GB5 A;  3NBB A;  4XDW A;  2FGT A;  3LYG A;  4KT3 B;  2BHM A;  2BU4 A;  3MYT A;  7GSP A;  2XSH B;  2Z7A A;  3KN4 A;  4ILF A;  1IK3 A;  2C10 A;  3MG3 A;  2SBL A;  4LEH A;  1B27 A;  3FGY A;  1BNG A;  1RJO A;  3U1W A;  4AEQ A;  5IER A;  2PZV A;  4JRF A;  1VQM 3;  1M9G A;  3T0U A;  2KF6 A;  2UGI A;  4HM1 B;  1WNH A;  3GWR A;  2IMJ A;  1TRP A;  3CCQ 3;  1MWS A;  2PNC A;  4K1V A;  3ZFZ A;  2KCD A;  4BL2 A;  1BU4 A;  4X2O A;  3X41 A;  2OQE C;  3DMC A;  1T5Y A;  3QK9 A;  4NRE A;  4CDL A;  4FCJ A;  3DGO A;  1YIJ 3;  1D6U A;  1KSI A;  3DZL A;  5D81 A;  1V58 A;  1RRH A;  3V92 A;  3G6E 3;  1WMO A;  2RNT A;  2OTJ 3;  1BRN L;  5KP1 A;  2IUK A;  3EX9 A;  1RN4 A;  4EYC A;  1PU4 A;  2F86 B;  4L8O A;  3S29 A;  2FXT A;  1RMS A;  1LOX A;  1QMA A;  1F8N A;  2O9U X;  1WMN A;  1W00 A;  5JPP A;  3OW2 2;  2R4I A;  1X1Y A;  5CLK A;  3X3X A;  1JBR A;  4J8T A;  4OVM A;  1Q7H A;  4XBT A;  1N9J A;  1RN1 A;  3AHW A;  5EEO A;  1FGO A;  3HX8 A;  2WOF A;  1QVF 2;  1EQK A;  5IG3 A;  1S5A A;  4J5G A;  3CCV 3;  2F4Y A;  4EV5 A;  2P05 A;  4LYL B;  3CD6 3;  2BMO B;  1Z1S A;  1GOV A;  1NWW A;  5HGR A;  1A67 A;  1RGK A;  4BTY A;  3ZG0 A;  1TJD A;  1JBS A;  4OUQ A;  3JUP A;  3N9H A;  4BTW A;  4HZB B;  4NPB A;  4RNY A;  3ROB A;  8RNT A;  1VQ9 3;  1YVB I;  1BUQ A;  3LTC A;  2W9Q A;  1GD3 A;  1I3I A;  3WR2 A;  1G96 A;  1B20 A;  2B1X B;  2UX0 A;  4GL6 A;  3FSD A;  1FUS A;  4DKI A;  1BGS A;  2W56 A;  2E2V A;  5BU4 A;  4JF8 A;  3J7Y d;  3FG4 A;  1NB3 I;  3AMO A;  1LRA A;  3AGO A;  1BNJ A;  3F14 A;  1S72 3;  3X40 A;  3FCS B;  3LT9 A;  2Q07 A;  4N6V 0;  2P0M A;  2HMM B;  1BIR A;  3JUN A;  1MNL A;  1FGM A;  1N9E A;  1RGG A;  3KE7 A;  4R80 A;  3PZW A;  1RGH A;  1RLS A;  4HM7 B;  1MWR A;  4HVN A;  2GEX A;  1NB5 I;  1LQG C;  4LMI A;  3OXA A;  4N6T A;  1B3S A;  4WP5 A;  1QVG 2;  3MKI A;  1IVW A;  2XFS A;  1YJ9 3;  3G71 3;  1UUV B;  1UCI A;  2W56 B;  3BLZ A;  2CG0 A;  1BSC A;  2I9W A;  2BNG A;  2WO0 A;  3K9M C;  5IF6 A;  1LXE A;  3WA2 X;  1B21 A;  1O7H B;  4J5K A;  3AMO B;  1FGT A;  1FYS A;  3GZB A;  3SXX A;  2Y74 A;  2BIR A;  2KF3 A;  3EC9 A;  5AIG A;  1WMP A;  1A90 A;  4GHO A;  5AEU B;  1BRS A;  5RNT A;  1W7C A;  3SLU A;  1W2Z A;  1US1 A;  2QGU A;  4HYZ A;  4K90 B;  3EE1 A;  1W2B 2;  4EC6 A;  1TFK A;  1CYV A;  2BMR B;  3BIR A;  1IT8 A;  1K8A 4;  1DVC A;  5M1A A;  2CWV A;  3UNL A;  2RGQ A;  3G8Z A;  4FMD A;  1DMN A;  3O8Y A;  3OWU A;  4U13 A;  5AI1 A;  2OQE A;  4HBR A;  2C4B A;  4Q53 A;  3B8L A;  4IIA A;  2ZA4 A;  1E3V A;  1JZO A;  3DGY A;  4HM5 B;  1GY6 A;  4KFD A;  3WDG B;  5AIF A;  6RNT A;  4WHA A;  3EQQ B;  2LQV A;  2ZL8 A;  1TTO A;  3NQZ A;  2XR8 B;  3D79 A;  3WOE B;  2RCD A;  1BVI A;  3PCS A;  5LC7 A;  2H0G A;  3WOD G;  4N6N B;  3EHC A;  2E2T A;  3UL6 A;  3I0Y A;  1BRI A;  1QAK A;  1W5Z A;  1R4Y A;  3HOH A;  3SVA A;  5IG4 A;  2CFL A;  1FGQ A;  1IV9 A;  5CF2 A;  2GU3 A;  3NBR A;  1JB5 A;  5BXQ A;  5IEP A;  1YI2 3;  3VSY A;  1OUN A;  1RNT A;  1JZD A;  5JPU A;  5KP4 A;  1FGR A;  1A2K A;  1WTH A;  2F99 A;  3AHS A;  3VF1 A;  3BB9 A;  4CPK A;  4NHF A;  4BU4 A;  3CMA 3;  1RGA A;  4O3V A;  7STD A;  1VQN 3;  1BAO A;  1R4C A;  1IV7 A;  4N3V A;  2A15 A;  1WQL B;  3CNX A;  4EW5 A;  1IVU A;  1QAF A;  1RGL A;  3OV4 A;  1N5H A;  3M8C A;  1TFO A;  1IT7 A;  3ECF A;  4HJL B;  3EBT A;  1AQZ A;  2F5W A;  4BIR A;  2KRT A;  2ML5 A;  2W03 A;  3SYU A;  4H61 A;  1GY5 A;  3N8B A;  1NO3 A;  1SII A;  2GBW B;  1BSD A;  4I5Q A;  3HZP A;  3I56 3;  1RGE A;  4H3U A;  3CCS 3;  1K28 A;  2IY2 A;  4STD A;  2F98 A;  2HMJ B;  1AVK A;  1K9M 4;  3MPH A;  1W6G A;  5ELJ A;  1AVL A;  1BAN A;  1GS3 A;  1RCL A;  3PS8 A;  2L4V A;  1N8Q A;  1DVD A;  1Y4K A;  1KWI A;  5FGO A;  1O7G B;  1RDS A;  1NDO B;  4O8S A;  3NHX A;  1OH0 A;  4HAA A;  5AEW B;  3GZY B;  2WOH A;  5ELU A;  3CC4 3;  3FLJ A;  3LOY A;  1O7W B;  1PYL A;  3TDG A;  3ZG5 A;  1VQ6 3;  4MMY B;  1LOW A;  5STD A;  1KC8 4;  3Q3F A;  3Q90 A;  1BSB A;  3LTB A;  1SAR A;  1ZGX A;  3K7C A;  3LTA A;  1UGH I;  2CFW A;  3MHE A;  2CWT A;  3HI7 A;  4R9K A;  4RNT A;  3WMD A;  3BU4 A;  1BNS A;  5JBS A;  4EXR A;  4LGQ A;  4BL3 A;  2P0X A;  3WHO A;  3LT8 A;  1YHQ 3;  3CCM 3;  3LTD A;  2ZDJ A;  3STD A;  5G2G A;  1FW7 A;  4N6U A;  2E2U A;  1B2X A;  2KF5 A;  1Q9E A;  2KXG A;  5GSP A;  1BRK A;  2SAR A;  4MJD A;  3H51 A;  3T8U A;  1GMR A;  1UCL A;  2CX1 A;  2YX9 A;  2CFD A;  2M7O A;  3NUV A;  1OHO A;  2D1W A;  3CC7 3;  1W4N A;  1VQ8 3;  1UI8 A;  4KZ1 A;  4K1U A;  1FA3 A;  2K3D A;  1MWU A;  1HZ1 A;  4HM2 B;  4HZ9 B;  5EVH A;  1X1X A;  1LVN A;  3HK4 A;  4HOH A;  3ER7 A;  2L1S A;  3MG2 A;  1Q86 4;  3OWY A;  1B2S A;  2IUJ A;  1Q42 A;  1N5P A;  1FZU A;  4ZM8 A;  2BT3 A;  2C11 A;  1MOL A;  1STF I;  1V74 A;  3KSP A;  4HM6 B;  4N6L A;  4RNZ A;  4HKV B;  1B2M A;  2WGQ A;  1A2P A;  1IU7 A;  1LQM B;  1RGC A;  1IQY A;  1VQQ A;  3S27 A;  2MF7 A;  3KSE D;  5AIH A;  1OAC A;  1BSA A;  1BUJ A;  3GAX A;  1GMP A;  1LNI A;  6STD A;  1V57 A;  1D6Z A;  5EQL A;  1X1W A;  1O7N B;  1K73 4;  2BO9 B;  3DGN A;  4FCZ A;  2CG1 A;  3N54 B;  1O7P B;  1M90 4;  1PFP A;  1IDP A;  2STD A;  3D4A A;  1UW1 A;  2JQ5 A;  4FMA A;  2K0M A;  1D6Y A;  2FNQ A;  1EEJ A;  3RNT A;  3GRD A;  1BRG A;  3X3Y A;  3EJV A;  3DGM A;  3FH1 A;  2JDI H;  3K63 A;  1DMQ A;  3UL5 A;  3NM2 A;  3QRD A;  3UB1 A;  1ROV A;  1BNR A;  2P09 A;  1GOU A;  3CC2 3;  5G1K A;  4K61 A;  1Q7Y 4;  5CF1 A;  1DMM A;  1NU3 A;  2CW9 A;  3F7S A;  2HMK B;  5IEO A;  4L8P A;  4KVH A;  1OGZ A;  1AV4 A;  2GXF A;  2RSX A;  1VQ4 3;  2OTL 3;  1TRQ A;  1MGR A;  3NQY A;  3B4P A;  1Q40 A;  3DH2 A;  4PEJ A;  3SOA A;  1SQW A;  1I3F A;  2K54 A;  4XBX A;  5A0O B;  1VQ7 3;  1W6Y A;  1W6C A;  5FW5 A;  2XSO B;  2YFJ B;  3SX1 A;  3CCE 3;  2OOV C;  1DE3 A;  1RCK A;  2QEX 3;  3F7X A;  1FUT A;  3A76 A;  1RGF A;  3LH4 A;  1I2G A;  2Z6B A;  1IQX A;  3AGN A;  1IVV A;  1UUW B;  1JB4 A;  1JKG A;  1I0V A;  3FG3 A;  1HU9 A;  3NM7 A;  3MG1 A;  2W2C A;  3BNE A;  2W04 A;  1Q40 B;  6GSP A;  2XFT A;  5DRV A;  1YJW 3;  1TU5 A;  3URP A;  2O3O A;  2AAD A;  3SOY A;  1EA2 A;  1OCV A;  1B2U A;  1DET A;  3G16 A;  1G02 A;  3CNM A;  1U5O A;  3HIG A;  3Q2P A;  1VQO 3;  4CCV A;  2IYJ A;  1SPU A;  4L7K A;  3FZW A;  1ULJ B;  1HYF A;  3FF0 A;  1VQK 3;  1YJN 3;  1YGW A;  5D82 A;  4HM0 B;  4RBN A;  3WOF B;  1JKG B;  2RBI A;  1JBT A;  2H0H A;  3EBY A;  2W9P A;  3EF8 A;  4XB5 A;  1QAL A;  1UUG B;  3DUK A;  1A2V A;  3CU3 A;  1IQ8 A;  2Z76 A;  3JUM A;  1STD A;  3D3L A;  2INX A;  4HM8 B;  7RNT A;  5M19 A;  3OX9 A;  4MMZ B;  1QJG A;  2ML6 A;  2YFI B;  1C7H A;  2AAE A;  4WFO A;  1X1U A;  4CJN A;  4WWU C;  1Q81 4;  3GZR A;  1FUW A;  1I70 A;  3X3Z A;  1DYU A;  1JV2 B;  3EN8 A;  3S28 A;  3CCL 3;  5I97 A;  2R41 A;  3D5G A;  5IG5 A;  1VZZ A;  1KD1 4;  5KP3 A;  1OPY A;  1ASK A;  1SIH A;  1W02 A;  1YNV X;  4R9L A;  1EKM A;  1HKX A;  4BTX A;  3RGA A;  3PGB A;  4XDV A;  5LC6 A;  4FMB A;  4TX4 A;  1I2E A;  2CKF B;  3IMA B;  3LML A;  4MEI A;  3WA3 A;  3LXU X;  3DGL A;  3JVC A;  5DRE A;  2F5M A;  1JRQ A;  5G1L A;  3F40 A;  1ULI B;  3A5E A;  5TGN A;  1GD4 A;  3F8X A;  3CPW 2;  1BNF A;  1YVS A;  1LOV A;  3BNC A;  3SED A;  1RRL A;  4XBY A;  3FG1 A;  3K0Z A;  1VQP 3;  2W0Q A;  5AII A;  4LZI A;  3FKA A;  4ORL A;  3CCJ 3;  1M1X B;  1RNB A;  3NBJ A;  2ZHX B;  3E99 A;  3PYJ A;  2CWU A;  3CPO A;  4OK0 A;  1BNI A;  3K5T A;  4WYK A;  3X42 A;  1I2F A;  5IG0 A;  1RTU A;  1CH0 A;  3JUQ A;  3KZT A;  4FR9 A;  1T2H A;  3LZA A;  3S67 A;  2QA4 3;  4MMX B;  2F56 A;  4EV2 A;  4FCM A;  1ISK A;  3DXO A;  3PCR A;  1TP6 A;  4IT7 A;  1U8C B;  2HMN B;  2XGN A;  8CHO A;  2OOV A;  1NJI 4;  5BVB A;  1L5G B;  1GY7 A;  1RN7 A;  1PY3 A;  1SJW A;  2HMO B;  3V98 A;  5AYR B;  1OGX A;  4AKY A;  3NV0 A;  3F8H A;  5AYS C;  2CX0 A;  1VQ5 3;  2OCT A;  2GEY A;  3RDE A;  1JJ2 2;  2HML B;  4WYK B;  2CHC A;  2Z77 A;  2D42 A;  2CIU A;  3GZX B;  2CFG A;  1LNH A;  1UCJ A;  1BSE A;  1BNE A;  3EB8 A;  2RFR A;  1EUI C;  2KAA A;  1AR0 A;  2Y73 A;  4N6O B;  2KF4 A;  2W6J H;  1GMQ A;  2CC3 A;  1CEW I;  1GYB A;  3CCR 3;  3L0R A;  3MSO A;  1YIT 3;  4J9A A;  3KKG A;  3IPT A;  4O2H A;  1UGI A;  2B24 B;  1YGE A;  2XH9 A;  3B7C A;  3NV0 B;  2GSP A;  4G1M B;  5HOH A;  2J8X B;  3MWZ A;  2GU1 A;  3DY5 A;  3KFQ C;  2XGL A;  1RSN A;  2WGO A;  1IYY A;  4KFF A;  1T2I A;  3DM8 A;  2CK3 H;  4R1K A;  3B4O A;  1ZX2 A;  3KCH A;  1BRH A;  1B2Z A;  3NXJ A;  3OWS A;  5CXO A;  3RGR A;  3VGN A;  1KQS 2;  1M1K 4;  1NNV A;  1JN5 A;  1VQL 3;  4KFE A;  4AKZ A;  1OHP A;  3G4S 3;  3NX0 A;  1TIJ A;  1BRJ A;  3CCU 3;  1MGW A; 
#chains in the Genus database with same CATH homology
 1E97 A;  1ZO2 A;  1E3R A;  1W01 A;  2BMQ B;  1OF5 A;  1IVX A;  1JNQ A;  3EN1 B;  3UJM A;  2CFK A;  3CXC 2;  4LSO A;  3HII A;  4R4K A;  5IW9 A;  2MC8 A;  3CME 3;  2V1L A;  3JUO A;  4X2H A;  1CQS A;  2XEP A;  3U97 A;  3ALA A;  3BNB A;  1O7M B;  3KII A;  1CYU A;  2LYX A;  3F9S A;  1TUH A;  2YFL B;  1JN5 B;  3PXM A;  4RZM A;  3Q1C A;  1K41 A;  5IEN A;  4FMC A;  4O02 B;  1OHS A;  1OF5 B;  1EG9 B;  4I4K A;  1UI7 A;  2CH9 A;  3G0K A;  4EBG A;  2GBX B;  2OWP A;  2QIY A;  1JB2 A;  4IPB A;  4QWT A;  3S5C A;  2XF3 A;  3H3H A;  5D83 A;  2P38 A;  3IJE B;  1Q82 4;  4N6M A;  3V99 A;  4HM4 B;  1RKY A;  4HM3 B;  3I55 3;  1ROA A;  2XRX B;  5CK6 A;  4XM4 A;  2IA7 A;  3T8N A;  3D9R A;  3BND A;  1J2B A;  3FF2 A;  4GB5 A;  3NBB A;  4XDW A;  2FGT A;  3LYG A;  2BHM A;  3MYT A;  2XSH B;  2Z7A A;  3KN4 A;  1IK3 A;  2C10 A;  3MG3 A;  2SBL A;  4LEH A;  3FGY A;  4AEQ A;  1RJO A;  5IER A;  2PZV A;  4JRF A;  1VQM 3;  1M9G A;  3T0U A;  4HM1 B;  1WNH A;  3GWR A;  2IMJ A;  3CCQ 3;  2PNC A;  4K1V A;  2KCD A;  4X2O A;  3X41 A;  2OQE C;  3DMC A;  1T5Y A;  3QK9 A;  4NRE A;  4CDL A;  4FCJ A;  3DGO A;  1YIJ 3;  1D6U A;  1KSI A;  3DZL A;  5D81 A;  1RRH A;  3V92 A;  3G6E 3;  1WMO A;  2OTJ 3;  5KP1 A;  2IUK A;  3EX9 A;  4EYC A;  1PU4 A;  2F86 B;  4L8O A;  3S29 A;  2FXT A;  1LOX A;  1QMA A;  1F8N A;  2O9U X;  1WMN A;  1W00 A;  5JPP A;  3OW2 2;  2R4I A;  5CLK A;  3X3X A;  4J8T A;  4OVM A;  4XBT A;  1N9J A;  5EEO A;  1FGO A;  3HX8 A;  2WOF A;  1QVF 2;  1EQK A;  5IG3 A;  1S5A A;  3CCV 3;  4EV5 A;  2P05 A;  1A67 A;  3CD6 3;  2BMO B;  1Z1S A;  1NWW A;  5HGR A;  4BTY A;  4OUQ A;  3JUP A;  3N9H A;  4BTW A;  4HZB B;  4RNY A;  3ROB A;  1VQ9 3;  1YVB I;  1BUQ A;  3LTC A;  2W9Q A;  1GD3 A;  1G96 A;  2B1X B;  2UX0 A;  4GL6 A;  3FSD A;  2W56 A;  2E2V A;  4JF8 A;  3J7Y d;  3FG4 A;  1NB3 I;  3AMO A;  3F14 A;  1S72 3;  3X40 A;  3FCS B;  3LT9 A;  2Q07 A;  4N6V 0;  2P0M A;  2HMM B;  3JUN A;  3KE7 A;  1MNL A;  1FGM A;  1N9E A;  4R80 A;  3PZW A;  4HM7 B;  1NB5 I;  4HVN A;  2GEX A;  4LMI A;  3OXA A;  4N6T A;  4WP5 A;  1QVG 2;  3MKI A;  1IVW A;  2XFS A;  1YJ9 3;  3G71 3;  1UUV B;  2W56 B;  3BLZ A;  2CG0 A;  2I9W A;  2WO0 A;  2BNG A;  3K9M C;  5IF6 A;  1LXE A;  3WA2 X;  1O7H B;  3AMO B;  1FGT A;  3GZB A;  1A90 A;  3SXX A;  2Y74 A;  3EC9 A;  5AIG A;  1WMP A;  5AEU B;  1W7C A;  3SLU A;  1W2Z A;  1US1 A;  2QGU A;  4HYZ A;  4K90 B;  3EE1 A;  1W2B 2;  4EC6 A;  1TFK A;  1CYV A;  2BMR B;  1K8A 4;  1IT8 A;  1DVC A;  2CWV A;  3UNL A;  2RGQ A;  3G8Z A;  4FMD A;  1DMN A;  3O8Y A;  3OWU A;  4U13 A;  5AI1 A;  2OQE A;  4HBR A;  4Q53 A;  3B8L A;  4IIA A;  1E3V A;  4HM5 B;  1GY6 A;  4KFD A;  3WDG B;  5AIF A;  4WHA A;  3EQQ B;  2LQV A;  2ZL8 A;  3NQZ A;  2XR8 B;  3WOE B;  2RCD A;  3PCS A;  5LC7 A;  3WOD G;  4N6N B;  3EHC A;  2E2T A;  3UL6 A;  3I0Y A;  1QAK A;  1W5Z A;  3SVA A;  5IG4 A;  2CFL A;  1FGQ A;  1IV9 A;  5CF2 A;  2GU3 A;  3NBR A;  1JB5 A;  5BXQ A;  5IEP A;  1YI2 3;  3VSY A;  1OUN A;  5JPU A;  5KP4 A;  1FGR A;  1A2K A;  1WTH A;  2F99 A;  3VF1 A;  3BB9 A;  3CMA 3;  4NHF A;  4O3V A;  7STD A;  1VQN 3;  1R4C A;  1IV7 A;  4N3V A;  2A15 A;  1WQL B;  3CNX A;  1IVU A;  1QAF A;  3OV4 A;  1N5H A;  3M8C A;  1TFO A;  1IT7 A;  3ECF A;  4HJL B;  3EBT A;  2KRT A;  2ML5 A;  2W03 A;  4H61 A;  1GY5 A;  3N8B A;  1NO3 A;  1SII A;  2GBW B;  3HZP A;  3I56 3;  4H3U A;  3CCS 3;  1K28 A;  4STD A;  2F98 A;  2HMJ B;  1AVK A;  1K9M 4;  3MPH A;  1W6G A;  5ELJ A;  1AVL A;  1GS3 A;  3PS8 A;  2L4V A;  1N8Q A;  1DVD A;  1Y4K A;  1KWI A;  5FGO A;  1O7G B;  1NDO B;  4O8S A;  3NHX A;  1OH0 A;  5AEW B;  3GZY B;  2WOH A;  5ELU A;  3CC4 3;  3FLJ A;  3LOY A;  1O7W B;  3TDG A;  1VQ6 3;  4MMY B;  1KC8 4;  5STD A;  3Q90 A;  3LTB A;  3K7C A;  3LTA A;  4R9K A;  2CFW A;  3MHE A;  2CWT A;  3HI7 A;  3WMD A;  1N8R 4;  5JBS A;  4LGQ A;  2P0X A;  3LT8 A;  1YHQ 3;  3CCM 3;  3LTD A;  2ZDJ A;  3STD A;  5G2G A;  4N6U A;  2E2U A;  2KXG A;  4MJD A;  3H51 A;  3T8U A;  2YX9 A;  2CFD A;  2M7O A;  3NUV A;  1OHO A;  2D1W A;  3CC7 3;  1W4N A;  1VQ8 3;  1UI8 A;  4KZ1 A;  4K1U A;  1FA3 A;  4HZ9 B;  4HM2 B;  5EVH A;  1LVN A;  3HK4 A;  3ER7 A;  3MG2 A;  1Q86 4;  3OWY A;  2IUJ A;  1Q42 A;  1N5P A;  4ZM8 A;  2BT3 A;  2C11 A;  1MOL A;  1STF I;  1V74 A;  3KSP A;  4HM6 B;  4N6L A;  4RNZ A;  4HKV B;  2WGQ A;  1IU7 A;  1IQY A;  3S27 A;  2MF7 A;  3KSE D;  5AIH A;  1OAC A;  3GAX A;  6STD A;  1D6Z A;  5EQL A;  1O7N B;  1K73 4;  2BO9 B;  3DGN A;  4FCZ A;  2CG1 A;  3N54 B;  1O7P B;  1M90 4;  1PFP A;  1IDP A;  2STD A;  1UW1 A;  2JQ5 A;  4FMA A;  2K0M A;  1D6Y A;  2FNQ A;  3GRD A;  3X3Y A;  3EJV A;  3DGM A;  3FH1 A;  2JDI H;  3K63 A;  1DMQ A;  3UL5 A;  3NM2 A;  3QRD A;  3UB1 A;  1ROV A;  2P09 A;  3CC2 3;  4K61 A;  1Q7Y 4;  5CF1 A;  1DMM A;  1NU3 A;  2CW9 A;  3F7S A;  2HMK B;  5IEO A;  4L8P A;  4KVH A;  1OGZ A;  1AV4 A;  2GXF A;  2RSX A;  1VQ4 3;  2OTL 3;  3NQY A;  3B4P A;  1Q40 A;  4PEJ A;  3SOA A;  1SQW A;  2K54 A;  4XBX A;  5A0O B;  1VQ7 3;  1W6Y A;  1W6C A;  5FW5 A;  2XSO B;  2YFJ B;  3SX1 A;  3CCE 3;  2OOV C;  2QEX 3;  3F7X A;  3LH4 A;  3A76 A;  2Z6B A;  1IQX A;  1IVV A;  1UUW B;  1JB4 A;  1JKG A;  3FG3 A;  1HU9 A;  3NM7 A;  3MG1 A;  2W2C A;  3BNE A;  2W04 A;  1Q40 B;  2XFT A;  5DRV A;  1YJW 3;  1TU5 A;  2O3O A;  3SOY A;  1EA2 A;  1OCV A;  3G16 A;  3Q2P A;  3HIG A;  3CNM A;  1U5O A;  1VQO 3;  4CCV A;  1SPU A;  4L7K A;  3FZW A;  1ULJ B;  3FF0 A;  1VQK 3;  1YJN 3;  5D82 A;  4HM0 B;  4RBN A;  3WOF B;  1JKG B;  3EBY A;  2W9P A;  3EF8 A;  4XB5 A;  1QAL A;  3DUK A;  1A2V A;  3CU3 A;  1IQ8 A;  2Z76 A;  3JUM A;  1STD A;  3D3L A;  2INX A;  4HM8 B;  3OX9 A;  4MMZ B;  1QJG A;  2ML6 A;  2YFI B;  1C7H A;  4WFO A;  1Q81 4;  1FUW A;  4WWU C;  3GZR A;  3X3Z A;  1DYU A;  1JV2 B;  3EN8 A;  3S28 A;  3CCL 3;  5I97 A;  5IG5 A;  1VZZ A;  1KD1 4;  5KP3 A;  1OPY A;  1ASK A;  1SIH A;  1W02 A;  4R9L A;  4BTX A;  1EKM A;  1HKX A;  4EXR A;  3RGA A;  3PGB A;  4XDV A;  5LC6 A;  4FMB A;  4TX4 A;  2CKF B;  3IMA B;  4MEI A;  3LML A;  3WA3 A;  3LXU X;  3DGL A;  3JVC A;  5DRE A;  1JRQ A;  3F40 A;  1ULI B;  5TGN A;  1GD4 A;  3F8X A;  3CPW 2;  3BNC A;  3SED A;  1RRL A;  4XBY A;  3FG1 A;  3K0Z A;  1VQP 3;  2W0Q A;  5AII A;  4LZI A;  3FKA A;  4ORL A;  3CCJ 3;  1M1X B;  3NBJ A;  3E99 A;  3PYJ A;  2CWU A;  3CPO A;  4OK0 A;  3K5T A;  4WYK A;  3X42 A;  5IG0 A;  3JUQ A;  3KZT A;  4FR9 A;  3S67 A;  3LZA A;  2QA4 3;  4MMX B;  4EV2 A;  4FCM A;  1ISK A;  3DXO A;  3PCR A;  1TP6 A;  4IT7 A;  1U8C B;  2HMN B;  2XGN A;  8CHO A;  2OOV A;  1NJI 4;  5BVB A;  1L5G B;  1GY7 A;  1RN7 A;  1SJW A;  2HMO B;  3V98 A;  5AYR B;  1OGX A;  4AKY A;  3NV0 A;  3F8H A;  5AYS C;  1VQ5 3;  2OCT A;  2GEY A;  3RDE A;  1JJ2 2;  2HML B;  4WYK B;  2CHC A;  2Z77 A;  2D42 A;  2CIU A;  3GZX B;  2CFG A;  1LNH A;  3EB8 A;  2RFR A;  1AR0 A;  2Y73 A;  4N6O B;  2W6J H;  2CC3 A;  1CEW I;  1GYB A;  3CCR 3;  3L0R A;  3MSO A;  1YIT 3;  4J9A A;  3KKG A;  3IPT A;  4O2H A;  2XH9 A;  2B24 B;  1YGE A;  3B7C A;  4G1M B;  3NV0 B;  3MWZ A;  2GU1 A;  3DY5 A;  3KFQ C;  2XGL A;  2WGO A;  4KFF A;  3DM8 A;  2CK3 H;  4R1K A;  3B4O A;  1ZX2 A;  3OWS A;  3NXJ A;  3RGR A;  5CXO A;  3VGN A;  1KQS 2;  1M1K 4;  1JN5 A;  1VQL 3;  4KFE A;  4AKZ A;  1OHP A;  3G4S 3;  3NX0 A;  1TIJ A;  3U1W A;  3CCU 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...