4O2HA

Crystal structure of bcam1869 protein (rsam homolog) from burkholderia cenocepacia
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
TSPLLHPVPGPSPDGYVRLSEGALAALVLDHVASGLDPSLLAELRDNAIDARLAGYTEWHRTAGAGVAYVTVGWDWYLERATGTFVIAGGDVRSNVMAIDAKGADIGMLRTAAALAARLAALDWPAAVASALLGHND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein BCAM1869
publication title RsaM: a transcriptional regulator of Burkholderia spp. with novel fold.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Structural genomics, unknown function
total genus 33
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16245 DUF4902 Domain of unknown function (DUF4902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.610 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o2hA00
4O2HA
chains in the Genus database with same CATH superfamily
1QAKA 1TIJA 1BRSA 1JN5A 1Z1SA 3ER7A 4XBYA 2WOFA 3WOFB 2CW9A 1DYUA 3DGNA 3VF1A 1STFI 1TRQA 4CDLA 1MWUA 1RGAA 5FGOA 3X3ZA 4HZ9B 5BVBA 2IMJA 4HM5B 6STDA 3MG3A 1GOVA 1B2SA 1Q40A 3M8CA 4XDVA 2B1XB 2KAAA 3UB1A 1ISKA 3SYUA 1PFPA 5GSPA 1DMNA 4EXRA 1UW1A 2HMNB 1DE3A 3MKIA 1Q9EA 1UCIA 2AAEA 2RNTA 2W0QA 2BMQB 1GSPA 1OHOA 1TFKA 1FGTA 3CPW2 4R80A 3OW22 2XR8B 4NHFA 2ML6A 3JUQA 2UX0A 1MGRA 5IENA 1OHPA 1RN1A 2E2TA 2P0XA 4L8PA 1CQSA 3U1WA 1BSDA 4EYCA 2C10A 3I563 3MHEA 1OACA 3U97A 3SEDA 1FUWA 3HZPA 2IUJA 2RBIA 1IQ8A 3BNEA 4J5GA 4QWTA 3S28A 3STDA 2BMOB 4BL3A 1FZUA 3PYJA 1BOXA 1US1A 1L5GB 2W04A 2CWVA 1HKXA 3SVAA 3EN8A 3LTBA 2CIUA 4NPBA 5AIIA 3Q90A 2GSPA 5CLKA 3F8XA 5ELJA 3JUMA 3CCR3 1VQ83 3WA3A 3A5EA 3KE7A 1YNVX 4KVHA 5RNTA 5IEOA 2OOVC 3LH4A 2CFWA 1GY5A 1NB5I 6RNTA 1B2UA 1BNSA 2GEYA 1OUNA 2HMJB 1A90A 3LTCA 3NX0A 2IY2A 5EEOA 1STDA 2F86B 4LGQA 1A2PA 3DGLA 3EQQB 1FUTA 1IVXA 3D9RA 3ALAA 4IT7A 4RNZA 2O3OA 2D42A 1B3SA 3NM2A 1NNVA 1BAOA 3JUNA 4HVNA 3OWSA 4FCZA 3SOYA 3EJVA 3JVCA 1KQS2 3F7XA 4MMZB 1E3VA 5AEWB 1DVCA 1JB4A 3CNMA 3OWUA 3CCV3 1LVNA 5IG5A 2HMMB 4WP5A 3QRDA 1JB2A 1F8NA 1QMAA 4H61A 5D81A 1BNJA 1B21A 1M904 1IT8A 1BRIA 4JF8A 4OVMA 4EC6A 2CX0A 1JRQA 4RBNA 3KSED 4K1UA 3EF8A 1Q824 3DGYA 3N54B 1BNEA 4KT3B 3NXJA 1UCKA 1X1UA 4ORLA 3V99A 1JB5A 1TU5A 1UGIA 5IG3A 5HGRA 4HM7B 1K41A 3DUKA 3DMCA 1JBTA 1AR0A 1GOYA 1O7PB 3N8BA 4KFDA 4XDWA 1T2HA 4HM1B 1PYLA 1OH0A 1OPYA 1RN7A 3LT9A 2RCDA 1SIIA 1FUSA 1ZGXA 1IQYA 1N9EA 1RGKA 2L1SA 1RDSA 2CWTA 4CJNA 1WTHA 4HBRA 2XEPA 3DZLA 1MWSA 5EQLA 1I70A 1BUJA 1BSEA 1WMPA 1I0XA 1RGHA 1S5AA 3X3YA 2BT3A 3NV0B 4AKZA 5AIFA 2XGLA 4U13A 3CC73 3SLUA 2UUGC 1I2GA 4MEIA 1IT7A 2KRTA 4L7KA 4MJDA 3FG4A 3RGAA 3DM8A 3PGBA 9RNTA 1Q864 5M1AA 3JUOA 1LOVA 2YX9A 2CHCA 2KF5A 2IYJA 3EBYA 2GEXA 2P05A 2OTJ3 4K61A 1TRPA 1TTOA 1X1WA 1GY6A 1LRAA 3NBJA 4STDA 3UL5A 1VQK3 3CNXA 1E3RA 1X1YA 4R4KA 3G6E3 3HX8A 4BTXA 3NHXA 2I9WA 5CF2A 8RNTA 3MYTA 1CYVA 4GL6A 3AMOB 1A2KA 1A2VA 3D5IA 2CWUA 3D3LA 5BXQA 1FA3A 1YHQ3 1GD3A 1JKGB 3BB9A 1LOYA 2QGUA 1R4CA 2XFTA 1HYFA 5M18A 2H0IA 1OGXA 2W56B 2Z77A 3NV0A 5KP3A 2YFIB 3EC9A 1QALA 4NREA 2JQ5A 3ZG0A 1MOLA 4PEJA 3UJMA 3KCHA 1W2B2 1K8A4 1FYSA 4FMDA 4R9KA 3BNCA 3MG1A 2F5WA 1GOUA 2Y73A 3CU3A 3ZG5A 2ZA4A 8CHOA 3X40A 4RZMA 3LZAA 2F99A 2W9PA 1X1XA 1M1XB 4N6TA 2E2UA 5AIHA 4R1KA 3G16A 3CCM3 1YVSA 1V57A 5DREA 4H3UA 1AVKA 4I4KA 2OTL3 1RTUA 1VZZA 4XM4A 3HIIA 1DETA 4CPKA 3NM7A 1RKYA 2GU3A 2XRXB 1KD14 1ZX2A 3FG1A 3IPTA 6GSPA 1N8QA 2CK3H 2F5MA 3AHSA 3PS8A 3RGRA 5IEPA 1JKGA 2QA43 1WMOA 1Y4KA 1W5ZA 3NBBA 4HM0B 3VSYA 1IQXA 1BIRA 3KFQC 4N6OB 3CCL3 4HM4B 4X2HA 2V1LA 1YJ93 2OQEA 1RNBA 3CMA3 4HOHA 1LOWA 1VQ73 1AVLA 1BRGA 1U8CB 3T0UA 1D6ZA 3DXOA 1K734 1KWIA 1VQQA 1GMQA 1OCVA 1IV9A 2BIRA 3G713 1G02A 4LZIA 2QIYA 3V92A 3T8NA 1LNHA 2CFLA 3FSDA 1C7HA 3DY5A 2W2CA 1SQWA 4TX4A 4RNTA 3RNTA 1QAFA 4GB5A 3G8ZA 1WMNA 2HMLB 4WHAA 1V58A 2GXFA 3G4S3 1CEWI 3K9MC 3CCQ3 1E97A 3WODG 5BIRA 2KCDA 3LOYA 1W6YA 1RGEA 1YJW3 4Q53A 4FR9A 3QK9A 1M1K4 1HU9A 3EBTA 2K0MA 3LYGA 4EW5A 4BIRA 3FGYA 3MPHA 4R9LA 2GBXB 2BNGA 1T3BA 1RJOA 1W02A 2K54A 1AV4A 3Q1CA 3WA2X 2CG1A 2FXTA 4I5QA 2HOHA 2RSXA 3F7SA 3IJEB 3UNLA 5D82A 2WO0A 1EUIC 3G0KA 2SARA 1EQKA 2STDA 5CXOA 1LQMB 1ROVA 1BGSA 2KF4A 1I0VA 4X2OA 2F4YA 7RNTA 4WYKB 3K63A 5IG0A 4GSPA 3S27A 1GYBA 4O3VA 1UUWB 2LYXA 1YJN3 3BU4A 1MNLA 3NQYA 1IK3A 4EBGA 1IVUA 2R41A 1QVG2 1J2BA 2OCTA 3SOAA 1BU4A 1EKMA 3HK4A 1W01A 1NJI4 1CYUA 5IF6A 1BSBA 4BL2A 2P09A 2INXA 1BRHA 3CXC2 5KP1A 3LT8A 3OWYA 3Q2PA 3KN4A 2LQVA 3HOHA 3IMAB 1NO3A 3EHCA 1BVIA 1LXEA 2Y74A 1IVVA 1Q42A 1JNQA 4MMYB 2BU4A 2XH9A 3I0YA 4WYKA 1RCKA 3S5CA 3V98A 1TUHA 1BRKA 3JUPA 3N9HA 4K1VA 4EV5A 1YIJ3 1VQ53 1RGFA 5IG4A 1ROAA 3GZRA 1TJDA 3HIGA 4XB5A 3F8HA 4HM3B 1BNFA 4N6LA 1AQZA 3X42A 3BNDA 1W4NA 1RNTA 4LSOA 4AKYA 4ZM8A 3EX9A 2Z6BA 3B4PA 2M7OA 2F56A 4HM8B 4L8OA 1SARA 1O7HB 1B2MA 3EE1A 4O2HA 5TGNA 2SBLA 3FCSB 5LC7A 3GWRA 2YFLB 4CCVA 4WWUC 3CME3 1FGOA 3NQZA 2XSOB 2XFSA 2IUKA 2L4VA 3PCSA 1Q40B 1D6YA 1PY3A 2CFKA 2Z76A 1GMRA 4FCJA 3ROBA 2CH9A 2HMOB 3O8YA 2E2VA 3X3XA 1MWRA 4OK0A 5IERA 3FZWA 4GHOA 1FGRA 2CFGA 3WR2A 3NUVA 1W00A 1WNHA 1UUVB 5DRVA 4IIAA 1G0TA 1EEJA 2ML5A 2CFDA 5JPUA 3BNBA 1JBSA 1BRJA 2F98A 3AGOA 2WOHA 1RMSA 1ULJB 1JV2B 1UGHI 2Z7AA 3B8LA 2K3DA 3FH1A 3LMLA 3OX9A 3VGNA 4BTWA 1DMMA 1N8R4 1T5YA 1RGGA 1RCLA 1UI8A 3F14A 2P38A 4KFFA 4OUQA 2C11A 3AMOA 3FG3A 5JBSA 1O7GB 3KSPA 1UCJA 1UCLA 2WGQA 1KC84 5G1KA 2KXGA 4G1MB 1SJWA 1BNIA 2R4IA 1V74A 1BUQA 4RNYA 3OXAA 2W56A 3GZBA 3ECFA 1TFOA 2AADA 2CX1A 1B20A 1CH0A 2H0HA 3K5TA 1ZO2A 3EB8A 1SPUA 4HYZA 4N3VA 4O02B 3T8UA 5AEUB 5CF1A 1I3IA 1YI23 3KZTA 5I97A 4N6NB 4BU4A 1A67A 2OWPA 1S723 2WGOA 2XGNA 2ZDJA 1IV7A 1W2ZA 2GBWB 1RHLA 3LTDA 2OOVA 1VQ63 4HKVB 3D79A 2HMKB 4FMBA 1N5HA 1ASKA 1PU4A 2KF3A 1BANA 3WMDA 5A0OB 1B27A 1O7WB 4LEHA 1RLSA 1FGMA 3E99A 4XBTA 3BIRA 1WQLB 1YGEA 3CCS3 1KSIA 3Q3FA 1NWWA 3WHOA 4HJLB 2ZL8A 5AYRB 2XF3A 1W6CA 2OQEC 5HOHA 3SX1A 2CKFB 1W7CA 2RGQA 4FMCA 3I553 3GZXB 1QVF2 3D5GA 2B24B 1BSCA 1Q7Y4 1ZS7A 2KF6A 1OGZA 5AYSC 3CCE3 3KKGA 1NB3I 3SXXA 4EV2A 2D1WA 1HZ1A 3DH2A 3WDGB 2W03A 3GRDA 2P0MA 3H51A 5KP4A 1LNIA 4LMIA 4LYLB 2A15A 1BNRA 2ZHXB 2W9QA 1IVWA 2J8XB 3BLZA 2IA7A 3HI7A 3DGMA 4HM6B 3GZYB 4IPBA 5ELUA 1UUGB 2QEX3 1D6UA 1VQM3 3TDGA 1JBRA 1C54A 3OV4A 4N6UA 1K9M4 1OF5B 1DVDA 3F40A 4FCMA 5IW9A 2JDIH 1I2FA 3B7CA 3A76A 4ILFA 1JJ22 5AI1A 1IDPA 3UL6A 5EVHA 3PCRA 4FMAA 4J8TA 3K7CA 5BU4A 3RDEA 1NU3A 1UDII 1MWTA 1Q7HA 3GAXA 4WFOA 1FW7A 2FGTA 7STDA 4N6V0 2Q07A 3MSOA 3D4AA 4HM2B 5G1LA 1IYYA 1BRNL 1VQN3 1IU7A 1OHSA 4XBXA 3CCJ3 1ULIB 1AY7A 1TP6A 2O9UX 1O7MB 3AHWA 5CK6A 3H3HA 3LXUX 1VQO3 5M19A 1RGLA 2PNCA 1BSAA 1GS3A 3FKAA 3NBRA 5JPPA 5STDA 4DKIA 1I2EA 2BMRB 1OF5A 3CC23 3LTAA 3PXMA 4O8SA 5G2GA 1JZDA 4MMXB 3K0ZA 1GD4A 1YIT3 3EN1B 4J5KA 1W6GA 3FF0A 1VQL3 3CC43 1O7NB 2GU1A 2PZVA 1DMQA 1YVBI 3MWZA 4N6MA 3MG2A 3AGNA 3CCU3 1NDOB 1RN4A 1T2IA 1VQ93 1GY7A 4AEQA 1LQGC 1SIHA 1N5PA 1YGWA 2BO9B 2C4BA 2CC3A 1N9JA 1JN5B 3FLJA 1FGQA 5FW5A 2XSHB 2W6JH 1R4YA 3WOEB 1GMPA 4HAAA 3X41A 3CPOA 1Q814 1I8VA 1RRHA 1QJGA 1MGWA 2RFRA 2BHMA 1M9GA 3GSPA 2CG0A 1BNGA 5AIGA 3S67A 3DGOA 3URPA 3ZFZA 1UI7A 1RRLA 2YFJB 3L0RA 3S29A 4K90B 1JZOA 1VQ43 2FNQA 4KFEA 1I3FA 3PZWA 3CD63 4JRFA 5LC6A 1B2XA 2H0GA 1B2ZA 2UGIA 4J9AA 1LOXA 1VQP3 3F9SA 2MC8A 4KZ1A 1K28A 1EA2A 1RGCA 1RSNA 1G96A 2MF7A 1U5OA 3KIIA 4HZBB 7GSPA 3J7Yd 3FF2A 5D83A 4BTYA 3B4OA 1EG9B
chains in the Genus database with same CATH topology
1QAKA 1TIJA 1JN5A 1Z1SA 3ER7A 4XBYA 2WOFA 3WOFB 2CW9A 1DYUA 3DGNA 3VF1A 1STFI 4CDLA 5FGOA 3X3ZA 4HZ9B 5BVBA 2IMJA 4HM5B 6STDA 3MG3A 1Q40A 3M8CA 4XDVA 2B1XB 3UB1A 1ISKA 1PFPA 1DMNA 4EXRA 1UW1A 2HMNB 3MKIA 2W0QA 2BMQB 3CPW2 1OHOA 1TFKA 1FGTA 3OW22 4R80A 2XR8B 4NHFA 2ML6A 3JUQA 2UX0A 5IENA 1OHPA 2E2TA 2P0XA 4L8PA 1CQSA 3U1WA 4EYCA 2C10A 3I563 3MHEA 1OACA 3U97A 3SEDA 1FUWA 3HZPA 2IUJA 3BNEA 1IQ8A 4QWTA 3S28A 3STDA 2BMOB 3PYJA 1US1A 1L5GB 2W04A 2CWVA 1HKXA 3SVAA 3EN8A 3LTBA 2CIUA 5AIIA 3Q90A 5ELJA 5CLKA 3F8XA 3JUMA 3CCR3 1VQ83 3WA3A 3KE7A 4KVHA 5IEOA 2OOVC 3LH4A 2CFWA 1GY5A 1NB5I 2GEYA 1OUNA 2HMJB 1A90A 3LTCA 3NX0A 5EEOA 1STDA 2F86B 4LGQA 3DGLA 3EQQB 3D9RA 1IVXA 3ALAA 4IT7A 4RNZA 2O3OA 2D42A 3NM2A 3JUNA 4HVNA 3OWSA 4FCZA 3SOYA 3EJVA 3JVCA 1KQS2 3F7XA 4MMZB 1E3VA 5AEWB 1DVCA 1JB4A 3CNMA 3OWUA 3CCV3 1LVNA 5IG5A 2HMMB 4WP5A 3QRDA 1JB2A 1F8NA 1QMAA 4H61A 5D81A 1M904 1IT8A 4JF8A 4OVMA 4EC6A 1JRQA 4RBNA 3KSED 4K1UA 3EF8A 1Q824 3N54B 3NXJA 4ORLA 3V99A 1JB5A 1TU5A 5IG3A 5HGRA 4HM7B 1K41A 3DUKA 3DMCA 1AR0A 1O7PB 3N8BA 4KFDA 4XDWA 4HM1B 1OH0A 1OPYA 1RN7A 3LT9A 2RCDA 1SIIA 1IQYA 1N9EA 2CWTA 1WTHA 4HBRA 2XEPA 3DZLA 5EQLA 1WMPA 1S5AA 3X3YA 2BT3A 3NV0B 4AKZA 5AIFA 2XGLA 4U13A 3CC73 3SLUA 4MEIA 1IT7A 2KRTA 4L7KA 4MJDA 3FG4A 3RGAA 3DM8A 3PGBA 1Q864 3JUOA 2YX9A 2CHCA 2OTJ3 3EBYA 2GEXA 2P05A 4K61A 3UL5A 3NBJA 1GY6A 1VQK3 4STDA 3CNXA 1E3RA 4R4KA 3G6E3 3HX8A 4BTXA 3NHXA 2I9WA 5CF2A 3MYTA 1CYVA 4GL6A 3AMOB 1A2KA 1A2VA 2CWUA 3D3LA 5BXQA 1FA3A 1YHQ3 1GD3A 1JKGB 3BB9A 2QGUA 1R4CA 2XFTA 1OGXA 2W56B 2Z77A 3NV0A 5KP3A 2YFIB 3EC9A 1QALA 4NREA 2JQ5A 1MOLA 4PEJA 3UJMA 1W2B2 1K8A4 4FMDA 4R9KA 3BNCA 3MG1A 2Y73A 3CU3A 8CHOA 3X40A 4RZMA 3LZAA 2F99A 2W9PA 1M1XB 4N6TA 2E2UA 5AIHA 4R1KA 3G16A 3CCM3 5DREA 4H3UA 1AVKA 4I4KA 2OTL3 1VZZA 4XM4A 3HIIA 1RKYA 3NM7A 2GU3A 2XRXB 1KD14 1ZX2A 3FG1A 3IPTA 1N8QA 2CK3H 3PS8A 3RGRA 5IEPA 1JKGA 2QA43 1WMOA 1Y4KA 1W5ZA 3NBBA 4HM0B 3VSYA 1IQXA 3KFQC 4N6OB 3CCL3 4HM4B 4X2HA 2V1LA 1YJ93 2OQEA 3CMA3 1VQ73 1AVLA 1U8CB 3T0UA 1D6ZA 3DXOA 1K734 1KWIA 1OCVA 1IV9A 3G713 4LZIA 2QIYA 3V92A 3T8NA 1LNHA 2CFLA 3FSDA 1C7HA 3DY5A 2W2CA 1SQWA 4TX4A 1QAFA 4GB5A 3G8ZA 1WMNA 2HMLB 4WHAA 2GXFA 3G4S3 1CEWI 3K9MC 3CCQ3 1E97A 3WODG 2KCDA 3LOYA 1W6YA 1YJW3 4Q53A 4FR9A 3QK9A 1M1K4 1HU9A 3EBTA 2K0MA 3LYGA 3FGYA 3MPHA 4R9LA 2GBXB 2BNGA 1RJOA 1W02A 2K54A 1AV4A 3Q1CA 3WA2X 2CG1A 2FXTA 2RSXA 3F7SA 3IJEB 3UNLA 5D82A 2WO0A 3G0KA 1EQKA 2STDA 5CXOA 1ROVA 4X2OA 4WYKB 3K63A 5IG0A 3S27A 1GYBA 4O3VA 1UUWB 2LYXA 1YJN3 1MNLA 3NQYA 1IK3A 4EBGA 1IVUA 1QVG2 1J2BA 2OCTA 3SOAA 1EKMA 3HK4A 1W01A 1NJI4 1CYUA 5IF6A 2P09A 2INXA 3CXC2 5KP1A 3LT8A 3OWYA 3Q2PA 3KN4A 2LQVA 3IMAB 1NO3A 3EHCA 1LXEA 2Y74A 1IVVA 1Q42A 1JNQA 4MMYB 2XH9A 3I0YA 4WYKA 3V98A 3S5CA 1YIJ3 1VQ53 1TUHA 3JUPA 3N9HA 4EV5A 4K1VA 5IG4A 1ROAA 3GZRA 3HIGA 4XB5A 3F8HA 4HM3B 4N6LA 3X42A 3BNDA 1W4NA 4LSOA 4AKYA 4ZM8A 3EX9A 2Z6BA 3B4PA 2M7OA 4L8OA 4HM8B 1O7HB 3EE1A 4O2HA 5TGNA 2SBLA 3FCSB 5LC7A 3GWRA 2YFLB 4CCVA 4WWUC 3CME3 1FGOA 3NQZA 2XSOB 2XFSA 2IUKA 2L4VA 3PCSA 1Q40B 1D6YA 2CFKA 4FCJA 2Z76A 3ROBA 2CH9A 2HMOB 3O8YA 2E2VA 3X3XA 4OK0A 5IERA 3FZWA 1FGRA 2CFGA 3NUVA 1W00A 1WNHA 1UUVB 5DRVA 4IIAA 2ML5A 2CFDA 5JPUA 3BNBA 2F98A 2WOHA 3LMLA 1ULJB 1JV2B 2Z7AA 3FH1A 3B8LA 3OX9A 3VGNA 4BTWA 1DMMA 1N8R4 1T5YA 1UI8A 3F14A 2P38A 4KFFA 4OUQA 2C11A 3AMOA 3FG3A 5JBSA 1O7GB 3KSPA 2WGQA 1KC84 2KXGA 4G1MB 1SJWA 2R4IA 1V74A 1BUQA 4RNYA 3OXAA 2W56A 3GZBA 3ECFA 1TFOA 3K5TA 1ZO2A 3EB8A 1SPUA 4HYZA 4N3VA 4O02B 3T8UA 5AEUB 5CF1A 1YI23 3KZTA 5I97A 4N6NB 1A67A 2OWPA 1S723 2WGOA 2ZDJA 2XGNA 1IV7A 1W2ZA 2GBWB 3LTDA 2OOVA 1VQ63 4HKVB 2HMKB 4FMBA 1N5HA 1ASKA 1PU4A 3WMDA 5A0OB 1O7WB 4LEHA 1FGMA 3E99A 4XBTA 1WQLB 1YGEA 3CCS3 1KSIA 1NWWA 4HJLB 2ZL8A 5AYRB 2XF3A 1W6CA 2OQEC 3SX1A 2CKFB 1W7CA 2RGQA 4FMCA 3I553 3GZXB 1QVF2 2B24B 1Q7Y4 1OGZA 5AYSC 3CCE3 3KKGA 1NB3I 3SXXA 4EV2A 2D1WA 3WDGB 2W03A 3GRDA 2P0MA 3H51A 5KP4A 4LMIA 2A15A 2W9QA 1IVWA 3BLZA 2IA7A 3HI7A 3DGMA 4HM6B 3GZYB 4IPBA 5ELUA 2QEX3 1D6UA 1VQM3 3TDGA 3OV4A 4N6UA 1K9M4 1OF5B 1DVDA 3F40A 4FCMA 5IW9A 2JDIH 3B7CA 1JJ22 3A76A 5AI1A 1IDPA 3UL6A 5EVHA 3PCRA 4FMAA 4J8TA 3K7CA 3RDEA 1NU3A 3GAXA 4WFOA 2FGTA 7STDA 4N6V0 2Q07A 3MSOA 4HM2B 1VQN3 1IU7A 1OHSA 4XBXA 3CCJ3 1ULIB 1TP6A 2O9UX 1O7MB 5CK6A 3H3HA 3LXUX 1VQO3 2PNCA 3FKAA 1GS3A 3NBRA 5JPPA 5STDA 2BMRB 1OF5A 3CC23 3LTAA 3PXMA 4O8SA 5G2GA 4MMXB 3K0ZA 1GD4A 1YIT3 3EN1B 1W6GA 3FF0A 1VQL3 3CC43 2PZVA 1O7NB 2GU1A 1DMQA 1YVBI 3MWZA 4N6MA 3MG2A 3CCU3 1NDOB 1VQ93 1GY7A 4AEQA 1SIHA 1N5PA 2BO9B 2CC3A 1N9JA 1JN5B 3FLJA 1FGQA 5FW5A 2XSHB 2W6JH 3WOEB 3X41A 3CPOA 1Q814 1RRHA 1QJGA 2RFRA 2BHMA 1M9GA 2CG0A 5AIGA 3S67A 3DGOA 1UI7A 1RRLA 2YFJB 3L0RA 3S29A 4K90B 1VQ43 2FNQA 4KFEA 3PZWA 3CD63 4JRFA 5LC6A 4J9AA 1LOXA 1VQP3 3F9SA 2MC8A 4KZ1A 1K28A 1EA2A 1G96A 2MF7A 1U5OA 3KIIA 4HZBB 3J7Yd 3FF2A 5D83A 4BTYA 3B4OA 1EG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2H A; 
#chains in the Genus database with same CATH topology
 1QAK A;  1TIJ A;  1BRS A;  1JN5 A;  1Z1S A;  3ER7 A;  4XBY A;  2WOF A;  3WOF B;  2CW9 A;  1DYU A;  3DGN A;  3VF1 A;  1STF I;  1TRQ A;  4CDL A;  1MWU A;  1RGA A;  5FGO A;  3X3Z A;  4HZ9 B;  5BVB A;  2IMJ A;  4HM5 B;  6STD A;  3MG3 A;  1GOV A;  1B2S A;  1Q40 A;  3M8C A;  4XDV A;  2B1X B;  2KAA A;  3UB1 A;  1ISK A;  3SYU A;  1PFP A;  5GSP A;  1DMN A;  4EXR A;  1UW1 A;  2HMN B;  1DE3 A;  3MKI A;  1Q9E A;  1UCI A;  2AAE A;  2RNT A;  2W0Q A;  2BMQ B;  1GSP A;  1OHO A;  1TFK A;  1FGT A;  3CPW 2;  4R80 A;  3OW2 2;  2XR8 B;  4NHF A;  2ML6 A;  3JUQ A;  2UX0 A;  1MGR A;  5IEN A;  1OHP A;  1RN1 A;  2E2T A;  2P0X A;  4L8P A;  1CQS A;  3U1W A;  1BSD A;  4EYC A;  2C10 A;  3I56 3;  3MHE A;  1OAC A;  3U97 A;  3SED A;  1FUW A;  3HZP A;  2IUJ A;  2RBI A;  1IQ8 A;  3BNE A;  4J5G A;  4QWT A;  3S28 A;  3STD A;  2BMO B;  4BL3 A;  1FZU A;  3PYJ A;  1BOX A;  1US1 A;  1L5G B;  2W04 A;  2CWV A;  1HKX A;  3SVA A;  3EN8 A;  3LTB A;  2CIU A;  4NPB A;  5AII A;  3Q90 A;  2GSP A;  5CLK A;  3F8X A;  5ELJ A;  3JUM A;  3CCR 3;  1VQ8 3;  3WA3 A;  3A5E A;  3KE7 A;  1YNV X;  4KVH A;  5RNT A;  5IEO A;  2OOV C;  3LH4 A;  2CFW A;  1GY5 A;  1NB5 I;  6RNT A;  1B2U A;  1BNS A;  2GEY A;  1OUN A;  2HMJ B;  1A90 A;  3LTC A;  3NX0 A;  2IY2 A;  5EEO A;  1STD A;  2F86 B;  4LGQ A;  1A2P A;  3DGL A;  3EQQ B;  1FUT A;  1IVX A;  3D9R A;  3ALA A;  4IT7 A;  4RNZ A;  2O3O A;  2D42 A;  1B3S A;  3NM2 A;  1NNV A;  1BAO A;  3JUN A;  4HVN A;  3OWS A;  4FCZ A;  3SOY A;  3EJV A;  3JVC A;  1KQS 2;  3F7X A;  4MMZ B;  1E3V A;  5AEW B;  1DVC A;  1JB4 A;  3CNM A;  3OWU A;  3CCV 3;  1LVN A;  5IG5 A;  2HMM B;  4WP5 A;  3QRD A;  1JB2 A;  1F8N A;  1QMA A;  4H61 A;  5D81 A;  1BNJ A;  1B21 A;  1M90 4;  1IT8 A;  1BRI A;  4JF8 A;  4OVM A;  4EC6 A;  2CX0 A;  1JRQ A;  4RBN A;  3KSE D;  4K1U A;  3EF8 A;  1Q82 4;  3DGY A;  3N54 B;  1BNE A;  4KT3 B;  3NXJ A;  1UCK A;  1X1U A;  4ORL A;  3V99 A;  1JB5 A;  1TU5 A;  1UGI A;  5IG3 A;  5HGR A;  4HM7 B;  1K41 A;  3DUK A;  3DMC A;  1JBT A;  1AR0 A;  1GOY A;  1O7P B;  3N8B A;  4KFD A;  4XDW A;  1T2H A;  4HM1 B;  1PYL A;  1OH0 A;  1OPY A;  1RN7 A;  3LT9 A;  2RCD A;  1SII A;  1FUS A;  1ZGX A;  1IQY A;  1N9E A;  1RGK A;  2L1S A;  1RDS A;  2CWT A;  4CJN A;  1WTH A;  4HBR A;  2XEP A;  3DZL A;  1MWS A;  5EQL A;  1I70 A;  1BUJ A;  1BSE A;  1WMP A;  1I0X A;  1RGH A;  1S5A A;  3X3Y A;  2BT3 A;  3NV0 B;  4AKZ A;  5AIF A;  2XGL A;  4U13 A;  3CC7 3;  3SLU A;  2UUG C;  1I2G A;  4MEI A;  1IT7 A;  2KRT A;  4L7K A;  4MJD A;  3FG4 A;  3RGA A;  3DM8 A;  3PGB A;  9RNT A;  1Q86 4;  5M1A A;  3JUO A;  1LOV A;  2YX9 A;  2CHC A;  2KF5 A;  2IYJ A;  3EBY A;  2GEX A;  2P05 A;  2OTJ 3;  4K61 A;  1TRP A;  1TTO A;  1X1W A;  1GY6 A;  1LRA A;  3NBJ A;  4STD A;  3UL5 A;  1VQK 3;  3CNX A;  1E3R A;  1X1Y A;  4R4K A;  3G6E 3;  3HX8 A;  4BTX A;  3NHX A;  2I9W A;  5CF2 A;  8RNT A;  3MYT A;  1CYV A;  4GL6 A;  3AMO B;  1A2K A;  1A2V A;  3D5I A;  2CWU A;  3D3L A;  5BXQ A;  1FA3 A;  1YHQ 3;  1GD3 A;  1JKG B;  3BB9 A;  1LOY A;  2QGU A;  1R4C A;  2XFT A;  1HYF A;  5M18 A;  2H0I A;  1OGX A;  2W56 B;  2Z77 A;  3NV0 A;  5KP3 A;  2YFI B;  3EC9 A;  1QAL A;  4NRE A;  2JQ5 A;  3ZG0 A;  1MOL A;  4PEJ A;  3UJM A;  3KCH A;  1W2B 2;  1K8A 4;  1FYS A;  4FMD A;  4R9K A;  3BNC A;  3MG1 A;  2F5W A;  1GOU A;  2Y73 A;  3CU3 A;  3ZG5 A;  2ZA4 A;  8CHO A;  3X40 A;  4RZM A;  3LZA A;  2F99 A;  2W9P A;  1X1X A;  1M1X B;  4N6T A;  2E2U A;  5AIH A;  4R1K A;  3G16 A;  3CCM 3;  1YVS A;  1V57 A;  5DRE A;  4H3U A;  1AVK A;  4I4K A;  2OTL 3;  1RTU A;  1VZZ A;  4XM4 A;  3HII A;  1DET A;  4CPK A;  3NM7 A;  1RKY A;  2GU3 A;  2XRX B;  1KD1 4;  1ZX2 A;  3FG1 A;  3IPT A;  6GSP A;  1N8Q A;  2CK3 H;  2F5M A;  3AHS A;  3PS8 A;  3RGR A;  5IEP A;  1JKG A;  2QA4 3;  1WMO A;  1Y4K A;  1W5Z A;  3NBB A;  4HM0 B;  3VSY A;  1IQX A;  1BIR A;  3KFQ C;  4N6O B;  3CCL 3;  4HM4 B;  4X2H A;  2V1L A;  1YJ9 3;  2OQE A;  1RNB A;  3CMA 3;  4HOH A;  1LOW A;  1VQ7 3;  1AVL A;  1BRG A;  1U8C B;  3T0U A;  1D6Z A;  3DXO A;  1K73 4;  1KWI A;  1VQQ A;  1GMQ A;  1OCV A;  1IV9 A;  2BIR A;  3G71 3;  1G02 A;  4LZI A;  2QIY A;  3V92 A;  3T8N A;  1LNH A;  2CFL A;  3FSD A;  1C7H A;  3DY5 A;  2W2C A;  1SQW A;  4TX4 A;  4RNT A;  3RNT A;  1QAF A;  4GB5 A;  3G8Z A;  1WMN A;  2HML B;  4WHA A;  1V58 A;  2GXF A;  3G4S 3;  1CEW I;  3K9M C;  3CCQ 3;  1E97 A;  3WOD G;  5BIR A;  2KCD A;  3LOY A;  1W6Y A;  1RGE A;  1YJW 3;  4Q53 A;  4FR9 A;  3QK9 A;  1M1K 4;  1HU9 A;  3EBT A;  2K0M A;  3LYG A;  4EW5 A;  4BIR A;  3FGY A;  3MPH A;  4R9L A;  2GBX B;  2BNG A;  1T3B A;  1RJO A;  1W02 A;  2K54 A;  1AV4 A;  3Q1C A;  3WA2 X;  2CG1 A;  2FXT A;  4I5Q A;  2HOH A;  2RSX A;  3F7S A;  3IJE B;  3UNL A;  5D82 A;  2WO0 A;  1EUI C;  3G0K A;  2SAR A;  1EQK A;  2STD A;  5CXO A;  1LQM B;  1ROV A;  1BGS A;  2KF4 A;  1I0V A;  4X2O A;  2F4Y A;  7RNT A;  4WYK B;  3K63 A;  5IG0 A;  4GSP A;  3S27 A;  1GYB A;  4O3V A;  1UUW B;  2LYX A;  1YJN 3;  3BU4 A;  1MNL A;  3NQY A;  1IK3 A;  4EBG A;  1IVU A;  2R41 A;  1QVG 2;  1J2B A;  2OCT A;  3SOA A;  1BU4 A;  1EKM A;  3HK4 A;  1W01 A;  1NJI 4;  1CYU A;  5IF6 A;  1BSB A;  4BL2 A;  2P09 A;  2INX A;  1BRH A;  3CXC 2;  5KP1 A;  3LT8 A;  3OWY A;  3Q2P A;  3KN4 A;  2LQV A;  3HOH A;  3IMA B;  1NO3 A;  3EHC A;  1BVI A;  1LXE A;  2Y74 A;  1IVV A;  1Q42 A;  1JNQ A;  4MMY B;  2BU4 A;  2XH9 A;  3I0Y A;  4WYK A;  1RCK A;  3S5C A;  3V98 A;  1TUH A;  1BRK A;  3JUP A;  3N9H A;  4K1V A;  4EV5 A;  1YIJ 3;  1VQ5 3;  1RGF A;  5IG4 A;  1ROA A;  3GZR A;  1TJD A;  3HIG A;  4XB5 A;  3F8H A;  4HM3 B;  1BNF A;  4N6L A;  1AQZ A;  3X42 A;  3BND A;  1W4N A;  1RNT A;  4LSO A;  4AKY A;  4ZM8 A;  3EX9 A;  2Z6B A;  3B4P A;  2M7O A;  2F56 A;  4HM8 B;  4L8O A;  1SAR A;  1O7H B;  1B2M A;  3EE1 A;  4O2H A;  5TGN A;  2SBL A;  3FCS B;  5LC7 A;  3GWR A;  2YFL B;  4CCV A;  4WWU C;  3CME 3;  1FGO A;  3NQZ A;  2XSO B;  2XFS A;  2IUK A;  2L4V A;  3PCS A;  1Q40 B;  1D6Y A;  1PY3 A;  2CFK A;  2Z76 A;  1GMR A;  4FCJ A;  3ROB A;  2CH9 A;  2HMO B;  3O8Y A;  2E2V A;  3X3X A;  1MWR A;  4OK0 A;  5IER A;  3FZW A;  4GHO A;  1FGR A;  2CFG A;  3WR2 A;  3NUV A;  1W00 A;  1WNH A;  1UUV B;  5DRV A;  4IIA A;  1G0T A;  1EEJ A;  2ML5 A;  2CFD A;  5JPU A;  3BNB A;  1JBS A;  1BRJ A;  2F98 A;  3AGO A;  2WOH A;  1RMS A;  1ULJ B;  1JV2 B;  1UGH I;  2Z7A A;  3B8L A;  2K3D A;  3FH1 A;  3LML A;  3OX9 A;  3VGN A;  4BTW A;  1DMM A;  1N8R 4;  1T5Y A;  1RGG A;  1RCL A;  1UI8 A;  3F14 A;  2P38 A;  4KFF A;  4OUQ A;  2C11 A;  3AMO A;  3FG3 A;  5JBS A;  1O7G B;  3KSP A;  1UCJ A;  1UCL A;  2WGQ A;  1KC8 4;  5G1K A;  2KXG A;  4G1M B;  1SJW A;  1BNI A;  2R4I A;  1V74 A;  1BUQ A;  4RNY A;  3OXA A;  2W56 A;  3GZB A;  3ECF A;  1TFO A;  2AAD A;  2CX1 A;  1B20 A;  1CH0 A;  2H0H A;  3K5T A;  1ZO2 A;  3EB8 A;  1SPU A;  4HYZ A;  4N3V A;  4O02 B;  3T8U A;  5AEU B;  5CF1 A;  1I3I A;  1YI2 3;  3KZT A;  5I97 A;  4N6N B;  4BU4 A;  1A67 A;  2OWP A;  1S72 3;  2WGO A;  2XGN A;  2ZDJ A;  1IV7 A;  1W2Z A;  2GBW B;  1RHL A;  3LTD A;  2OOV A;  1VQ6 3;  4HKV B;  3D79 A;  2HMK B;  4FMB A;  1N5H A;  1ASK A;  1PU4 A;  2KF3 A;  1BAN A;  3WMD A;  5A0O B;  1B27 A;  1O7W B;  4LEH A;  1RLS A;  1FGM A;  3E99 A;  4XBT A;  3BIR A;  1WQL B;  1YGE A;  3CCS 3;  1KSI A;  3Q3F A;  1NWW A;  3WHO A;  4HJL B;  2ZL8 A;  5AYR B;  2XF3 A;  1W6C A;  2OQE C;  5HOH A;  3SX1 A;  2CKF B;  1W7C A;  2RGQ A;  4FMC A;  3I55 3;  3GZX B;  1QVF 2;  3D5G A;  2B24 B;  1BSC A;  1Q7Y 4;  1ZS7 A;  2KF6 A;  1OGZ A;  5AYS C;  3CCE 3;  3KKG A;  1NB3 I;  3SXX A;  4EV2 A;  2D1W A;  1HZ1 A;  3DH2 A;  3WDG B;  2W03 A;  3GRD A;  2P0M A;  3H51 A;  5KP4 A;  1LNI A;  4LMI A;  4LYL B;  2A15 A;  1BNR A;  2ZHX B;  2W9Q A;  1IVW A;  2J8X B;  3BLZ A;  2IA7 A;  3HI7 A;  3DGM A;  4HM6 B;  3GZY B;  4IPB A;  5ELU A;  1UUG B;  2QEX 3;  1D6U A;  1VQM 3;  3TDG A;  1JBR A;  1C54 A;  3OV4 A;  4N6U A;  1K9M 4;  1OF5 B;  1DVD A;  3F40 A;  4FCM A;  5IW9 A;  2JDI H;  1I2F A;  3B7C A;  3A76 A;  4ILF A;  1JJ2 2;  5AI1 A;  1IDP A;  3UL6 A;  5EVH A;  3PCR A;  4FMA A;  4J8T A;  3K7C A;  5BU4 A;  3RDE A;  1NU3 A;  1UDI I;  1MWT A;  1Q7H A;  3GAX A;  4WFO A;  1FW7 A;  2FGT A;  7STD A;  4N6V 0;  2Q07 A;  3MSO A;  3D4A A;  4HM2 B;  5G1L A;  1IYY A;  1BRN L;  1VQN 3;  1IU7 A;  1OHS A;  4XBX A;  3CCJ 3;  1ULI B;  1AY7 A;  1TP6 A;  2O9U X;  1O7M B;  3AHW A;  5CK6 A;  3H3H A;  3LXU X;  1VQO 3;  5M19 A;  1RGL A;  2PNC A;  1BSA A;  1GS3 A;  3FKA A;  3NBR A;  5JPP A;  5STD A;  4DKI A;  1I2E A;  2BMR B;  1OF5 A;  3CC2 3;  3LTA A;  3PXM A;  4O8S A;  5G2G A;  1JZD A;  4MMX B;  3K0Z A;  1GD4 A;  1YIT 3;  3EN1 B;  4J5K A;  1W6G A;  3FF0 A;  1VQL 3;  3CC4 3;  1O7N B;  2GU1 A;  2PZV A;  1DMQ A;  1YVB I;  3MWZ A;  4N6M A;  3MG2 A;  3AGN A;  3CCU 3;  1NDO B;  1RN4 A;  1T2I A;  1VQ9 3;  1GY7 A;  4AEQ A;  1LQG C;  1SIH A;  1N5P A;  1YGW A;  2BO9 B;  2C4B A;  2CC3 A;  1N9J A;  1JN5 B;  3FLJ A;  1FGQ A;  5FW5 A;  2XSH B;  2W6J H;  1R4Y A;  3WOE B;  1GMP A;  4HAA A;  3X41 A;  3CPO A;  1Q81 4;  1I8V A;  1RRH A;  1QJG A;  1MGW A;  2RFR A;  2BHM A;  1M9G A;  3GSP A;  2CG0 A;  1BNG A;  5AIG A;  3S67 A;  3DGO A;  3URP A;  3ZFZ A;  1UI7 A;  1RRL A;  2YFJ B;  3L0R A;  3S29 A;  4K90 B;  1JZO A;  1VQ4 3;  2FNQ A;  4KFE A;  1I3F A;  3PZW A;  3CD6 3;  4JRF A;  5LC6 A;  1B2X A;  2H0G A;  1B2Z A;  2UGI A;  4J9A A;  1LOX A;  1VQP 3;  3F9S A;  2MC8 A;  4KZ1 A;  1K28 A;  1EA2 A;  1RGC A;  1RSN A;  1G96 A;  2MF7 A;  1U5O A;  3KII A;  4HZB B;  7GSP A;  3J7Y d;  3FF2 A;  5D83 A;  4BTY A;  3B4O A;  1EG9 B; 
#chains in the Genus database with same CATH homology
 1QAK A;  1TIJ A;  1JN5 A;  1Z1S A;  3ER7 A;  4XBY A;  2WOF A;  3WOF B;  2CW9 A;  1DYU A;  3DGN A;  3VF1 A;  1STF I;  4CDL A;  5FGO A;  3X3Z A;  4HZ9 B;  5BVB A;  2IMJ A;  4HM5 B;  6STD A;  3MG3 A;  1Q40 A;  3M8C A;  4XDV A;  2B1X B;  3UB1 A;  1ISK A;  1PFP A;  1DMN A;  4EXR A;  1UW1 A;  2HMN B;  3MKI A;  2W0Q A;  2BMQ B;  3CPW 2;  1OHO A;  1TFK A;  1FGT A;  3OW2 2;  4R80 A;  2XR8 B;  4NHF A;  2ML6 A;  3JUQ A;  2UX0 A;  5IEN A;  1OHP A;  2E2T A;  2P0X A;  4L8P A;  1CQS A;  3U1W A;  4EYC A;  2C10 A;  3I56 3;  3MHE A;  1OAC A;  3U97 A;  3SED A;  1FUW A;  3HZP A;  2IUJ A;  3BNE A;  1IQ8 A;  4QWT A;  3S28 A;  3STD A;  2BMO B;  3PYJ A;  1US1 A;  1L5G B;  2W04 A;  2CWV A;  1HKX A;  3SVA A;  3EN8 A;  3LTB A;  2CIU A;  5AII A;  3Q90 A;  5ELJ A;  5CLK A;  3F8X A;  3JUM A;  3CCR 3;  1VQ8 3;  3WA3 A;  3KE7 A;  4KVH A;  5IEO A;  2OOV C;  3LH4 A;  2CFW A;  1GY5 A;  1NB5 I;  2GEY A;  1OUN A;  2HMJ B;  1A90 A;  3LTC A;  3NX0 A;  5EEO A;  1STD A;  2F86 B;  4LGQ A;  3DGL A;  3EQQ B;  3D9R A;  1IVX A;  3ALA A;  4IT7 A;  4RNZ A;  2O3O A;  2D42 A;  3NM2 A;  3JUN A;  4HVN A;  3OWS A;  4FCZ A;  3SOY A;  3EJV A;  3JVC A;  1KQS 2;  3F7X A;  4MMZ B;  1E3V A;  5AEW B;  1DVC A;  1JB4 A;  3CNM A;  3OWU A;  3CCV 3;  1LVN A;  5IG5 A;  2HMM B;  4WP5 A;  3QRD A;  1JB2 A;  1F8N A;  1QMA A;  4H61 A;  5D81 A;  1M90 4;  1IT8 A;  4JF8 A;  4OVM A;  4EC6 A;  1JRQ A;  4RBN A;  3KSE D;  4K1U A;  3EF8 A;  1Q82 4;  3N54 B;  3NXJ A;  4ORL A;  3V99 A;  1JB5 A;  1TU5 A;  5IG3 A;  5HGR A;  4HM7 B;  1K41 A;  3DUK A;  3DMC A;  1AR0 A;  1O7P B;  3N8B A;  4KFD A;  4XDW A;  4HM1 B;  1OH0 A;  1OPY A;  1RN7 A;  3LT9 A;  2RCD A;  1SII A;  1IQY A;  1N9E A;  2CWT A;  1WTH A;  4HBR A;  2XEP A;  3DZL A;  5EQL A;  1WMP A;  1S5A A;  3X3Y A;  2BT3 A;  3NV0 B;  4AKZ A;  5AIF A;  2XGL A;  4U13 A;  3CC7 3;  3SLU A;  4MEI A;  1IT7 A;  2KRT A;  4L7K A;  4MJD A;  3FG4 A;  3RGA A;  3DM8 A;  3PGB A;  1Q86 4;  3JUO A;  2YX9 A;  2CHC A;  2OTJ 3;  3EBY A;  2GEX A;  2P05 A;  4K61 A;  3UL5 A;  3NBJ A;  1GY6 A;  1VQK 3;  4STD A;  3CNX A;  1E3R A;  4R4K A;  3G6E 3;  3HX8 A;  4BTX A;  3NHX A;  2I9W A;  5CF2 A;  3MYT A;  1CYV A;  4GL6 A;  3AMO B;  1A2K A;  1A2V A;  2CWU A;  3D3L A;  5BXQ A;  1FA3 A;  1YHQ 3;  1GD3 A;  1JKG B;  3BB9 A;  2QGU A;  1R4C A;  2XFT A;  1OGX A;  2W56 B;  2Z77 A;  3NV0 A;  5KP3 A;  2YFI B;  3EC9 A;  1QAL A;  4NRE A;  2JQ5 A;  1MOL A;  4PEJ A;  3UJM A;  1W2B 2;  1K8A 4;  4FMD A;  4R9K A;  3BNC A;  3MG1 A;  2Y73 A;  3CU3 A;  8CHO A;  3X40 A;  4RZM A;  3LZA A;  2F99 A;  2W9P A;  1M1X B;  4N6T A;  2E2U A;  5AIH A;  4R1K A;  3G16 A;  3CCM 3;  5DRE A;  4H3U A;  1AVK A;  4I4K A;  2OTL 3;  1VZZ A;  4XM4 A;  3HII A;  1RKY A;  3NM7 A;  2GU3 A;  2XRX B;  1KD1 4;  1ZX2 A;  3FG1 A;  3IPT A;  1N8Q A;  2CK3 H;  3PS8 A;  3RGR A;  5IEP A;  1JKG A;  2QA4 3;  1WMO A;  1Y4K A;  1W5Z A;  3NBB A;  4HM0 B;  3VSY A;  1IQX A;  3KFQ C;  4N6O B;  3CCL 3;  4HM4 B;  4X2H A;  2V1L A;  1YJ9 3;  2OQE A;  3CMA 3;  1VQ7 3;  1AVL A;  1U8C B;  3T0U A;  1D6Z A;  3DXO A;  1K73 4;  1KWI A;  1OCV A;  1IV9 A;  3G71 3;  4LZI A;  2QIY A;  3V92 A;  3T8N A;  1LNH A;  2CFL A;  3FSD A;  1C7H A;  3DY5 A;  2W2C A;  1SQW A;  4TX4 A;  1QAF A;  4GB5 A;  3G8Z A;  1WMN A;  2HML B;  4WHA A;  2GXF A;  3G4S 3;  1CEW I;  3K9M C;  3CCQ 3;  1E97 A;  3WOD G;  2KCD A;  3LOY A;  1W6Y A;  1YJW 3;  4Q53 A;  4FR9 A;  3QK9 A;  1M1K 4;  1HU9 A;  3EBT A;  2K0M A;  3LYG A;  3FGY A;  3MPH A;  4R9L A;  2GBX B;  2BNG A;  1RJO A;  1W02 A;  2K54 A;  1AV4 A;  3Q1C A;  3WA2 X;  2CG1 A;  2FXT A;  2RSX A;  3F7S A;  3IJE B;  3UNL A;  5D82 A;  2WO0 A;  3G0K A;  1EQK A;  2STD A;  5CXO A;  1ROV A;  4X2O A;  4WYK B;  3K63 A;  5IG0 A;  3S27 A;  1GYB A;  4O3V A;  1UUW B;  2LYX A;  1YJN 3;  1MNL A;  3NQY A;  1IK3 A;  4EBG A;  1IVU A;  1QVG 2;  1J2B A;  2OCT A;  3SOA A;  1EKM A;  3HK4 A;  1W01 A;  1NJI 4;  1CYU A;  5IF6 A;  2P09 A;  2INX A;  3CXC 2;  5KP1 A;  3LT8 A;  3OWY A;  3Q2P A;  3KN4 A;  2LQV A;  3IMA B;  1NO3 A;  3EHC A;  1LXE A;  2Y74 A;  1IVV A;  1Q42 A;  1JNQ A;  4MMY B;  2XH9 A;  3I0Y A;  4WYK A;  3V98 A;  3S5C A;  1YIJ 3;  1VQ5 3;  1TUH A;  3JUP A;  3N9H A;  4EV5 A;  4K1V A;  5IG4 A;  1ROA A;  3GZR A;  3HIG A;  4XB5 A;  3F8H A;  4HM3 B;  4N6L A;  3X42 A;  3BND A;  1W4N A;  4LSO A;  4AKY A;  4ZM8 A;  3EX9 A;  2Z6B A;  3B4P A;  2M7O A;  4L8O A;  4HM8 B;  1O7H B;  3EE1 A;  4O2H A;  5TGN A;  2SBL A;  3FCS B;  5LC7 A;  3GWR A;  2YFL B;  4CCV A;  4WWU C;  3CME 3;  1FGO A;  3NQZ A;  2XSO B;  2XFS A;  2IUK A;  2L4V A;  3PCS A;  1Q40 B;  1D6Y A;  2CFK A;  4FCJ A;  2Z76 A;  3ROB A;  2CH9 A;  2HMO B;  3O8Y A;  2E2V A;  3X3X A;  4OK0 A;  5IER A;  3FZW A;  1FGR A;  2CFG A;  3NUV A;  1W00 A;  1WNH A;  1UUV B;  5DRV A;  4IIA A;  2ML5 A;  2CFD A;  5JPU A;  3BNB A;  2F98 A;  2WOH A;  3LML A;  1ULJ B;  1JV2 B;  2Z7A A;  3FH1 A;  3B8L A;  3OX9 A;  3VGN A;  4BTW A;  1DMM A;  1N8R 4;  1T5Y A;  1UI8 A;  3F14 A;  2P38 A;  4KFF A;  4OUQ A;  2C11 A;  3AMO A;  3FG3 A;  5JBS A;  1O7G B;  3KSP A;  2WGQ A;  1KC8 4;  2KXG A;  4G1M B;  1SJW A;  2R4I A;  1V74 A;  1BUQ A;  4RNY A;  3OXA A;  2W56 A;  3GZB A;  3ECF A;  1TFO A;  3K5T A;  1ZO2 A;  3EB8 A;  1SPU A;  4HYZ A;  4N3V A;  4O02 B;  3T8U A;  5AEU B;  5CF1 A;  1YI2 3;  3KZT A;  5I97 A;  4N6N B;  1A67 A;  2OWP A;  1S72 3;  2WGO A;  2ZDJ A;  2XGN A;  1IV7 A;  1W2Z A;  2GBW B;  3LTD A;  2OOV A;  1VQ6 3;  4HKV B;  2HMK B;  4FMB A;  1N5H A;  1ASK A;  1PU4 A;  3WMD A;  5A0O B;  1O7W B;  4LEH A;  1FGM A;  3E99 A;  4XBT A;  1WQL B;  1YGE A;  3CCS 3;  1KSI A;  1NWW A;  4HJL B;  2ZL8 A;  5AYR B;  2XF3 A;  1W6C A;  2OQE C;  3SX1 A;  2CKF B;  1W7C A;  2RGQ A;  4FMC A;  3I55 3;  3GZX B;  1QVF 2;  2B24 B;  1Q7Y 4;  1OGZ A;  5AYS C;  3CCE 3;  3KKG A;  1NB3 I;  3SXX A;  4EV2 A;  2D1W A;  3WDG B;  2W03 A;  3GRD A;  2P0M A;  3H51 A;  5KP4 A;  4LMI A;  2A15 A;  2W9Q A;  1IVW A;  3BLZ A;  2IA7 A;  3HI7 A;  3DGM A;  4HM6 B;  3GZY B;  4IPB A;  5ELU A;  2QEX 3;  1D6U A;  1VQM 3;  3TDG A;  3OV4 A;  4N6U A;  1K9M 4;  1OF5 B;  1DVD A;  3F40 A;  4FCM A;  5IW9 A;  2JDI H;  3B7C A;  1JJ2 2;  3A76 A;  5AI1 A;  1IDP A;  3UL6 A;  5EVH A;  3PCR A;  4FMA A;  4J8T A;  3K7C A;  3RDE A;  1NU3 A;  3GAX A;  4WFO A;  2FGT A;  7STD A;  4N6V 0;  2Q07 A;  3MSO A;  4HM2 B;  1VQN 3;  1IU7 A;  1OHS A;  4XBX A;  3CCJ 3;  1ULI B;  1TP6 A;  2O9U X;  1O7M B;  5CK6 A;  3H3H A;  3LXU X;  1VQO 3;  2PNC A;  3FKA A;  1GS3 A;  3NBR A;  5JPP A;  5STD A;  2BMR B;  1OF5 A;  3CC2 3;  3LTA A;  3PXM A;  4O8S A;  5G2G A;  4MMX B;  3K0Z A;  1GD4 A;  1YIT 3;  3EN1 B;  1W6G A;  3FF0 A;  1VQL 3;  3CC4 3;  2PZV A;  1O7N B;  2GU1 A;  1DMQ A;  1YVB I;  3MWZ A;  4N6M A;  3MG2 A;  3CCU 3;  1NDO B;  1VQ9 3;  1GY7 A;  4AEQ A;  1SIH A;  1N5P A;  2BO9 B;  2CC3 A;  1N9J A;  1JN5 B;  3FLJ A;  1FGQ A;  5FW5 A;  2XSH B;  2W6J H;  3WOE B;  3X41 A;  3CPO A;  1Q81 4;  1RRH A;  1QJG A;  2RFR A;  2BHM A;  1M9G A;  2CG0 A;  5AIG A;  3S67 A;  3DGO A;  1UI7 A;  1RRL A;  2YFJ B;  3L0R A;  3S29 A;  4K90 B;  1VQ4 3;  2FNQ A;  4KFE A;  3PZW A;  3CD6 3;  4JRF A;  5LC6 A;  4J9A A;  1LOX A;  1VQP 3;  3F9S A;  2MC8 A;  4KZ1 A;  1K28 A;  1EA2 A;  1G96 A;  2MF7 A;  1U5O A;  3KII A;  4HZB B;  3J7Y d;  3FF2 A;  5D83 A;  4BTY A;  3B4O A;  1EG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...