3GZBA

Crystal structure of putative snoal-like polyketide cyclase (yp_001182657.1) from shewanella putrefaciens cn-32 at 1.44 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
154
structure length
154
Chain Sequence
GMFASLVIPVSAQANSGEMPQEQQLAVKYMDALTEHDYKTLITFYNRDSIFFDKTANRKYTGGRFIIDFLERAHQGVLEYDFNIEHMYNAGSLVVMIGNYHFKGPGEQFGKPGKIIDVAIPAVTSLKLDMLNRRVTEHVDLIDYQTMSDQLAMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative SnoaL-like polyketide cyclase
publication title Crystal structure of putative SnoaL-like polyketide cyclase (YP_001182657.1) from Shewanella putrefaciens CN-32 at 1.44 A resolution
rcsb
source organism Shewanella putrefaciens
molecule tags Lyase
total genus 42
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3gzbA00
1O7PB 3KSPA 1BUQA 2F99A 1OHPA 1ZO2A 4WYKA 4XBYA 5AIFA 4HM6B 2HMJB 3OWYA 2XRXB 3CPOA 2BMRB 1O7GB 3OX9A 2STDA 3MG3A 5STDA 3CNXA 3MG2A 4HJLB 3HZPA 2BMOB 1E97A 3DM8A 4U13A 3OWSA 4XDWA 3H51A 1NDOB 2F86B 1OCVA 3EBTA 3SEDA 3GWRA 3A76A 1OPYA 3UJMA 2Z76A 1NWWA 1OHOA 5KP4A 4XM4A 2HMKB 4HM5B 3RGRA 1C7HA 1DMNA 1TP6A 5IG3A 2RGQA 3ROBA 1OGZA 1W02A 4J9AA 4MJDA 2XSHB 4HM0B 3FLJA 4WYKB 1Q42A 5D82A 4OUQA 4X2OA 5CF1A 4FCJA 3B4PA 3UNLA 1GY5A 4HZ9B 3EF8A 4L8PA 5HGRA 2GBWB 1VZZA 3DMCA 4X2HA 8CHOA 1OF5A 3G16A 1QMAA 2QGUA 1O7WB 4XBTA 3SOYA 4HM1B 5IG0A 5JPUA 1HKXA 5IEOA 5JPPA 1CQSA 3JUOA 3F14A 2YFJB 4HZBB 4R9KA 2RFRA 1W00A 3LZAA 2R4IA 2BMQB 2HMNB 1QJGA 4R1KA 3K0ZA 4WP5A 5DRVA 3GRDA 3STDA 7STDA 2CHCA 3DUKA 1GY6A 1OH0A 1O7MB 2B1XB 5IENA 1ULJB 2HMOB 1JB5A 4I4KA 4HM2B 3FGYA 3OXAA 3NM2A 3VGNA 2GXFA 3MKIA 3FH1A 2GEYA 1O7HB 4XB5A 1S5AA 4L8OA 5G2GA 3GZBA 1OF5B 1ULIB 5TGNA 1OUNA 3MHEA 3BB9A 2UX0A 3GZYB 2YFLB 4K1UA 3GZRA 4KVHA 3DXOA 2A15A 3I0YA 2YFIB 3NHXA 3M8CA 3KE7A 1ISKA 3VSYA 3EBYA 1WQLB 5KP1A 5IF6A 4XDVA 1GS3A 1GY7A 4L7KA 1K41A 4RZMA 3F7SA 3SOAA 4ORLA 3B8LA 5CF2A 4WWUC 2CKFB 3JUNA 1UUVB 1STDA 1GYBA 2Z7AA 4K1VA 5AEWB 2HMMB 2I9WA 1ZX2A 3KKGA 2PZVA 3NXJA 4HVNA 1JKGB 2BNGA 5CXOA 2JQ5A 2INXA 3EQQB 3Q90A 5AIHA 4LGQA 4XBXA 4FCMA 1O7NB 1UUWB 3D9RA 3JUMA 3MYTA 1TUHA 3DZLA 1JB4A 5IG4A 5AIIA 4LEHA 5IERA 3FSDA 3NBRA 2F98A 2B24B 4CDLA 3RGAA 4STDA 3NUVA 4J8TA 3ECFA 2W2CA 5IEPA 3E99A 3HK4A 3S5CA 3OV4A 1SJWA 1E3RA 1E3VA 3FF0A 4GB5A 3ER7A 4HM4B 5D81A 5AI1A 4PEJA 3EJVA 2K54A 1W01A 1Q40A 3WMDA 2Z77A 4Q53A 2GBXB 3NV0A 3FZWA 1JKGA 2IMJA 1JN5A 3F9SA 5DREA 3F8HA 3HX8A 1Z1SA 3BLZA 1EA2A 4HM3B 3MSOA 4OVMA 4IIAA 5AEUB 1JB2A 2GEXA 2HMLB 4HKVB 3CNMA 1AR0A 1DMQA 3OWUA 5BVBA 4H3UA 3EC9A 3F40A 3K7CA 2QIYA 3F7XA 4HM7B 3B4OA 4R9LA 1U5OA 3EN8A 3EX9A 3G8ZA 3EHCA 3LYGA 3MG1A 3JUPA 3B7CA 3JUQA 5IG5A 1OHSA 5KP3A 3F8XA 1A2KA 2OWPA 3G0KA 5BXQA 1W6YA 3CU3A 1EG9B 1Q40B 5CK6A 3FKAA 3FF2A 3NV0B 3EN1B 3IPTA 5CLKA 5FW5A 1JN5B 3GZXB 2XSOB 6STDA 5AIGA 4LMIA 1OGXA 3T8NA 3T8UA 3H3HA 3KZTA 5EVHA 5D83A 4HM8B 2RCDA 1DMMA 1IDPA 4N3VA 1ASKA 1NU3A 2XR8B
chains in the Genus database with same CATH superfamily
1Q9EA 1BRSA 1O7PB 2AAEA 1WMOA 3CC43 3KSED 1JBRA 3KSPA 3PS8A 1N9JA 1BNFA 5G1KA 1BUQA 2F99A 1W5ZA 1X1XA 2OOVC 1M1K4 3PGBA 1OHPA 3OW22 1ZO2A 4BL2A 2ML6A 2W9QA 4WYKA 1YHQ3 3G713 3EB8A 4XBYA 2BU4A 2UGIA 5AIFA 4FR9A 5I97A 1YIT3 3PCRA 1I3FA 3DGOA 4HM6B 1I2GA 2HMJB 1RCLA 3OWYA 1IQYA 1MWSA 2XRXB 3CPOA 1BSEA 2CFKA 2BMRB 3G4S3 1O7GB 1QALA 4KFDA 4MMXB 3X3ZA 5LC6A 4N6UA 3TDGA 3OX9A 2STDA 1UW1A 1GMQA 3MG3A 2XH9A 5STDA 4EYCA 4EV2A 3DGNA 3CNXA 1R4YA 1RNBA 1D6ZA 1UCLA 3BNBA 3MG2A 3N54B 1YIJ3 1NJI4 4HJLB 3HZPA 2BMOB 3FCSB 1E97A 2GU3A 4CJNA 3DM8A 4U13A 2IA7A 2K3DA 2RBIA 2CC3A 3CMA3 1TIJA 1WMNA 3OWSA 1T5YA 3RNTA 1MNLA 4XDWA 3SYUA 1B20A 3H51A 1NDOB 2F86B 4FMDA 1OCVA 1CYVA 3URPA 3EBTA 2KRTA 3SEDA 2BT3A 5HOHA 1RJOA 3GWRA 3VF1A 1QVG2 3A76A 1OPYA 2P0XA 1KD14 4AKYA 3UJMA 1V57A 3DY5A 1AQZA 2Z76A 1NWWA 1OHOA 5KP4A 2CFGA 4ZM8A 4XM4A 1TRQA 2HMKB 1W4NA 1K9M4 1VQ43 4BTXA 2KF4A 4NPBA 1ZS7A 1BU4A 1V74A 4HM5B 4GHOA 1RDSA 3RGRA 2ZDJA 5AYRB 1BUJA 1C7HA 4FMAA 1DMNA 1FUTA 1TP6A 1D6YA 5LC7A 5BIRA 5IG3A 2RGQA 3SXXA 3X42A 3ROBA 1OGZA 1N8QA 2ZL8A 3CME3 1W02A 2P0MA 1GMPA 4J9AA 1CYUA 4MJDA 1DE3A 1BRIA 4EBGA 2XSHB 2CH9A 2IY2A 3S67A 1Y4KA 4HM0B 1N5HA 3Q3FA 3FLJA 4WYKB 3X40A 2C11A 4HBRA 3WODG 7RNTA 1Q42A 5ELUA 3GAXA 3AMOB 4N6TA 4OUQA 5D82A 1I8VA 2Q07A 1LQGC 1WMPA 3K9MC 4X2OA 1D6UA 3PZWA 1I70A 5CF1A 4KZ1A 1M904 4FCJA 1BIRA 1B2XA 3B4PA 4K61A 1Q814 3UNLA 3ZG5A 1GY5A 1I0XA 4HZ9B 1UI7A 3LXUX 3EF8A 3WOEB 4ILFA 4L8PA 3N9HA 5HGRA 2GBWB 3X41A 1RGKA 1YGWA 1UGHI 2CFWA 1RGCA 5EEOA 1A67A 3KIIA 4NHFA 1VZZA 1YVSA 3DMCA 4X2HA 2XGNA 3V92A 1FW7A 1A90A 1I3IA 8CHOA 1WNHA 1RLSA 1IU7A 1OF5A 3G16A 1W2B2 3CXC2 4RNTA 1NB5I 2XEPA 4EC6A 1YNVX 1BNSA 1IVUA 1W2ZA 3ZG0A 3HIIA 1VQL3 1QMAA 1ZGXA 2QGUA 1TJDA 1O7WB 3IJEB 1IV9A 2CX1A 3NQZA 4XBTA 3G6E3 4CCVA 1TFKA 2H0GA 3MPHA 4O3VA 4AKZA 2FXTA 4DKIA 2E2TA 4BU4A 3WDGB 1RNTA 4RBNA 3CCL3 2OTJ3 3SOYA 4HM1B 1RGAA 1MOLA 1PFPA 5IG0A 1ROVA 3CCQ3 3EE1A 5JPUA 1JJ22 1FGTA 1HKXA 1B3SA 3V99A 1S723 5IEOA 1SIIA 1CQSA 3NM7A 5JPPA 3JUOA 3SX1A 3F14A 3U97A 3BIRA 2YFJB 3LH4A 4IT7A 4HZBB 1NO3A 1FGMA 4TX4A 1FZUA 4R9KA 1RMSA 2RFRA 1VQN3 1W00A 1YGEA 3BNDA 3LZAA 1FA3A 2R4IA 3KFQC 1TU5A 3FG3A 2BMQB 3GSPA 2HMNB 3PXMA 1QJGA 1I2FA 3K0ZA 4R1KA 1VQP3 1SIHA 1X1WA 4R80A 2SBLA 4HOHA 4WP5A 1VQ53 5DRVA 3GRDA 3STDA 1IQ8A 1M9GA 3AMOA 2CHCA 7STDA 2PNCA 3AHSA 2W6JH 3DUKA 1K734 1F8NA 1RRHA 1RGLA 1GY6A 1JZDA 2D1WA 3LTAA 1OH0A 3L0RA 1VQK3 1O7MB 2B1XB 5IENA 1YI23 1BANA 1EUIC 1ULJB 2HMOB 1ROAA 2XGLA 1JB5A 4EXRA 3CD63 4I4KA 4QWTA 1AV4A 4HM2B 1K8A4 1VQ63 1FGQA 2JDIH 1A2PA 1WTHA 3FGYA 3OXAA 1QAKA 4EV5A 1MGWA 3NM2A 3VGNA 1DVCA 1PY3A 1KC84 2CG1A 2GXFA 1GMRA 3MKIA 3FH1A 2GEYA 1O7HB 4J5KA 4XB5A 1BRHA 6RNTA 3AHWA 1S5AA 1TRPA 4L8OA 1KSIA 2WO0A 5G2GA 3GZBA 3DGLA 1OF5B 3A5EA 1BSCA 2CWTA 3S29A 1GSPA 1BNJA 1G96A 1ULIB 5TGNA 2J8XB 3I563 2P38A 1HZ1A 1FGRA 1OUNA 3ALAA 4KT3B 3CC73 3MHEA 3BB9A 3LMLA 5JBSA 2UX0A 1BGSA 3PYJA 3GZYB 2YFLB 4K1UA 3GZRA 3KCHA 1VQ73 1W6GA 1GD4A 4LYLB 4N6OB 2O9UX 3DXOA 2KXGA 2A15A 4KVHA 3I0YA 2YFIB 2OQEC 1B27A 2KF6A 3NHXA 2FGTA 5EQLA 3M8CA 2W03A 2CG0A 1KQS2 1B2MA 4HYZA 3KE7A 1ISKA 1VQM3 3VSYA 4JF8A 1NB3I 4FCZA 3EBYA 1X1UA 1T2IA 2OOVA 1GOVA 3LT9A 1OACA 1WQLB 2IUJA 1HYFA 5KP1A 5IF6A 1YVBI 2YX9A 4XDVA 1GS3A 1AVKA 1GY7A 3BU4A 4L7KA 3I553 1K41A 4RZMA 2C10A 3CCM3 1IV7A 2BO9B 6GSPA 2QEX3 4H61A 3HI7A 2FNQA 3QK9A 2BHMA 2O3OA 1J2BA 3F7SA 4RNZA 3SOAA 4LSOA 4N6NB 2Y73A 1JRQA 2CWUA 3CCR3 4LZIA 4EW5A 4ORLA 1EEJA 1BSBA 3B8LA 1C54A 3LT8A 1GOYA 1TTOA 5CF2A 1JBTA 1CEWI 4FMCA 4MMZB 4N6V0 4BIRA 3D79A 4WWUC 3UL5A 5G1LA 1IT8A 1MWRA 4AEQA 2KF3A 2CKFB 2Y74A 1DYUA 1N5PA 1RCKA 3JUNA 5M19A 1UUVB 4WHAA 1KWIA 1STDA 1GYBA 1G02A 2Z7AA 4G1MB 4K1VA 5AEWB 2HMMB 4BTWA 1BNGA 2I9WA 2F5WA 2GSPA 1ZX2A 3KKGA 1IQXA 2W0QA 2PZVA 1AVLA 1RN7A 1LRAA 4N6MA 3UB1A 2OTL3 1JZOA 2KF5A 2V1LA 3NXJA 3RDEA 4HVNA 2CW9A 1V58A 2HOHA 1QAFA 1JKGB 2R41A 5IW9A 1RHLA 2BNGA 3WA2X 2Z6BA 5CXOA 3NBJA 2RSXA 2JQ5A 2INXA 2MF7A 1LOVA 3D5IA 4MEIA 2LQVA 3EQQB 1EQKA 3Q90A 1VQO3 5AIHA 1W7CA 4LGQA 3S28A 3UL6A 3CCS3 2D42A 4XBXA 5FGOA 2CK3H 4FCMA 1O7NB 3ZFZA 1BNEA 4GL6A 1UUWB 2UUGC 1X1YA 2WGOA 3O8YA 3D9RA 1BSAA 3JUMA 3MYTA 5ELJA 1TUHA 3D4AA 1YJW3 1BSDA 2L1SA 3DZLA 3CCJ3 1JB4A 1EKMA 5IG4A 5AIIA 1G0TA 3CCU3 2BIRA 4LEHA 5IERA 1SARA 3FSDA 3NBRA 4MMYB 2W56A 4O8SA 2F98A 2B24B 4CDLA 2P05A 3RGAA 2RNTA 2IUKA 3BNCA 3LTDA 4STDA 3MWZA 3NUVA 3DH2A 4J8TA 3ECFA 4BTYA 3X3YA 4N6LA 2CWVA 2W2CA 3Q1CA 2F4YA 5BU4A 3WR2A 1MWUA 5IEPA 3E99A 3HK4A 3S5CA 1ASKA 3OV4A 1LVNA 1SJWA 3D5GA 1E3RA 1E3VA 3FF0A 1US1A 3WA3A 1Q864 4GB5A 4JRFA 1YJ93 1I0VA 1IVVA 3ER7A 2AADA 1JNQA 4HM4B 4NREA 5D81A 5AI1A 1B2SA 5M18A 4KFEA 1RN1A 1FGOA 1JBSA 4PEJA 1RGHA 2SARA 3EJVA 3K5TA 1IT7A 1T2HA 2K54A 1W01A 1Q40A 3DGYA 2F5MA 3WMDA 1FUWA 2CX0A 3DGMA 2Z77A 4Q53A 1M1XB 2GBXB 3NV0A 1CH0A 1BVIA 1UDII 3FZWA 1FYSA 1JKGA 3T0UA 3PCSA 1FUSA 4R4KA 1IVWA 1IYYA 2IMJA 1JN5A 3F9SA 1YJN3 5A0OB 3K63A 5DREA 2CFLA 3F8HA 4GSPA 4RNYA 5AYSC 3HX8A 2QA43 2E2VA 1Z1SA 3BLZA 1EA2A 2CIUA 4HM3B 2WOFA 5M1AA 2P09A 3MSOA 3IMAB 1T3BA 4IIAA 4OVMA 1PU4A 1LOYA 1RN4A 3CCE3 3JVCA 5AEUB 1JB2A 4IPBA 3CPW2 1K28A 2GEXA 2HMLB 1SPUA 1Q824 2KCDA 4HKVB 3BNEA 1B21A 3CNMA 4CPKA 1AR0A 1B2UA 1BNIA 1DMQA 3OWUA 5BVBA 2XF3A 4O02B 2ML5A 4H3UA 1RGFA 9RNTA 2WOHA 1MWTA 4KFFA 1Q7HA 2H0HA 2K0MA 1RRLA 3EC9A 3F40A 1L5GB 3SVAA 3HIGA 3LTBA 3WOFB 3K7CA 2QIYA 3WHOA 1UUGB 1UGIA 1DETA 1Q7Y4 1VQ93 2W56B 5RNTA 4HAAA 3F7XA 4HM7B 1UCKA 4OK0A 3D3LA 3B4OA 2CFDA 1RGGA 1JV2B 4R9LA 1B2ZA 1U5OA 1IK3A 3EN8A 3EX9A 1MGRA 4J5GA 3G8ZA 3EHCA 3LYGA 3MG1A 3QRDA 1LNHA 8RNTA 4I5QA 1RKYA 2F56A 3JUPA 1BAOA 3HOHA 1AY7A 3NQYA 2IYJA 3B7CA 1IVXA 2M7OA 3U1WA 2OCTA 2H0IA 4FMBA 1TFOA 3JUQA 1LNIA 5IG5A 1OHSA 3LTCA 1DVDA 5KP3A 3FG1A 3F8XA 1A2KA 3SLUA 2OWPA 1QVF2 2ZHXB 3G0KA 3V98A 1BOXA 5BXQA 1VQ83 1W6YA 1HU9A 1BRJA 2ZA4A 3AGNA 1EG9B 1BRKA 1Q40B 1SQWA 3AGOA 3CU3A 3FKAA 3FF2A 3LOYA 1LOXA 2XFSA 3N8BA 5CK6A 1BNRA 7GSPA 3NV0B 3EN1B 1I2EA 1VQQA 3X3XA 5GSPA 3IPTA 1LOWA 1GD3A 5CLKA 5FW5A 1UCIA 3S27A 1JN5B 3NBBA 3GZXB 4BL3A 1LQMB 2C4BA 2XSOB 1A2VA 1U8CB 1UCJA 3NX0A 2OQEA 6STDA 1UI8A 1RTUA 4K90B 4WFOA 5AIGA 2KAAA 1NNVA 3FG4A 1N8R4 1GOUA 1R4CA 4LMIA 1RSNA 1OGXA 1W6CA 1N9EA 2W04A 2GU1A 3T8NA 4O2HA 2WGQA 2LYXA 3H3HA 3KZTA 3T8UA 3CCV3 5EVHA 1STFI 2E2UA 2W9PA 5D83A 1PYLA 3KN4A 2L4VA 1RGEA 2RCDA 2XFTA 4HM8B 3Q2PA 1BRNL 2MC8A 1DMMA 1IDPA 1BRGA 4N3VA 3J7Yd 3CC23 1LXEA 1NU3A 2XR8B
chains in the Genus database with same CATH topology
1O7PB 1WMOA 3CC43 3KSED 3KSPA 3PS8A 1N9JA 1BUQA 2F99A 1W5ZA 2OOVC 1M1K4 3PGBA 1OHPA 3OW22 1ZO2A 2ML6A 2W9QA 4WYKA 1YHQ3 3G713 3EB8A 4XBYA 5AIFA 4FR9A 5I97A 1YIT3 3PCRA 3DGOA 4HM6B 2HMJB 3OWYA 1IQYA 2XRXB 3CPOA 2CFKA 2BMRB 3G4S3 1O7GB 1QALA 4KFDA 4MMXB 3X3ZA 5LC6A 4N6UA 3TDGA 3OX9A 2STDA 1UW1A 3MG3A 5STDA 2XH9A 4EYCA 4EV2A 3DGNA 3CNXA 1D6ZA 3N54B 3BNBA 3MG2A 1YIJ3 1NJI4 4HJLB 3HZPA 2BMOB 3FCSB 1E97A 2GU3A 3DM8A 4U13A 2IA7A 2CC3A 3CMA3 1TIJA 1WMNA 3OWSA 1T5YA 1MNLA 4XDWA 3H51A 1NDOB 2F86B 4FMDA 1OCVA 1CYVA 3EBTA 2KRTA 3SEDA 2BT3A 1RJOA 3GWRA 3VF1A 1QVG2 3A76A 1OPYA 2P0XA 1KD14 4AKYA 3UJMA 3DY5A 2Z76A 1NWWA 1OHOA 5KP4A 2CFGA 4ZM8A 4XM4A 2HMKB 1W4NA 1K9M4 1VQ43 4BTXA 1V74A 4HM5B 3RGRA 2ZDJA 5AYRB 1C7HA 4FMAA 1DMNA 1TP6A 1D6YA 5LC7A 5IG3A 2RGQA 3SXXA 3X42A 3ROBA 1OGZA 1N8QA 2ZL8A 3CME3 1W02A 2P0MA 4J9AA 1CYUA 4MJDA 4EBGA 2XSHB 2CH9A 3S67A 1Y4KA 4HM0B 1N5HA 3FLJA 4WYKB 3X40A 2C11A 4HBRA 3WODG 1Q42A 5ELUA 3GAXA 3AMOB 4N6TA 4OUQA 5D82A 2Q07A 4X2OA 1WMPA 3K9MC 1D6UA 3PZWA 5CF1A 4KZ1A 1M904 4FCJA 3B4PA 4K61A 1Q814 3UNLA 1GY5A 4HZ9B 1UI7A 3LXUX 3EF8A 3WOEB 4L8PA 3N9HA 5HGRA 2GBWB 3X41A 2CFWA 5EEOA 1A67A 3KIIA 4NHFA 1VZZA 3DMCA 4X2HA 2XGNA 3V92A 1A90A 8CHOA 1WNHA 1IU7A 1OF5A 3G16A 1W2B2 1LXEA 3CXC2 2XEPA 4EC6A 1IVUA 1W2ZA 3HIIA 1VQL3 1QMAA 2QGUA 3IJEB 1O7WB 1IV9A 3NQZA 4XBTA 3G6E3 4CCVA 1TFKA 3MPHA 4O3VA 4AKZA 2FXTA 2E2TA 3WDGB 4RBNA 3CCL3 2OTJ3 3SOYA 4HM1B 5IG0A 1MOLA 1PFPA 1ROVA 3CCQ3 3EE1A 5JPUA 1JJ22 1FGTA 1HKXA 1S723 3V99A 5IEOA 1SIIA 1CQSA 3NM7A 5JPPA 3JUOA 3SX1A 3F14A 3U97A 2YFJB 3LH4A 4IT7A 4HZBB 1NO3A 1FGMA 4TX4A 4R9KA 1VQN3 2RFRA 1W00A 1YGEA 3BNDA 3LZAA 1FA3A 2R4IA 3KFQC 1TU5A 3FG3A 2BMQB 1VQP3 2HMNB 3PXMA 1QJGA 4R1KA 3K0ZA 1NB5I 1SIHA 4R80A 2SBLA 4WP5A 1VQ53 5DRVA 3GRDA 3STDA 1IQ8A 3AMOA 1M9GA 2CHCA 7STDA 2PNCA 2W6JH 3DUKA 1K734 1F8NA 1RRHA 1GY6A 2D1WA 3LTAA 1OH0A 3L0RA 1VQK3 1O7MB 2B1XB 5IENA 1YI23 1ULJB 2HMOB 1ROAA 2XGLA 1JB5A 4EXRA 3CD63 4I4KA 4QWTA 1AV4A 4HM2B 1K8A4 1VQ63 1FGQA 2JDIH 1WTHA 3FGYA 3OXAA 1QAKA 4EV5A 3NM2A 3VGNA 1DVCA 1KC84 2CG1A 2GXFA 3MKIA 3FH1A 2GEYA 1O7HB 4XB5A 1S5AA 4L8OA 1KSIA 2WO0A 5G2GA 3GZBA 3DGLA 1OF5B 2CWTA 3S29A 1G96A 1ULIB 5TGNA 3I563 2P38A 1FGRA 1OUNA 3ALAA 3CC73 3MHEA 3BB9A 3LMLA 5JBSA 2UX0A 3PYJA 3GZYB 2YFLB 4K1UA 3GZRA 1VQ73 1W6GA 1GD4A 4N6OB 2O9UX 3DXOA 2KXGA 2A15A 4KVHA 3I0YA 2YFIB 2OQEC 3NHXA 2FGTA 5EQLA 3M8CA 2W03A 2CG0A 1KQS2 4HYZA 3KE7A 1ISKA 3VSYA 4JF8A 1NB3I 4FCZA 3EBYA 2OOVA 3LT9A 1OACA 1WQLB 2IUJA 5KP1A 5IF6A 1YVBI 2YX9A 4XDVA 1GS3A 1AVKA 1GY7A 4L7KA 3I553 1K41A 4RZMA 2C10A 3CCM3 1IV7A 2BO9B 2QEX3 4H61A 3HI7A 2FNQA 3QK9A 2BHMA 2O3OA 1J2BA 3F7SA 4RNZA 3SOAA 4LSOA 4N6NB 2Y73A 1JRQA 2CWUA 3CCR3 4LZIA 4ORLA 3B8LA 3LT8A 5CF2A 1CEWI 4FMCA 4MMZB 4N6V0 4WWUC 3UL5A 1IT8A 4AEQA 2CKFB 2Y74A 1DYUA 1N5PA 3JUNA 1UUVB 4WHAA 1KWIA 1STDA 1GYBA 4G1MB 2Z7AA 4K1VA 5AEWB 2HMMB 4BTWA 2I9WA 1ZX2A 3KKGA 1IQXA 2W0QA 2PZVA 1AVLA 1RN7A 4N6MA 3UB1A 2OTL3 2V1LA 3NXJA 3RDEA 4HVNA 2CW9A 1QAFA 1JKGB 5IW9A 3WA2X 2BNGA 2Z6BA 5CXOA 3NBJA 2RSXA 2JQ5A 2INXA 2MF7A 4MEIA 1EQKA 2LQVA 3EQQB 3Q90A 1VQO3 5AIHA 1W7CA 4LGQA 3S28A 3UL6A 3CCS3 2D42A 4XBXA 5FGOA 2CK3H 4FCMA 1O7NB 4GL6A 1UUWB 2WGOA 3O8YA 3D9RA 3JUMA 3MYTA 5ELJA 1TUHA 1YJW3 3CCJ3 3DZLA 1JB4A 1EKMA 5IG4A 5AIIA 3CCU3 4LEHA 5IERA 3FSDA 3NBRA 4MMYB 2W56A 4O8SA 2F98A 2B24B 4CDLA 2P05A 3RGAA 2IUKA 3BNCA 3LTDA 4STDA 3MWZA 3NUVA 4J8TA 4BTYA 3ECFA 3X3YA 4N6LA 2CWVA 2W2CA 3Q1CA 5IEPA 3E99A 3HK4A 3S5CA 3OV4A 1LVNA 1SJWA 1E3RA 1E3VA 3FF0A 1US1A 3WA3A 1Q864 4GB5A 4JRFA 1YJ93 1IVVA 3ER7A 4NREA 1JNQA 4HM4B 5D81A 5AI1A 4KFEA 1FGOA 4PEJA 3EJVA 3K5TA 1IT7A 2K54A 1W01A 1Q40A 3WMDA 1FUWA 3DGMA 2Z77A 4Q53A 2GBXB 1M1XB 3NV0A 3FZWA 1JKGA 3T0UA 3PCSA 4R4KA 1IVWA 2IMJA 1JN5A 3F9SA 1YJN3 5A0OB 3K63A 5DREA 2CFLA 3F8HA 4RNYA 5AYSC 3HX8A 2QA43 2E2VA 1Z1SA 3BLZA 1EA2A 2CIUA 4HM3B 2WOFA 2P09A 3MSOA 3IMAB 4OVMA 4IIAA 3CCE3 1PU4A 3JVCA 5AEUB 1JB2A 4IPBA 3CPW2 1K28A 2GEXA 2HMLB 1SPUA 1Q824 2KCDA 4HKVB 3BNEA 3CNMA 1AR0A 1DMQA 3OWUA 5BVBA 2XF3A 4O02B 2ML5A 4H3UA 2WOHA 1L5GB 4KFFA 3EC9A 2K0MA 1RRLA 3F40A 3SVAA 3HIGA 3LTBA 3WOFB 3K7CA 2QIYA 1Q7Y4 1VQ93 2W56B 3F7XA 4HM7B 4OK0A 3D3LA 3B4OA 2CFDA 1JV2B 4R9LA 1U5OA 1IK3A 3EN8A 3EX9A 3G8ZA 3EHCA 3LYGA 3MG1A 3QRDA 1LNHA 1RKYA 3JUPA 3NQYA 3B7CA 1IVXA 2M7OA 3U1WA 2OCTA 4FMBA 1TFOA 3JUQA 5IG5A 1OHSA 3LTCA 1DVDA 5KP3A 3FG1A 3F8XA 1A2KA 3SLUA 2OWPA 1QVF2 3G0KA 3V98A 5BXQA 1VQ83 1W6YA 1HU9A 1VQM3 3CU3A 1EG9B 1Q40B 3LOYA 1SQWA 5CK6A 3N8BA 3FKAA 3FF2A 1LOXA 2XFSA 3NV0B 3EN1B 3X3XA 3IPTA 1GD3A 5CLKA 5FW5A 3S27A 1JN5B 3NBBA 3GZXB 2XSOB 1A2VA 1U8CB 3NX0A 2OQEA 6STDA 1UI8A 4K90B 4WFOA 5AIGA 3FG4A 1N8R4 1R4CA 4LMIA 1W6CA 1OGXA 1N9EA 2W04A 2GU1A 3T8NA 4O2HA 2WGQA 2LYXA 3H3HA 3KZTA 3T8UA 3CCV3 5EVHA 1STFI 2E2UA 2W9PA 5D83A 3KN4A 2L4VA 4HM8B 2RCDA 2XFTA 3Q2PA 2MC8A 1DMMA 1IDPA 4N3VA 3J7Yd 3CC23 1ASKA 1NU3A 2XR8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7P B;  3KSP A;  1BUQ A;  2F99 A;  1OHP A;  1ZO2 A;  4WYK A;  4XBY A;  5AIF A;  4HM6 B;  2HMJ B;  3OWY A;  2XRX B;  3CPO A;  2BMR B;  1O7G B;  3OX9 A;  2STD A;  3MG3 A;  5STD A;  3CNX A;  3MG2 A;  4HJL B;  3HZP A;  2BMO B;  1E97 A;  3DM8 A;  4U13 A;  3OWS A;  4XDW A;  3H51 A;  1NDO B;  2F86 B;  1OCV A;  3EBT A;  3SED A;  3GWR A;  3A76 A;  1OPY A;  3UJM A;  2Z76 A;  1NWW A;  1OHO A;  5KP4 A;  4XM4 A;  2HMK B;  4HM5 B;  3RGR A;  1C7H A;  1DMN A;  1TP6 A;  5IG3 A;  2RGQ A;  3ROB A;  1OGZ A;  1W02 A;  4J9A A;  4MJD A;  2XSH B;  4HM0 B;  3FLJ A;  4WYK B;  1Q42 A;  5D82 A;  4OUQ A;  4X2O A;  5CF1 A;  4FCJ A;  3B4P A;  3UNL A;  1GY5 A;  4HZ9 B;  3EF8 A;  4L8P A;  5HGR A;  2GBW B;  1VZZ A;  3DMC A;  4X2H A;  8CHO A;  1OF5 A;  3G16 A;  1QMA A;  2QGU A;  1O7W B;  4XBT A;  3SOY A;  4HM1 B;  5IG0 A;  5JPU A;  1HKX A;  5IEO A;  5JPP A;  1CQS A;  3JUO A;  3F14 A;  2YFJ B;  4HZB B;  4R9K A;  2RFR A;  1W00 A;  3LZA A;  2R4I A;  2BMQ B;  2HMN B;  1QJG A;  4R1K A;  3K0Z A;  4WP5 A;  5DRV A;  3GRD A;  3STD A;  7STD A;  2CHC A;  3DUK A;  1GY6 A;  1OH0 A;  1O7M B;  2B1X B;  5IEN A;  1ULJ B;  2HMO B;  1JB5 A;  4I4K A;  4HM2 B;  3FGY A;  3OXA A;  3NM2 A;  3VGN A;  2GXF A;  3MKI A;  3FH1 A;  2GEY A;  1O7H B;  4XB5 A;  1S5A A;  4L8O A;  5G2G A;  3GZB A;  1OF5 B;  1ULI B;  5TGN A;  1OUN A;  3MHE A;  3BB9 A;  2UX0 A;  3GZY B;  2YFL B;  4K1U A;  3GZR A;  4KVH A;  3DXO A;  2A15 A;  3I0Y A;  2YFI B;  3NHX A;  3M8C A;  3KE7 A;  1ISK A;  3VSY A;  3EBY A;  1WQL B;  5KP1 A;  5IF6 A;  4XDV A;  1GS3 A;  1GY7 A;  4L7K A;  1K41 A;  4RZM A;  3F7S A;  3SOA A;  4ORL A;  3B8L A;  5CF2 A;  4WWU C;  2CKF B;  3JUN A;  1UUV B;  1STD A;  1GYB A;  2Z7A A;  4K1V A;  5AEW B;  2HMM B;  2I9W A;  1ZX2 A;  3KKG A;  2PZV A;  3NXJ A;  4HVN A;  1JKG B;  2BNG A;  5CXO A;  2JQ5 A;  2INX A;  3EQQ B;  3Q90 A;  5AIH A;  4LGQ A;  4XBX A;  4FCM A;  1O7N B;  1UUW B;  3D9R A;  3JUM A;  3MYT A;  1TUH A;  3DZL A;  1JB4 A;  5IG4 A;  5AII A;  4LEH A;  5IER A;  3FSD A;  3NBR A;  2F98 A;  2B24 B;  4CDL A;  3RGA A;  4STD A;  3NUV A;  4J8T A;  3ECF A;  2W2C A;  5IEP A;  3E99 A;  3HK4 A;  3S5C A;  3OV4 A;  1SJW A;  1E3R A;  1E3V A;  3FF0 A;  4GB5 A;  3ER7 A;  4HM4 B;  5D81 A;  5AI1 A;  4PEJ A;  3EJV A;  2K54 A;  1W01 A;  1Q40 A;  3WMD A;  2Z77 A;  4Q53 A;  2GBX B;  3NV0 A;  3FZW A;  1JKG A;  2IMJ A;  1JN5 A;  3F9S A;  5DRE A;  3F8H A;  3HX8 A;  1Z1S A;  3BLZ A;  1EA2 A;  4HM3 B;  3MSO A;  4OVM A;  4IIA A;  5AEU B;  1JB2 A;  2GEX A;  2HML B;  4HKV B;  3CNM A;  1AR0 A;  1DMQ A;  3OWU A;  5BVB A;  4H3U A;  3EC9 A;  3F40 A;  3K7C A;  2QIY A;  3F7X A;  4HM7 B;  3B4O A;  4R9L A;  1U5O A;  3EN8 A;  3EX9 A;  3G8Z A;  3EHC A;  3LYG A;  3MG1 A;  3JUP A;  3B7C A;  3JUQ A;  5IG5 A;  1OHS A;  5KP3 A;  3F8X A;  1A2K A;  2OWP A;  3G0K A;  5BXQ A;  1W6Y A;  3CU3 A;  1EG9 B;  1Q40 B;  5CK6 A;  3FKA A;  3FF2 A;  3NV0 B;  3EN1 B;  3IPT A;  5CLK A;  5FW5 A;  1JN5 B;  3GZX B;  2XSO B;  6STD A;  5AIG A;  4LMI A;  1OGX A;  3T8N A;  3T8U A;  3H3H A;  3KZT A;  5EVH A;  5D83 A;  4HM8 B;  2RCD A;  1DMM A;  1IDP A;  4N3V A;  1ASK A;  1NU3 A;  2XR8 B; 
#chains in the Genus database with same CATH topology
 1Q9E A;  1BRS A;  1O7P B;  2AAE A;  1WMO A;  3CC4 3;  3KSE D;  1JBR A;  3KSP A;  3PS8 A;  1N9J A;  1BNF A;  5G1K A;  1BUQ A;  2F99 A;  1W5Z A;  1X1X A;  2OOV C;  1M1K 4;  3PGB A;  1OHP A;  3OW2 2;  1ZO2 A;  4BL2 A;  2ML6 A;  2W9Q A;  4WYK A;  1YHQ 3;  3G71 3;  3EB8 A;  4XBY A;  2BU4 A;  2UGI A;  5AIF A;  4FR9 A;  5I97 A;  1YIT 3;  3PCR A;  1I3F A;  3DGO A;  4HM6 B;  1I2G A;  2HMJ B;  1RCL A;  3OWY A;  1IQY A;  1MWS A;  2XRX B;  3CPO A;  1BSE A;  2CFK A;  2BMR B;  3G4S 3;  1O7G B;  1QAL A;  4KFD A;  4MMX B;  3X3Z A;  5LC6 A;  4N6U A;  3TDG A;  3OX9 A;  2STD A;  1UW1 A;  1GMQ A;  3MG3 A;  2XH9 A;  5STD A;  4EYC A;  4EV2 A;  3DGN A;  3CNX A;  1R4Y A;  1RNB A;  1D6Z A;  1UCL A;  3BNB A;  3MG2 A;  3N54 B;  1YIJ 3;  1NJI 4;  4HJL B;  3HZP A;  2BMO B;  3FCS B;  1E97 A;  2GU3 A;  4CJN A;  3DM8 A;  4U13 A;  2IA7 A;  2K3D A;  2RBI A;  2CC3 A;  3CMA 3;  1TIJ A;  1WMN A;  3OWS A;  1T5Y A;  3RNT A;  1MNL A;  4XDW A;  3SYU A;  1B20 A;  3H51 A;  1NDO B;  2F86 B;  4FMD A;  1OCV A;  1CYV A;  3URP A;  3EBT A;  2KRT A;  3SED A;  2BT3 A;  5HOH A;  1RJO A;  3GWR A;  3VF1 A;  1QVG 2;  3A76 A;  1OPY A;  2P0X A;  1KD1 4;  4AKY A;  3UJM A;  1V57 A;  3DY5 A;  1AQZ A;  2Z76 A;  1NWW A;  1OHO A;  5KP4 A;  2CFG A;  4ZM8 A;  4XM4 A;  1TRQ A;  2HMK B;  1W4N A;  1K9M 4;  1VQ4 3;  4BTX A;  2KF4 A;  4NPB A;  1ZS7 A;  1BU4 A;  1V74 A;  4HM5 B;  4GHO A;  1RDS A;  3RGR A;  2ZDJ A;  5AYR B;  1BUJ A;  1C7H A;  4FMA A;  1DMN A;  1FUT A;  1TP6 A;  1D6Y A;  5LC7 A;  5BIR A;  5IG3 A;  2RGQ A;  3SXX A;  3X42 A;  3ROB A;  1OGZ A;  1N8Q A;  2ZL8 A;  3CME 3;  1W02 A;  2P0M A;  1GMP A;  4J9A A;  1CYU A;  4MJD A;  1DE3 A;  1BRI A;  4EBG A;  2XSH B;  2CH9 A;  2IY2 A;  3S67 A;  1Y4K A;  4HM0 B;  1N5H A;  3Q3F A;  3FLJ A;  4WYK B;  3X40 A;  2C11 A;  4HBR A;  3WOD G;  7RNT A;  1Q42 A;  5ELU A;  3GAX A;  3AMO B;  4N6T A;  4OUQ A;  5D82 A;  1I8V A;  2Q07 A;  1LQG C;  1WMP A;  3K9M C;  4X2O A;  1D6U A;  3PZW A;  1I70 A;  5CF1 A;  4KZ1 A;  1M90 4;  4FCJ A;  1BIR A;  1B2X A;  3B4P A;  4K61 A;  1Q81 4;  3UNL A;  3ZG5 A;  1GY5 A;  1I0X A;  4HZ9 B;  1UI7 A;  3LXU X;  3EF8 A;  3WOE B;  4ILF A;  4L8P A;  3N9H A;  5HGR A;  2GBW B;  3X41 A;  1RGK A;  1YGW A;  1UGH I;  2CFW A;  1RGC A;  5EEO A;  1A67 A;  3KII A;  4NHF A;  1VZZ A;  1YVS A;  3DMC A;  4X2H A;  2XGN A;  3V92 A;  1FW7 A;  1A90 A;  1I3I A;  8CHO A;  1WNH A;  1RLS A;  1IU7 A;  1OF5 A;  3G16 A;  1W2B 2;  3CXC 2;  4RNT A;  1NB5 I;  2XEP A;  4EC6 A;  1YNV X;  1BNS A;  1IVU A;  1W2Z A;  3ZG0 A;  3HII A;  1VQL 3;  1QMA A;  1ZGX A;  2QGU A;  1TJD A;  1O7W B;  3IJE B;  1IV9 A;  2CX1 A;  3NQZ A;  4XBT A;  3G6E 3;  4CCV A;  1TFK A;  2H0G A;  3MPH A;  4O3V A;  4AKZ A;  2FXT A;  4DKI A;  2E2T A;  4BU4 A;  3WDG B;  1RNT A;  4RBN A;  3CCL 3;  2OTJ 3;  3SOY A;  4HM1 B;  1RGA A;  1MOL A;  1PFP A;  5IG0 A;  1ROV A;  3CCQ 3;  3EE1 A;  5JPU A;  1JJ2 2;  1FGT A;  1HKX A;  1B3S A;  3V99 A;  1S72 3;  5IEO A;  1SII A;  1CQS A;  3NM7 A;  5JPP A;  3JUO A;  3SX1 A;  3F14 A;  3U97 A;  3BIR A;  2YFJ B;  3LH4 A;  4IT7 A;  4HZB B;  1NO3 A;  1FGM A;  4TX4 A;  1FZU A;  4R9K A;  1RMS A;  2RFR A;  1VQN 3;  1W00 A;  1YGE A;  3BND A;  3LZA A;  1FA3 A;  2R4I A;  3KFQ C;  1TU5 A;  3FG3 A;  2BMQ B;  3GSP A;  2HMN B;  3PXM A;  1QJG A;  1I2F A;  3K0Z A;  4R1K A;  1VQP 3;  1SIH A;  1X1W A;  4R80 A;  2SBL A;  4HOH A;  4WP5 A;  1VQ5 3;  5DRV A;  3GRD A;  3STD A;  1IQ8 A;  1M9G A;  3AMO A;  2CHC A;  7STD A;  2PNC A;  3AHS A;  2W6J H;  3DUK A;  1K73 4;  1F8N A;  1RRH A;  1RGL A;  1GY6 A;  1JZD A;  2D1W A;  3LTA A;  1OH0 A;  3L0R A;  1VQK 3;  1O7M B;  2B1X B;  5IEN A;  1YI2 3;  1BAN A;  1EUI C;  1ULJ B;  2HMO B;  1ROA A;  2XGL A;  1JB5 A;  4EXR A;  3CD6 3;  4I4K A;  4QWT A;  1AV4 A;  4HM2 B;  1K8A 4;  1VQ6 3;  1FGQ A;  2JDI H;  1A2P A;  1WTH A;  3FGY A;  3OXA A;  1QAK A;  4EV5 A;  1MGW A;  3NM2 A;  3VGN A;  1DVC A;  1PY3 A;  1KC8 4;  2CG1 A;  2GXF A;  1GMR A;  3MKI A;  3FH1 A;  2GEY A;  1O7H B;  4J5K A;  4XB5 A;  1BRH A;  6RNT A;  3AHW A;  1S5A A;  1TRP A;  4L8O A;  1KSI A;  2WO0 A;  5G2G A;  3GZB A;  3DGL A;  1OF5 B;  3A5E A;  1BSC A;  2CWT A;  3S29 A;  1GSP A;  1BNJ A;  1G96 A;  1ULI B;  5TGN A;  2J8X B;  3I56 3;  2P38 A;  1HZ1 A;  1FGR A;  1OUN A;  3ALA A;  4KT3 B;  3CC7 3;  3MHE A;  3BB9 A;  3LML A;  5JBS A;  2UX0 A;  1BGS A;  3PYJ A;  3GZY B;  2YFL B;  4K1U A;  3GZR A;  3KCH A;  1VQ7 3;  1W6G A;  1GD4 A;  4LYL B;  4N6O B;  2O9U X;  3DXO A;  2KXG A;  2A15 A;  4KVH A;  3I0Y A;  2YFI B;  2OQE C;  1B27 A;  2KF6 A;  3NHX A;  2FGT A;  5EQL A;  3M8C A;  2W03 A;  2CG0 A;  1KQS 2;  1B2M A;  4HYZ A;  3KE7 A;  1ISK A;  1VQM 3;  3VSY A;  4JF8 A;  1NB3 I;  4FCZ A;  3EBY A;  1X1U A;  1T2I A;  2OOV A;  1GOV A;  3LT9 A;  1OAC A;  1WQL B;  2IUJ A;  1HYF A;  5KP1 A;  5IF6 A;  1YVB I;  2YX9 A;  4XDV A;  1GS3 A;  1AVK A;  1GY7 A;  3BU4 A;  4L7K A;  3I55 3;  1K41 A;  4RZM A;  2C10 A;  3CCM 3;  1IV7 A;  2BO9 B;  6GSP A;  2QEX 3;  4H61 A;  3HI7 A;  2FNQ A;  3QK9 A;  2BHM A;  2O3O A;  1J2B A;  3F7S A;  4RNZ A;  3SOA A;  4LSO A;  4N6N B;  2Y73 A;  1JRQ A;  2CWU A;  3CCR 3;  4LZI A;  4EW5 A;  4ORL A;  1EEJ A;  1BSB A;  3B8L A;  1C54 A;  3LT8 A;  1GOY A;  1TTO A;  5CF2 A;  1JBT A;  1CEW I;  4FMC A;  4MMZ B;  4N6V 0;  4BIR A;  3D79 A;  4WWU C;  3UL5 A;  5G1L A;  1IT8 A;  1MWR A;  4AEQ A;  2KF3 A;  2CKF B;  2Y74 A;  1DYU A;  1N5P A;  1RCK A;  3JUN A;  5M19 A;  1UUV B;  4WHA A;  1KWI A;  1STD A;  1GYB A;  1G02 A;  2Z7A A;  4G1M B;  4K1V A;  5AEW B;  2HMM B;  4BTW A;  1BNG A;  2I9W A;  2F5W A;  2GSP A;  1ZX2 A;  3KKG A;  1IQX A;  2W0Q A;  2PZV A;  1AVL A;  1RN7 A;  1LRA A;  4N6M A;  3UB1 A;  2OTL 3;  1JZO A;  2KF5 A;  2V1L A;  3NXJ A;  3RDE A;  4HVN A;  2CW9 A;  1V58 A;  2HOH A;  1QAF A;  1JKG B;  2R41 A;  5IW9 A;  1RHL A;  2BNG A;  3WA2 X;  2Z6B A;  5CXO A;  3NBJ A;  2RSX A;  2JQ5 A;  2INX A;  2MF7 A;  1LOV A;  3D5I A;  4MEI A;  2LQV A;  3EQQ B;  1EQK A;  3Q90 A;  1VQO 3;  5AIH A;  1W7C A;  4LGQ A;  3S28 A;  3UL6 A;  3CCS 3;  2D42 A;  4XBX A;  5FGO A;  2CK3 H;  4FCM A;  1O7N B;  3ZFZ A;  1BNE A;  4GL6 A;  1UUW B;  2UUG C;  1X1Y A;  2WGO A;  3O8Y A;  3D9R A;  1BSA A;  3JUM A;  3MYT A;  5ELJ A;  1TUH A;  3D4A A;  1YJW 3;  1BSD A;  2L1S A;  3DZL A;  3CCJ 3;  1JB4 A;  1EKM A;  5IG4 A;  5AII A;  1G0T A;  3CCU 3;  2BIR A;  4LEH A;  5IER A;  1SAR A;  3FSD A;  3NBR A;  4MMY B;  2W56 A;  4O8S A;  2F98 A;  2B24 B;  4CDL A;  2P05 A;  3RGA A;  2RNT A;  2IUK A;  3BNC A;  3LTD A;  4STD A;  3MWZ A;  3NUV A;  3DH2 A;  4J8T A;  3ECF A;  4BTY A;  3X3Y A;  4N6L A;  2CWV A;  2W2C A;  3Q1C A;  2F4Y A;  5BU4 A;  3WR2 A;  1MWU A;  5IEP A;  3E99 A;  3HK4 A;  3S5C A;  1ASK A;  3OV4 A;  1LVN A;  1SJW A;  3D5G A;  1E3R A;  1E3V A;  3FF0 A;  1US1 A;  3WA3 A;  1Q86 4;  4GB5 A;  4JRF A;  1YJ9 3;  1I0V A;  1IVV A;  3ER7 A;  2AAD A;  1JNQ A;  4HM4 B;  4NRE A;  5D81 A;  5AI1 A;  1B2S A;  5M18 A;  4KFE A;  1RN1 A;  1FGO A;  1JBS A;  4PEJ A;  1RGH A;  2SAR A;  3EJV A;  3K5T A;  1IT7 A;  1T2H A;  2K54 A;  1W01 A;  1Q40 A;  3DGY A;  2F5M A;  3WMD A;  1FUW A;  2CX0 A;  3DGM A;  2Z77 A;  4Q53 A;  1M1X B;  2GBX B;  3NV0 A;  1CH0 A;  1BVI A;  1UDI I;  3FZW A;  1FYS A;  1JKG A;  3T0U A;  3PCS A;  1FUS A;  4R4K A;  1IVW A;  1IYY A;  2IMJ A;  1JN5 A;  3F9S A;  1YJN 3;  5A0O B;  3K63 A;  5DRE A;  2CFL A;  3F8H A;  4GSP A;  4RNY A;  5AYS C;  3HX8 A;  2QA4 3;  2E2V A;  1Z1S A;  3BLZ A;  1EA2 A;  2CIU A;  4HM3 B;  2WOF A;  5M1A A;  2P09 A;  3MSO A;  3IMA B;  1T3B A;  4IIA A;  4OVM A;  1PU4 A;  1LOY A;  1RN4 A;  3CCE 3;  3JVC A;  5AEU B;  1JB2 A;  4IPB A;  3CPW 2;  1K28 A;  2GEX A;  2HML B;  1SPU A;  1Q82 4;  2KCD A;  4HKV B;  3BNE A;  1B21 A;  3CNM A;  4CPK A;  1AR0 A;  1B2U A;  1BNI A;  1DMQ A;  3OWU A;  5BVB A;  2XF3 A;  4O02 B;  2ML5 A;  4H3U A;  1RGF A;  9RNT A;  2WOH A;  1MWT A;  4KFF A;  1Q7H A;  2H0H A;  2K0M A;  1RRL A;  3EC9 A;  3F40 A;  1L5G B;  3SVA A;  3HIG A;  3LTB A;  3WOF B;  3K7C A;  2QIY A;  3WHO A;  1UUG B;  1UGI A;  1DET A;  1Q7Y 4;  1VQ9 3;  2W56 B;  5RNT A;  4HAA A;  3F7X A;  4HM7 B;  1UCK A;  4OK0 A;  3D3L A;  3B4O A;  2CFD A;  1RGG A;  1JV2 B;  4R9L A;  1B2Z A;  1U5O A;  1IK3 A;  3EN8 A;  3EX9 A;  1MGR A;  4J5G A;  3G8Z A;  3EHC A;  3LYG A;  3MG1 A;  3QRD A;  1LNH A;  8RNT A;  4I5Q A;  1RKY A;  2F56 A;  3JUP A;  1BAO A;  3HOH A;  1AY7 A;  3NQY A;  2IYJ A;  3B7C A;  1IVX A;  2M7O A;  3U1W A;  2OCT A;  2H0I A;  4FMB A;  1TFO A;  3JUQ A;  1LNI A;  5IG5 A;  1OHS A;  3LTC A;  1DVD A;  5KP3 A;  3FG1 A;  3F8X A;  1A2K A;  3SLU A;  2OWP A;  1QVF 2;  2ZHX B;  3G0K A;  3V98 A;  1BOX A;  5BXQ A;  1VQ8 3;  1W6Y A;  1HU9 A;  1BRJ A;  2ZA4 A;  3AGN A;  1EG9 B;  1BRK A;  1Q40 B;  1SQW A;  3AGO A;  3CU3 A;  3FKA A;  3FF2 A;  3LOY A;  1LOX A;  2XFS A;  3N8B A;  5CK6 A;  1BNR A;  7GSP A;  3NV0 B;  3EN1 B;  1I2E A;  1VQQ A;  3X3X A;  5GSP A;  3IPT A;  1LOW A;  1GD3 A;  5CLK A;  5FW5 A;  1UCI A;  3S27 A;  1JN5 B;  3NBB A;  3GZX B;  4BL3 A;  1LQM B;  2C4B A;  2XSO B;  1A2V A;  1U8C B;  1UCJ A;  3NX0 A;  2OQE A;  6STD A;  1UI8 A;  1RTU A;  4K90 B;  4WFO A;  5AIG A;  2KAA A;  1NNV A;  3FG4 A;  1N8R 4;  1GOU A;  1R4C A;  4LMI A;  1RSN A;  1OGX A;  1W6C A;  1N9E A;  2W04 A;  2GU1 A;  3T8N A;  4O2H A;  2WGQ A;  2LYX A;  3H3H A;  3KZT A;  3T8U A;  3CCV 3;  5EVH A;  1STF I;  2E2U A;  2W9P A;  5D83 A;  1PYL A;  3KN4 A;  2L4V A;  1RGE A;  2RCD A;  2XFT A;  4HM8 B;  3Q2P A;  1BRN L;  2MC8 A;  1DMM A;  1IDP A;  1BRG A;  4N3V A;  3J7Y d;  3CC2 3;  1LXE A;  1NU3 A;  2XR8 B; 
#chains in the Genus database with same CATH homology
 1O7P B;  1WMO A;  3CC4 3;  3KSE D;  3KSP A;  3PS8 A;  1N9J A;  1BUQ A;  2F99 A;  1W5Z A;  2OOV C;  1M1K 4;  3PGB A;  1OHP A;  3OW2 2;  1ZO2 A;  2ML6 A;  2W9Q A;  4WYK A;  1YHQ 3;  3G71 3;  3EB8 A;  4XBY A;  5AIF A;  4FR9 A;  5I97 A;  1YIT 3;  3PCR A;  3DGO A;  4HM6 B;  2HMJ B;  3OWY A;  1IQY A;  2XRX B;  3CPO A;  2CFK A;  2BMR B;  3G4S 3;  1O7G B;  1QAL A;  4KFD A;  4MMX B;  3X3Z A;  5LC6 A;  4N6U A;  3TDG A;  3OX9 A;  2STD A;  1UW1 A;  3MG3 A;  5STD A;  2XH9 A;  4EYC A;  4EV2 A;  3DGN A;  3CNX A;  1D6Z A;  3N54 B;  3BNB A;  3MG2 A;  1YIJ 3;  1NJI 4;  4HJL B;  3HZP A;  2BMO B;  3FCS B;  1E97 A;  2GU3 A;  3DM8 A;  4U13 A;  2IA7 A;  2CC3 A;  3CMA 3;  1TIJ A;  1WMN A;  3OWS A;  1T5Y A;  1MNL A;  4XDW A;  3H51 A;  1NDO B;  2F86 B;  4FMD A;  1OCV A;  1CYV A;  3EBT A;  2KRT A;  3SED A;  2BT3 A;  1RJO A;  3GWR A;  3VF1 A;  1QVG 2;  3A76 A;  1OPY A;  2P0X A;  1KD1 4;  4AKY A;  3UJM A;  3DY5 A;  2Z76 A;  1NWW A;  1OHO A;  5KP4 A;  2CFG A;  4ZM8 A;  4XM4 A;  2HMK B;  1W4N A;  1K9M 4;  1VQ4 3;  4BTX A;  1V74 A;  4HM5 B;  3RGR A;  2ZDJ A;  5AYR B;  1C7H A;  4FMA A;  1DMN A;  1TP6 A;  1D6Y A;  5LC7 A;  5IG3 A;  2RGQ A;  3SXX A;  3X42 A;  3ROB A;  1OGZ A;  1N8Q A;  2ZL8 A;  3CME 3;  1W02 A;  2P0M A;  4J9A A;  1CYU A;  4MJD A;  4EBG A;  2XSH B;  2CH9 A;  3S67 A;  1Y4K A;  4HM0 B;  1N5H A;  3FLJ A;  4WYK B;  3X40 A;  2C11 A;  4HBR A;  3WOD G;  1Q42 A;  5ELU A;  3GAX A;  3AMO B;  4N6T A;  4OUQ A;  5D82 A;  2Q07 A;  4X2O A;  1WMP A;  3K9M C;  1D6U A;  3PZW A;  5CF1 A;  4KZ1 A;  1M90 4;  4FCJ A;  3B4P A;  4K61 A;  1Q81 4;  3UNL A;  1GY5 A;  4HZ9 B;  1UI7 A;  3LXU X;  3EF8 A;  3WOE B;  4L8P A;  3N9H A;  5HGR A;  2GBW B;  3X41 A;  2CFW A;  5EEO A;  1A67 A;  3KII A;  4NHF A;  1VZZ A;  3DMC A;  4X2H A;  2XGN A;  3V92 A;  1A90 A;  8CHO A;  1WNH A;  1IU7 A;  1OF5 A;  3G16 A;  1W2B 2;  1LXE A;  3CXC 2;  2XEP A;  4EC6 A;  1IVU A;  1W2Z A;  3HII A;  1VQL 3;  1QMA A;  2QGU A;  3IJE B;  1O7W B;  1IV9 A;  3NQZ A;  4XBT A;  3G6E 3;  4CCV A;  1TFK A;  3MPH A;  4O3V A;  4AKZ A;  2FXT A;  2E2T A;  3WDG B;  4RBN A;  3CCL 3;  2OTJ 3;  3SOY A;  4HM1 B;  5IG0 A;  1MOL A;  1PFP A;  1ROV A;  3CCQ 3;  3EE1 A;  5JPU A;  1JJ2 2;  1FGT A;  1HKX A;  1S72 3;  3V99 A;  5IEO A;  1SII A;  1CQS A;  3NM7 A;  5JPP A;  3JUO A;  3SX1 A;  3F14 A;  3U97 A;  2YFJ B;  3LH4 A;  4IT7 A;  4HZB B;  1NO3 A;  1FGM A;  4TX4 A;  4R9K A;  1VQN 3;  2RFR A;  1W00 A;  1YGE A;  3BND A;  3LZA A;  1FA3 A;  2R4I A;  3KFQ C;  1TU5 A;  3FG3 A;  2BMQ B;  1VQP 3;  2HMN B;  3PXM A;  1QJG A;  4R1K A;  3K0Z A;  1NB5 I;  1SIH A;  4R80 A;  2SBL A;  4WP5 A;  1VQ5 3;  5DRV A;  3GRD A;  3STD A;  1IQ8 A;  3AMO A;  1M9G A;  2CHC A;  7STD A;  2PNC A;  2W6J H;  3DUK A;  1K73 4;  1F8N A;  1RRH A;  1GY6 A;  2D1W A;  3LTA A;  1OH0 A;  3L0R A;  1VQK 3;  1O7M B;  2B1X B;  5IEN A;  1YI2 3;  1ULJ B;  2HMO B;  1ROA A;  2XGL A;  1JB5 A;  4EXR A;  3CD6 3;  4I4K A;  4QWT A;  1AV4 A;  4HM2 B;  1K8A 4;  1VQ6 3;  1FGQ A;  2JDI H;  1WTH A;  3FGY A;  3OXA A;  1QAK A;  4EV5 A;  3NM2 A;  3VGN A;  1DVC A;  1KC8 4;  2CG1 A;  2GXF A;  3MKI A;  3FH1 A;  2GEY A;  1O7H B;  4XB5 A;  1S5A A;  4L8O A;  1KSI A;  2WO0 A;  5G2G A;  3GZB A;  3DGL A;  1OF5 B;  2CWT A;  3S29 A;  1G96 A;  1ULI B;  5TGN A;  3I56 3;  2P38 A;  1FGR A;  1OUN A;  3ALA A;  3CC7 3;  3MHE A;  3BB9 A;  3LML A;  5JBS A;  2UX0 A;  3PYJ A;  3GZY B;  2YFL B;  4K1U A;  3GZR A;  1VQ7 3;  1W6G A;  1GD4 A;  4N6O B;  2O9U X;  3DXO A;  2KXG A;  2A15 A;  4KVH A;  3I0Y A;  2YFI B;  2OQE C;  3NHX A;  2FGT A;  5EQL A;  3M8C A;  2W03 A;  2CG0 A;  1KQS 2;  4HYZ A;  3KE7 A;  1ISK A;  3VSY A;  4JF8 A;  1NB3 I;  4FCZ A;  3EBY A;  2OOV A;  3LT9 A;  1OAC A;  1WQL B;  2IUJ A;  5KP1 A;  5IF6 A;  1YVB I;  2YX9 A;  4XDV A;  1GS3 A;  1AVK A;  1GY7 A;  4L7K A;  3I55 3;  1K41 A;  4RZM A;  2C10 A;  3CCM 3;  1IV7 A;  2BO9 B;  2QEX 3;  4H61 A;  3HI7 A;  2FNQ A;  3QK9 A;  2BHM A;  2O3O A;  1J2B A;  3F7S A;  4RNZ A;  3SOA A;  4LSO A;  4N6N B;  2Y73 A;  1JRQ A;  2CWU A;  3CCR 3;  4LZI A;  4ORL A;  3B8L A;  3LT8 A;  5CF2 A;  1CEW I;  4FMC A;  4MMZ B;  4N6V 0;  4WWU C;  3UL5 A;  1IT8 A;  4AEQ A;  2CKF B;  2Y74 A;  1DYU A;  1N5P A;  3JUN A;  1UUV B;  4WHA A;  1KWI A;  1STD A;  1GYB A;  4G1M B;  2Z7A A;  4K1V A;  5AEW B;  2HMM B;  4BTW A;  2I9W A;  1ZX2 A;  3KKG A;  1IQX A;  2W0Q A;  2PZV A;  1AVL A;  1RN7 A;  4N6M A;  3UB1 A;  2OTL 3;  2V1L A;  3NXJ A;  3RDE A;  4HVN A;  2CW9 A;  1QAF A;  1JKG B;  5IW9 A;  3WA2 X;  2BNG A;  2Z6B A;  5CXO A;  3NBJ A;  2RSX A;  2JQ5 A;  2INX A;  2MF7 A;  4MEI A;  1EQK A;  2LQV A;  3EQQ B;  3Q90 A;  1VQO 3;  5AIH A;  1W7C A;  4LGQ A;  3S28 A;  3UL6 A;  3CCS 3;  2D42 A;  4XBX A;  5FGO A;  2CK3 H;  4FCM A;  1O7N B;  4GL6 A;  1UUW B;  2WGO A;  3O8Y A;  3D9R A;  3JUM A;  3MYT A;  5ELJ A;  1TUH A;  1YJW 3;  3CCJ 3;  3DZL A;  1JB4 A;  1EKM A;  5IG4 A;  5AII A;  3CCU 3;  4LEH A;  5IER A;  3FSD A;  3NBR A;  4MMY B;  2W56 A;  4O8S A;  2F98 A;  2B24 B;  4CDL A;  2P05 A;  3RGA A;  2IUK A;  3BNC A;  3LTD A;  4STD A;  3MWZ A;  3NUV A;  4J8T A;  4BTY A;  3ECF A;  3X3Y A;  4N6L A;  2CWV A;  2W2C A;  3Q1C A;  5IEP A;  3E99 A;  3HK4 A;  3S5C A;  3OV4 A;  1LVN A;  1SJW A;  1E3R A;  1E3V A;  3FF0 A;  1US1 A;  3WA3 A;  1Q86 4;  4GB5 A;  4JRF A;  1YJ9 3;  1IVV A;  3ER7 A;  4NRE A;  1JNQ A;  4HM4 B;  5D81 A;  5AI1 A;  4KFE A;  1FGO A;  4PEJ A;  3EJV A;  3K5T A;  1IT7 A;  2K54 A;  1W01 A;  1Q40 A;  3WMD A;  1FUW A;  3DGM A;  2Z77 A;  4Q53 A;  2GBX B;  1M1X B;  3NV0 A;  3FZW A;  1JKG A;  3T0U A;  3PCS A;  4R4K A;  1IVW A;  2IMJ A;  1JN5 A;  3F9S A;  1YJN 3;  5A0O B;  3K63 A;  5DRE A;  2CFL A;  3F8H A;  4RNY A;  5AYS C;  3HX8 A;  2QA4 3;  2E2V A;  1Z1S A;  3BLZ A;  1EA2 A;  2CIU A;  4HM3 B;  2WOF A;  2P09 A;  3MSO A;  3IMA B;  4OVM A;  4IIA A;  3CCE 3;  1PU4 A;  3JVC A;  5AEU B;  1JB2 A;  4IPB A;  3CPW 2;  1K28 A;  2GEX A;  2HML B;  1SPU A;  1Q82 4;  2KCD A;  4HKV B;  3BNE A;  3CNM A;  1AR0 A;  1DMQ A;  3OWU A;  5BVB A;  2XF3 A;  4O02 B;  2ML5 A;  4H3U A;  2WOH A;  1L5G B;  4KFF A;  3EC9 A;  2K0M A;  1RRL A;  3F40 A;  3SVA A;  3HIG A;  3LTB A;  3WOF B;  3K7C A;  2QIY A;  1Q7Y 4;  1VQ9 3;  2W56 B;  3F7X A;  4HM7 B;  4OK0 A;  3D3L A;  3B4O A;  2CFD A;  1JV2 B;  4R9L A;  1U5O A;  1IK3 A;  3EN8 A;  3EX9 A;  3G8Z A;  3EHC A;  3LYG A;  3MG1 A;  3QRD A;  1LNH A;  1RKY A;  3JUP A;  3NQY A;  3B7C A;  1IVX A;  2M7O A;  3U1W A;  2OCT A;  4FMB A;  1TFO A;  3JUQ A;  5IG5 A;  1OHS A;  3LTC A;  1DVD A;  5KP3 A;  3FG1 A;  3F8X A;  1A2K A;  3SLU A;  2OWP A;  1QVF 2;  3G0K A;  3V98 A;  5BXQ A;  1VQ8 3;  1W6Y A;  1HU9 A;  1VQM 3;  3CU3 A;  1EG9 B;  1Q40 B;  3LOY A;  1SQW A;  5CK6 A;  3N8B A;  3FKA A;  3FF2 A;  1LOX A;  2XFS A;  3NV0 B;  3EN1 B;  3X3X A;  3IPT A;  1GD3 A;  5CLK A;  5FW5 A;  3S27 A;  1JN5 B;  3NBB A;  3GZX B;  2XSO B;  1A2V A;  1U8C B;  3NX0 A;  2OQE A;  6STD A;  1UI8 A;  4K90 B;  4WFO A;  5AIG A;  3FG4 A;  1N8R 4;  1R4C A;  4LMI A;  1W6C A;  1OGX A;  1N9E A;  2W04 A;  2GU1 A;  3T8N A;  4O2H A;  2WGQ A;  2LYX A;  3H3H A;  3KZT A;  3T8U A;  3CCV 3;  5EVH A;  1STF I;  2E2U A;  2W9P A;  5D83 A;  3KN4 A;  2L4V A;  4HM8 B;  2RCD A;  2XFT A;  3Q2P A;  2MC8 A;  1DMM A;  1IDP A;  4N3V A;  3J7Y d;  3CC2 3;  1ASK A;  1NU3 A;  2XR8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...