4O2HA

Crystal structure of bcam1869 protein (rsam homolog) from burkholderia cenocepacia
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
TSPLLHPVPGPSPDGYVRLSEGALAALVLDHVASGLDPSLLAELRDNAIDARLAGYTEWHRTAGAGVAYVTVGWDWYLERATGTFVIAGGDVRSNVMAIDAKGADIGMLRTAAALAARLAALDWPAAVASALLGHND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein BCAM1869
publication title RsaM: a transcriptional regulator of Burkholderia spp. with novel fold.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Structural genomics, unknown function
total genus 33
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16245 DUF4902 Domain of unknown function (DUF4902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.610 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o2hA00
4O2HA
chains in the Genus database with same CATH superfamily
3D9RA 1X1YA 5CXOA 3X3ZA 1FGMA 2YX9A 3EJVA 3QK9A 2MF7A 4HKVB 4FCJA 1JN5A 4WHAA 1JV2B 1ROAA 3S27A 1O7GB 1U5OA 2E2UA 1EQKA 1E97A 3DZLA 1SARA 2CK3H 3F40A 1BNRA 1RGCA 3X3YA 4RNZA 3IPTA 1JBSA 2KXGA 3KZTA 1B2SA 3T0UA 2RCDA 1UCIA 3NM2A 3EX9A 1O7WB 1RLSA 8RNTA 5BVBA 1JZOA 4MEIA 1J2BA 3CU3A 3VSYA 3EF8A 4TX4A 1FZUA 4FR9A 5GSPA 4XBYA 1O7HB 3RGAA 4JF8A 1OPYA 1K28A 1OGXA 1O7PB 2OQEA 1ROVA 1DETA 3FF0A 3BNEA 2AADA 1ZS7A 4EYCA 3DGYA 1OHPA 3NBRA 1TRQA 1K41A 1YVSA 5KP3A 3D5GA 1FGTA 4NREA 1MWTA 4KZ1A 2L4VA 1UI7A 3KIIA 4Q53A 3CCV3 2GU1A 1E3VA 3LTDA 1FYSA 4G1MB 3FSDA 3HX8A 3JUNA 2YFJB 2Z6BA 1FGOA 1W02A 3CPOA 3FG3A 4NHFA 1RGLA 1SIHA 4J9AA 1VQ73 1YHQ3 1BGSA 1GS3A 4WWUC 1RGGA 5STDA 1GD3A 2E2VA 3IJEB 3ROBA 4MMXB 4EC6A 8CHOA 4FCMA 3I553 1N8R4 3V98A 4R9LA 2CG1A 1UCKA 2LQVA 3LH4A 1DVCA 4LGQA 3EBYA 3L0RA 1BRNL 3CD63 3PS8A 1K8A4 3BIRA 3FLJA 2CFWA 5IENA 1JB4A 1W4NA 2CX1A 3FCSB 3PZWA 1NNVA 4CPKA 5AEWB 1C7HA 1N9EA 4HZBB 1RGFA 4GB5A 3URPA 5AEUB 2CFDA 5IERA 1NDOB 3N54B 1RKYA 3GZYB 3ZFZA 1BNIA 4HYZA 1QAKA 2O3OA 1QMAA 4R9KA 4U13A 3CCU3 3WA3A 1BANA 1QALA 1G0TA 2W56B 4R4KA 2CFKA 2WGQA 2SBLA 2ZHXB 1YJN3 1SJWA 3FKAA 3VF1A 3NUVA 4J5GA 4BL2A 1NWWA 3BB9A 2LYXA 3KE7A 3WODG 3X41A 3TDGA 1I3FA 1FUTA 3F8HA 1O7MB 2SARA 1BRJA 2RFRA 3EQQB 1AY7A 1HYFA 5G2GA 2STDA 1I2EA 4NPBA 3BLZA 5AIFA 4L8PA 1RMSA 1D6UA 1RSNA 1M9GA 2KF3A 3B7CA 3X40A 3G713 1US1A 2D42A 1GOYA 1UCJA 3FF2A 4HZ9B 3SXXA 4HM6B 5AIIA 6RNTA 2ZA4A 1RGHA 2KF6A 4CCVA 3JUQA 4BIRA 2CWVA 2BMQB 2K54A 4QWTA 2FXTA 1I0XA 1RCKA 3HZPA 4OUQA 1OF5A 1W00A 5KP1A 4K1UA 1WQLB 3DGNA 1GMPA 4EW5A 4N6NB 1JBTA 1GY5A 2RNTA 1VQQA 1K9M4 3MKIA 1RTUA 4PEJA 1W5ZA 2YFIB 1VZZA 4O2HA 2Q07A 1IQ8A 1TIJA 1TJDA 3CCR3 5M19A 1JZDA 2WOHA 2H0IA 1MGRA 1Q42A 3NM7A 3F8XA 1RGKA 4ORLA 2KCDA 5DRVA 1QVG2 1LQMB 2XSOB 1NJI4 2GSPA 4RNTA 4CJNA 6STDA 1Q7Y4 1VQN3 4I4KA 2BT3A 4BTYA 3H51A 3EE1A 5CK6A 1A90A 2F5MA 1CH0A 4BTXA 1YI23 4HM8B 3PCRA 5G1KA 7RNTA 1FA3A 1BNJA 4GHOA 2IYJA 4HM4B 3DGLA 1I8VA 3U97A 1VQ83 2W04A 3CME3 1SIIA 3GZRA 4BU4A 1KD14 1LQGC 1MWUA 1OHSA 1RNTA 1JNQA 3GRDA 5BU4A 3I563 4ZM8A 1N9JA 2UGIA 5EVHA 2QGUA 1GOVA 1MOLA 3O8YA 3HOHA 1IK3A 2IA7A 2W2CA 1UDII 3AMOB 1BRGA 1YVBI 1I70A 1W6YA 3HIIA 1IYYA 2Z77A 3OWUA 3MG2A 5JPUA 2W9QA 3S28A 2IMJA 1B2UA 5KP4A 3WDGB 3MPHA 4FMDA 5CLKA 3Q3FA 5TGNA 3B4PA 4FCZA 1DMNA 3BNDA 5IEOA 1W2B2 1EKMA 4H3UA 3V92A 1UUWB 3KN4A 2INXA 4N6OB 1OHOA 1T3BA 1KC84 4RZMA 2CKFB 1C54A 2W03A 3NBBA 5IW9A 1D6YA 1S5AA 1JKGB 4XBTA 1BUQA 3LMLA 5I97A 1O7NB 2F98A 2Z7AA 1JB2A 3UB1A 3I0YA 1BAOA 1IQYA 1BSCA 1TFOA 4XB5A 1IDPA 4K1VA 3PXMA 3JUPA 2D1WA 1BRIA 3G4S3 5EQLA 2F56A 1IVVA 2CIUA 1TP6A 2J8XB 3E99A 2GXFA 1RDSA 3LTBA 3KSED 1JJ22 2QIYA 2B24B 4N6MA 4O02B 4OVMA 1HU9A 2IUJA 3ZG0A 1FUSA 3IMAB 1IVUA 4IT7A 2JQ5A 1UGHI 1QJGA 2GBXB 4KFEA 1GD4A 1YJ93 1V57A 3DXOA 4ILFA 5HOHA 1ISKA 2XEPA 3ECFA 4IPBA 1Q40B 3ZG5A 4XM4A 1JRQA 2GEYA 4AEQA 1GY6A 2P0XA 1AV4A 5AYRB 3HK4A 3DGOA 4IIAA 3UJMA 1ZO2A 1DMQA 4K90B 1BUJA 4L7KA 1MWRA 2XR8B 1UW1A 2RGQA 2ML6A 2P09A 4KT3B 2I9WA 2WOFA 2FNQA 1R4CA 1T2IA 5M18A 1A2VA 3OW22 1LNIA 1RN1A 2HOHA 3UL5A 2W6JH 1LRAA 5EEOA 2XGNA 4KFDA 3RGRA 5IG5A 2CW9A 6GSPA 2BO9B 1WMOA 2F99A 3CNXA 2BHMA 1NU3A 2RBIA 3GWRA 2QEX3 5D81A 4FMAA 1X1XA 2CWUA 3K5TA 1VQM3 4H61A 2H0GA 2BIRA 1BRHA 3GZBA 2BMRB 2M7OA 1IVWA 3GAXA 2C4BA 2MC8A 3SLUA 1QVF2 2F86B 1A67A 1PU4A 1OACA 1G02A 4HM5B 4LEHA 2A15A 4EBGA 1S723 2O9UX 1MNLA 3F7SA 5ELUA 1BNGA 1UUGB 3CCM3 5AIHA 2CWTA 1Q9EA 4R80A 3X42A 4J8TA 1L5GB 1BRSA 5IG4A 3N9HA 3D3LA 1STDA 1T5YA 1EA2A 3KCHA 3CCL3 1AVKA 1WTHA 2XRXB 1RRHA 1QAFA 5IG3A 3EB8A 5AI1A 3EN8A 2OTJ3 1TRPA 2W56A 4WYKB 3N8BA 1B20A 1TUHA 5IF6A 1LXEA 2OOVC 1EUIC 4HM0B 3X3XA 1B2ZA 2R41A 2ZL8A 1LNHA 3NV0B 5BXQA 5LC6A 1BNEA 3CCQ3 1VQP3 2B1XB 1M1XB 3CNMA 3LYGA 1GSPA 5A0OB 3LOYA 2ZDJA 2E2TA 3FG1A 1YGEA 3FH1A 2W0QA 3BNBA 3EC9A 1SQWA 3K7CA 3KFQC 4HM7B 1I3IA 1W7CA 3OV4A 2W9PA 2XGLA 5AYSC 1GOUA 2AAEA 3AGNA 3UNLA 1TU5A 1ULJB 3WMDA 1V74A 5RNTA 1NB3I 1OUNA 1WNHA 1AVLA 1B21A 3KSPA 1Q7HA 2P05A 1VQK3 3MHEA 1CYUA 2GEXA 2XSHB 2R4IA 1K734 1UGIA 5G1LA 5M1AA 4WYKA 1IQXA 3Q2PA 4MMYB 1BU4A 2HMOB 3AHWA 4AKZA 3U1WA 4L8OA 3PGBA 3NX0A 1JB5A 3ER7A 4RNYA 1IU7A 2Y74A 1B2MA 2XFTA 1DVDA 1CQSA 1AQZA 1LOWA 1ZGXA 4J5KA 2HMLB 1PYLA 3WR2A 1MWSA 1STFI 2HMMB 4HM1B 1M904 1HZ1A 1RJOA 1OH0A 1MGWA 3EHCA 3NHXA 1LOYA 1E3RA 2ML5A 3G0KA 2OQEC 7GSPA 3CC73 4I5QA 4EV5A 1YIT3 1EG9B 1W6CA 3BU4A 3Q1CA 1BNSA 1WMPA 4BL3A 3D79A 3OX9A 1IV9A 5BIRA 2IUKA 4X2OA 3FG4A 3CXC2 3MG1A 1IT8A 1VQL3 2PNCA 1LOXA 1BRKA 1FGRA 2BNGA 3ALAA 3MYTA 4MMZB 3S5CA 3NQYA 5CF2A 1CYVA 3GSPA 4WP5A 2Z76A 3EN1B 2QA43 1B2XA 3AMOA 3JVCA 3S29A 2V1LA 3DH2A 2H0HA 1WMNA 2CFGA 1SPUA 4HOHA 2F4YA 1JBRA 3T8UA 1DYUA 1W01A 3K0ZA 4KVHA 3WOEB 4STDA 5JPPA 1ZX2A 2F5WA 5HGRA 5IEPA 2JDIH 1IVXA 4EXRA 3CCJ3 4HJLB 1BSAA 2K3DA 3A5EA 2BU4A 2GU3A 3CC23 1KQS2 3MWZA 1G96A 1RCLA 3SEDA 1GMQA 1M1K4 1YNVX 3A76A 3HI7A 4LMIA 3J7Yd 3K63A 1CEWI 1LVNA 2CHCA 1IV7A 1JKGA 3WHOA 1UUVB 4AKYA 4HM2B 1GYBA 4BTWA 3Q90A 1OGZA 5D82A 1UCLA 3JUOA 3LTAA 5FW5A 2HMKB 3DM8A 2KRTA 1R4YA 1BVIA 3G6E3 3AGOA 4HBRA 2GBWB 4HVNA 1BIRA 3RDEA 1GY7A 1EEJA 1Z1SA 3NBJA 2PZVA 3F14A 3JUMA 3DUKA 1BSEA 1Y4KA 3F7XA 4X2HA 1I2GA 1HKXA 3UL6A 4HM3B 1YJW3 3CMA3 4GSPA 3SVAA 1AR0A 3B4OA 1I0VA 2CFLA 3DY5A 3LXUX 1NB5I 4FMBA 1U8CB 1W6GA 2WGOA 1N8QA 2P38A 2XFSA 3DGMA 3HIGA 1VQO3 1TFKA 2L1SA 4O8SA 2Y73A 3F9SA 3CC43 1Q40A 2UX0A 3EBTA 4N3VA 1VQ63 3OWSA 4DKIA 1OF5B 3B8LA 3K9MC 4WFOA 5IG0A 3SX1A 9RNTA 3PCSA 2HMNB 1B3SA 4RBNA 4K61A 1FUWA 2FGTA 3STDA 1VQ43 3NQZA 1ASKA 1RRLA 3G16A 1BSBA 3SOYA 1B27A 3V99A 1X1WA 4HAAA 1RGAA 1UI8A 3CCS3 2CX0A 1ULIB 3FGYA 3KKGA 1YIJ3 3CPW2 3OXAA 3D4AA 1RN4A 1VQ53 1A2PA 3MG3A 1TTOA 2KAAA 3NXJA 4GL6A 4R1KA 3T8NA 1V58A 2K0MA 3QRDA 2OTL3 3MSOA 4XDVA 3H3HA 2YFLB 3DMCA 3LT8A 1NO3A 5FGOA 4OK0A 2HMJB 2CC3A 4FMCA 2C11A 3G8ZA 1N5PA 4XDWA 3WOFB 3M8CA 1X1UA 4N6LA 3S67A 4N6V0 1PY3A 3VGNA 5JBSA 2OCTA 2CH9A 3OWYA 1VQ93 2C10A 1RGEA 3AHSA 3BNCA 4CDLA 4XBXA 5CF1A 1LOVA 1IT7A 3LT9A 1N5HA 1W2ZA 1RNBA 1BNFA 1YGWA 1DMMA 1JN5B 1GMRA 2BMOB 1PFPA 1A2KA 3FZWA 5LC7A 2XF3A 2OWPA 3SOAA 2KF4A 1I2FA 1FGQA 1DE3A 1KSIA 1KWIA 3WA2X 4LSOA 5DREA 3D5IA 3CCE3 1OCVA 2UUGC 3LZAA 4JRFA 2OOVA 1FW7A 4LYLB 1D6ZA 1Q814 1T2HA 2P0MA 3RNTA 3LTCA 3NV0A 1RHLA 2XH9A 4O3VA 2WO0A 1Q864 7STDA 2KF5A 2RSXA 4EV2A 2CG0A 3GZXB 1BOXA 4N6TA 1RN7A 4KFFA 3SYUA 4N6UA 4LZIA 5AIGA 5D83A 1Q824 2IY2A 4MJDA 1F8NA 5ELJA 1BSDA 3PYJA
chains in the Genus database with same CATH topology
3D9RA 5CXOA 3X3ZA 1FGMA 2YX9A 3EJVA 3QK9A 2MF7A 4HKVB 4FCJA 1JN5A 4WHAA 1JV2B 1ROAA 3S27A 1O7GB 1U5OA 2E2UA 1EQKA 1E97A 3DZLA 2CK3H 3F40A 3X3YA 4RNZA 3IPTA 2KXGA 3KZTA 3T0UA 2RCDA 3NM2A 3EX9A 1O7WB 5BVBA 4MEIA 3CU3A 3VSYA 3EF8A 4TX4A 4FR9A 4XBYA 1O7HB 3RGAA 4JF8A 1OPYA 1K28A 1OGXA 1O7PB 2OQEA 1ROVA 3FF0A 3BNEA 4EYCA 1OHPA 3NBRA 1K41A 5KP3A 1FGTA 4NREA 4KZ1A 2L4VA 1UI7A 3KIIA 4Q53A 3CCV3 2GU1A 1E3VA 3LTDA 4G1MB 3FSDA 3HX8A 3JUNA 2YFJB 2Z6BA 1FGOA 1W02A 3CPOA 3FG3A 4NHFA 4J9AA 1SIHA 1VQ73 1YHQ3 1GS3A 5STDA 1GD3A 2E2VA 3IJEB 3ROBA 4MMXB 4EC6A 8CHOA 4FCMA 3I553 1N8R4 3V98A 4R9LA 2CG1A 4LGQA 2LQVA 3LH4A 1DVCA 3EBYA 3L0RA 3CD63 3PS8A 1K8A4 3FLJA 2CFWA 5IENA 1JB4A 1W4NA 3FCSB 3PZWA 5AEWB 1C7HA 1N9EA 4HZBB 5AEUB 4GB5A 2CFDA 5IERA 1NDOB 3N54B 1RKYA 3GZYB 4HYZA 1QAKA 2O3OA 1QMAA 4R9KA 4U13A 3CCU3 3WA3A 1QALA 2W56B 4R4KA 2CFKA 2WGQA 2SBLA 1YJN3 1SJWA 3FKAA 3VF1A 3NUVA 1NWWA 3BB9A 2LYXA 3KE7A 3WODG 3X41A 3TDGA 3F8HA 1O7MB 3EQQB 2RFRA 5G2GA 2STDA 3BLZA 5AIFA 4L8PA 1D6UA 3B7CA 1M9GA 3X40A 3G713 1US1A 2D42A 3FF2A 4HZ9B 3SXXA 4HM6B 5AIIA 4CCVA 3JUQA 2CWVA 2BMQB 2K54A 4QWTA 2FXTA 3HZPA 4OUQA 1OF5A 1W00A 5KP1A 4K1UA 1WQLB 3DGNA 4N6NB 1GY5A 1K9M4 3MKIA 4PEJA 2YFIB 1W5ZA 1VZZA 4O2HA 2Q07A 1IQ8A 1TIJA 3CCR3 2WOHA 1Q42A 3NM7A 3F8XA 4ORLA 5DRVA 2KCDA 1NJI4 1QVG2 2XSOB 6STDA 1Q7Y4 1VQN3 4I4KA 2BT3A 4BTYA 3H51A 3EE1A 5CK6A 1A90A 4BTXA 1YI23 4HM8B 3PCRA 1FA3A 4HM4B 3DGLA 3U97A 1VQ83 2W04A 3CME3 1SIIA 3GZRA 1KD14 1OHSA 1JNQA 3GRDA 3I563 4ZM8A 1N9JA 5EVHA 2QGUA 1MOLA 3O8YA 1IK3A 2IA7A 2W2CA 3AMOB 1YVBI 1W6YA 3HIIA 2Z77A 3OWUA 3MG2A 5JPUA 2W9QA 3S28A 2IMJA 5KP4A 3WDGB 3MPHA 4FMDA 5CLKA 5TGNA 3B4PA 4FCZA 1DMNA 3BNDA 5IEOA 1W2B2 1EKMA 4H3UA 3V92A 1UUWB 3KN4A 2INXA 4N6OB 1OHOA 1KC84 4RZMA 2CKFB 2W03A 3NBBA 5IW9A 1D6YA 1S5AA 1JKGB 4XBTA 1BUQA 3LMLA 5I97A 1O7NB 2F98A 2Z7AA 1JB2A 3UB1A 3I0YA 1TFOA 1IQYA 4XB5A 1IDPA 4K1VA 3PXMA 3JUPA 2D1WA 3G4S3 5EQLA 1IVVA 2CIUA 1TP6A 3E99A 2GXFA 3LTBA 3KSED 1JJ22 2QIYA 2B24B 4N6MA 4O02B 4OVMA 1HU9A 2IUJA 1J2BA 3IMAB 1IVUA 4IT7A 2JQ5A 1QJGA 2GBXB 4KFEA 1GD4A 1YJ93 3DXOA 1ISKA 2XEPA 3ECFA 4IPBA 1Q40B 4XM4A 1JRQA 2GEYA 4AEQA 1GY6A 2P0XA 1AV4A 5AYRB 3HK4A 3DGOA 4IIAA 3UJMA 1ZO2A 1DMQA 4K90B 4L7KA 2XR8B 1UW1A 2RGQA 2ML6A 2P09A 2I9WA 2WOFA 2FNQA 1R4CA 1A2VA 3OW22 3UL5A 2W6JH 5EEOA 2XGNA 4KFDA 3RGRA 5IG5A 2CW9A 2F99A 2BO9B 1WMOA 3CNXA 2BHMA 1NU3A 3GWRA 2QEX3 5D81A 4FMAA 1VQM3 2CWUA 3K5TA 4H61A 3GZBA 2BMRB 2M7OA 1IVWA 3GAXA 2MC8A 3SLUA 1QVF2 2F86B 1A67A 1PU4A 1OACA 4HM5B 4LEHA 2A15A 4EBGA 1S723 2O9UX 1MNLA 3F7SA 5ELUA 3CCM3 5AIHA 2CWTA 5IG4A 4R80A 3X42A 4J8TA 1L5GB 3N9HA 3D3LA 1STDA 1T5YA 1EA2A 3CCL3 1AVKA 1WTHA 2XRXB 1RRHA 1QAFA 5IG3A 3EB8A 5AI1A 3EN8A 2OTJ3 2W56A 4WYKB 3N8BA 1TUHA 5IF6A 1LXEA 2OOVC 4HM0B 3X3XA 2ZL8A 1LNHA 3NV0B 5BXQA 5LC6A 3CCQ3 1VQP3 2B1XB 1M1XB 3CNMA 3LYGA 5A0OB 3LOYA 2ZDJA 2E2TA 3FG1A 1YGEA 3FH1A 2W0QA 3BNBA 3EC9A 1SQWA 3K7CA 3KFQC 4HM7B 1W7CA 3OV4A 2W9PA 2XGLA 5AYSC 3UNLA 1TU5A 1ULJB 3WMDA 1V74A 1NB3I 1OUNA 1WNHA 1AVLA 3KSPA 1VQK3 2P05A 3MHEA 1CYUA 2GEXA 2XSHB 2R4IA 1K734 4WYKA 1IQXA 3Q2PA 4MMYB 2HMOB 4AKZA 3U1WA 4L8OA 3PGBA 3NX0A 1JB5A 3ER7A 4RNYA 1IU7A 2Y74A 1DVDA 2XFTA 1CQSA 2HMLB 1STFI 2HMMB 4HM1B 1M904 1RJOA 1OH0A 3EHCA 3NHXA 1E3RA 2ML5A 3G0KA 2OQEC 3CC73 1YIT3 4EV5A 1EG9B 1W6CA 3Q1CA 1WMPA 3OX9A 1IV9A 2IUKA 4X2OA 3FG4A 3CXC2 3MG1A 1IT8A 1VQL3 2PNCA 1LOXA 1FGRA 2BNGA 3ALAA 3MYTA 4MMZB 3S5CA 5CF2A 3NQYA 1CYVA 4WP5A 2Z76A 3EN1B 2QA43 3AMOA 3JVCA 3S29A 2V1LA 1WMNA 2CFGA 1SPUA 3T8UA 1DYUA 1W01A 3K0ZA 4KVHA 3WOEB 4STDA 5JPPA 1ZX2A 5HGRA 5IEPA 2JDIH 1IVXA 4EXRA 3CCJ3 4HJLB 2GU3A 3CC23 1KQS2 3MWZA 1G96A 3SEDA 1M1K4 3A76A 3HI7A 4LMIA 3J7Yd 3K63A 1LVNA 1CEWI 2CHCA 1IV7A 1JKGA 4AKYA 1UUVB 4HM2B 1GYBA 4BTWA 3Q90A 1OGZA 5D82A 3JUOA 3LTAA 5FW5A 2HMKB 3DM8A 2KRTA 3G6E3 4HBRA 2GBWB 4HVNA 3RDEA 1GY7A 1Z1SA 3NBJA 2PZVA 3F14A 3JUMA 3DUKA 3UL6A 1Y4KA 3F7XA 4X2HA 1YJW3 1HKXA 3CMA3 4HM3B 3SVAA 1AR0A 3B4OA 2CFLA 3DY5A 3LXUX 1NB5I 4FMBA 1U8CB 1W6GA 2WGOA 1N8QA 2P38A 2XFSA 3DGMA 3HIGA 1VQO3 1TFKA 4O8SA 2Y73A 3F9SA 3CC43 1Q40A 2UX0A 3EBTA 4N3VA 1VQ63 3OWSA 1OF5B 3B8LA 3K9MC 4WFOA 5IG0A 3SX1A 3PCSA 2HMNB 4RBNA 4K61A 1FUWA 2FGTA 3STDA 1VQ43 3NQZA 1ASKA 1RRLA 3G16A 3SOYA 3V99A 1UI8A 3CCS3 1ULIB 3FGYA 3KKGA 1YIJ3 3CPW2 3OXAA 1VQ53 3MG3A 4GL6A 3NXJA 3T8NA 4R1KA 2K0MA 3QRDA 2OTL3 3MSOA 4XDVA 3H3HA 2YFLB 3DMCA 3LT8A 1NO3A 5FGOA 4OK0A 2HMJB 2CC3A 4FMCA 2C11A 3G8ZA 1N5PA 4XDWA 3WOFB 3M8CA 4N6LA 3S67A 4N6V0 3VGNA 5JBSA 2OCTA 2CH9A 3OWYA 1VQ93 2C10A 3BNCA 4CDLA 4XBXA 5CF1A 1IT7A 3LT9A 1N5HA 1W2ZA 1DMMA 1JN5B 2BMOB 1PFPA 1A2KA 3FZWA 5LC7A 2XF3A 2OWPA 3SOAA 1FGQA 1KSIA 1KWIA 3WA2X 4LSOA 5DREA 3CCE3 1OCVA 3LZAA 2OOVA 4JRFA 1D6ZA 1Q814 2P0MA 3LTCA 3NV0A 2XH9A 4O3VA 1Q864 2WO0A 7STDA 2RSXA 4EV2A 2CG0A 3GZXB 4N6TA 1RN7A 4KFFA 4N6UA 4LZIA 5AIGA 5D83A 1Q824 4MJDA 1F8NA 5ELJA 4WWUC 3PYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2H A; 
#chains in the Genus database with same CATH topology
 3D9R A;  1X1Y A;  5CXO A;  3X3Z A;  1FGM A;  2YX9 A;  3EJV A;  3QK9 A;  2MF7 A;  4HKV B;  4FCJ A;  1JN5 A;  4WHA A;  1JV2 B;  1ROA A;  3S27 A;  1O7G B;  1U5O A;  2E2U A;  1EQK A;  1E97 A;  3DZL A;  1SAR A;  2CK3 H;  3F40 A;  1BNR A;  1RGC A;  3X3Y A;  4RNZ A;  3IPT A;  1JBS A;  2KXG A;  3KZT A;  1B2S A;  3T0U A;  2RCD A;  1UCI A;  3NM2 A;  3EX9 A;  1O7W B;  1RLS A;  8RNT A;  5BVB A;  1JZO A;  4MEI A;  1J2B A;  3CU3 A;  3VSY A;  3EF8 A;  4TX4 A;  1FZU A;  4FR9 A;  5GSP A;  4XBY A;  1O7H B;  3RGA A;  4JF8 A;  1OPY A;  1K28 A;  1OGX A;  1O7P B;  2OQE A;  1ROV A;  1DET A;  3FF0 A;  3BNE A;  2AAD A;  1ZS7 A;  4EYC A;  3DGY A;  1OHP A;  3NBR A;  1TRQ A;  1K41 A;  1YVS A;  5KP3 A;  3D5G A;  1FGT A;  4NRE A;  1MWT A;  4KZ1 A;  2L4V A;  1UI7 A;  3KII A;  4Q53 A;  3CCV 3;  2GU1 A;  1E3V A;  3LTD A;  1FYS A;  4G1M B;  3FSD A;  3HX8 A;  3JUN A;  2YFJ B;  2Z6B A;  1FGO A;  1W02 A;  3CPO A;  3FG3 A;  4NHF A;  1RGL A;  1SIH A;  4J9A A;  1VQ7 3;  1YHQ 3;  1BGS A;  1GS3 A;  4WWU C;  1RGG A;  5STD A;  1GD3 A;  2E2V A;  3IJE B;  3ROB A;  4MMX B;  4EC6 A;  8CHO A;  4FCM A;  3I55 3;  1N8R 4;  3V98 A;  4R9L A;  2CG1 A;  1UCK A;  2LQV A;  3LH4 A;  1DVC A;  4LGQ A;  3EBY A;  3L0R A;  1BRN L;  3CD6 3;  3PS8 A;  1K8A 4;  3BIR A;  3FLJ A;  2CFW A;  5IEN A;  1JB4 A;  1W4N A;  2CX1 A;  3FCS B;  3PZW A;  1NNV A;  4CPK A;  5AEW B;  1C7H A;  1N9E A;  4HZB B;  1RGF A;  4GB5 A;  3URP A;  5AEU B;  2CFD A;  5IER A;  1NDO B;  3N54 B;  1RKY A;  3GZY B;  3ZFZ A;  1BNI A;  4HYZ A;  1QAK A;  2O3O A;  1QMA A;  4R9K A;  4U13 A;  3CCU 3;  3WA3 A;  1BAN A;  1QAL A;  1G0T A;  2W56 B;  4R4K A;  2CFK A;  2WGQ A;  2SBL A;  2ZHX B;  1YJN 3;  1SJW A;  3FKA A;  3VF1 A;  3NUV A;  4J5G A;  4BL2 A;  1NWW A;  3BB9 A;  2LYX A;  3KE7 A;  3WOD G;  3X41 A;  3TDG A;  1I3F A;  1FUT A;  3F8H A;  1O7M B;  2SAR A;  1BRJ A;  2RFR A;  3EQQ B;  1AY7 A;  1HYF A;  5G2G A;  2STD A;  1I2E A;  4NPB A;  3BLZ A;  5AIF A;  4L8P A;  1RMS A;  1D6U A;  1RSN A;  1M9G A;  2KF3 A;  3B7C A;  3X40 A;  3G71 3;  1US1 A;  2D42 A;  1GOY A;  1UCJ A;  3FF2 A;  4HZ9 B;  3SXX A;  4HM6 B;  5AII A;  6RNT A;  2ZA4 A;  1RGH A;  2KF6 A;  4CCV A;  3JUQ A;  4BIR A;  2CWV A;  2BMQ B;  2K54 A;  4QWT A;  2FXT A;  1I0X A;  1RCK A;  3HZP A;  4OUQ A;  1OF5 A;  1W00 A;  5KP1 A;  4K1U A;  1WQL B;  3DGN A;  1GMP A;  4EW5 A;  4N6N B;  1JBT A;  1GY5 A;  2RNT A;  1VQQ A;  1K9M 4;  3MKI A;  1RTU A;  4PEJ A;  1W5Z A;  2YFI B;  1VZZ A;  4O2H A;  2Q07 A;  1IQ8 A;  1TIJ A;  1TJD A;  3CCR 3;  5M19 A;  1JZD A;  2WOH A;  2H0I A;  1MGR A;  1Q42 A;  3NM7 A;  3F8X A;  1RGK A;  4ORL A;  2KCD A;  5DRV A;  1QVG 2;  1LQM B;  2XSO B;  1NJI 4;  2GSP A;  4RNT A;  4CJN A;  6STD A;  1Q7Y 4;  1VQN 3;  4I4K A;  2BT3 A;  4BTY A;  3H51 A;  3EE1 A;  5CK6 A;  1A90 A;  2F5M A;  1CH0 A;  4BTX A;  1YI2 3;  4HM8 B;  3PCR A;  5G1K A;  7RNT A;  1FA3 A;  1BNJ A;  4GHO A;  2IYJ A;  4HM4 B;  3DGL A;  1I8V A;  3U97 A;  1VQ8 3;  2W04 A;  3CME 3;  1SII A;  3GZR A;  4BU4 A;  1KD1 4;  1LQG C;  1MWU A;  1OHS A;  1RNT A;  1JNQ A;  3GRD A;  5BU4 A;  3I56 3;  4ZM8 A;  1N9J A;  2UGI A;  5EVH A;  2QGU A;  1GOV A;  1MOL A;  3O8Y A;  3HOH A;  1IK3 A;  2IA7 A;  2W2C A;  1UDI I;  3AMO B;  1BRG A;  1YVB I;  1I70 A;  1W6Y A;  3HII A;  1IYY A;  2Z77 A;  3OWU A;  3MG2 A;  5JPU A;  2W9Q A;  3S28 A;  2IMJ A;  1B2U A;  5KP4 A;  3WDG B;  3MPH A;  4FMD A;  5CLK A;  3Q3F A;  5TGN A;  3B4P A;  4FCZ A;  1DMN A;  3BND A;  5IEO A;  1W2B 2;  1EKM A;  4H3U A;  3V92 A;  1UUW B;  3KN4 A;  2INX A;  4N6O B;  1OHO A;  1T3B A;  1KC8 4;  4RZM A;  2CKF B;  1C54 A;  2W03 A;  3NBB A;  5IW9 A;  1D6Y A;  1S5A A;  1JKG B;  4XBT A;  1BUQ A;  3LML A;  5I97 A;  1O7N B;  2F98 A;  2Z7A A;  1JB2 A;  3UB1 A;  3I0Y A;  1BAO A;  1IQY A;  1BSC A;  1TFO A;  4XB5 A;  1IDP A;  4K1V A;  3PXM A;  3JUP A;  2D1W A;  1BRI A;  3G4S 3;  5EQL A;  2F56 A;  1IVV A;  2CIU A;  1TP6 A;  2J8X B;  3E99 A;  2GXF A;  1RDS A;  3LTB A;  3KSE D;  1JJ2 2;  2QIY A;  2B24 B;  4N6M A;  4O02 B;  4OVM A;  1HU9 A;  2IUJ A;  3ZG0 A;  1FUS A;  3IMA B;  1IVU A;  4IT7 A;  2JQ5 A;  1UGH I;  1QJG A;  2GBX B;  4KFE A;  1GD4 A;  1YJ9 3;  1V57 A;  3DXO A;  4ILF A;  5HOH A;  1ISK A;  2XEP A;  3ECF A;  4IPB A;  1Q40 B;  3ZG5 A;  4XM4 A;  1JRQ A;  2GEY A;  4AEQ A;  1GY6 A;  2P0X A;  1AV4 A;  5AYR B;  3HK4 A;  3DGO A;  4IIA A;  3UJM A;  1ZO2 A;  1DMQ A;  4K90 B;  1BUJ A;  4L7K A;  1MWR A;  2XR8 B;  1UW1 A;  2RGQ A;  2ML6 A;  2P09 A;  4KT3 B;  2I9W A;  2WOF A;  2FNQ A;  1R4C A;  1T2I A;  5M18 A;  1A2V A;  3OW2 2;  1LNI A;  1RN1 A;  2HOH A;  3UL5 A;  2W6J H;  1LRA A;  5EEO A;  2XGN A;  4KFD A;  3RGR A;  5IG5 A;  2CW9 A;  6GSP A;  2BO9 B;  1WMO A;  2F99 A;  3CNX A;  2BHM A;  1NU3 A;  2RBI A;  3GWR A;  2QEX 3;  5D81 A;  4FMA A;  1X1X A;  2CWU A;  3K5T A;  1VQM 3;  4H61 A;  2H0G A;  2BIR A;  1BRH A;  3GZB A;  2BMR B;  2M7O A;  1IVW A;  3GAX A;  2C4B A;  2MC8 A;  3SLU A;  1QVF 2;  2F86 B;  1A67 A;  1PU4 A;  1OAC A;  1G02 A;  4HM5 B;  4LEH A;  2A15 A;  4EBG A;  1S72 3;  2O9U X;  1MNL A;  3F7S A;  5ELU A;  1BNG A;  1UUG B;  3CCM 3;  5AIH A;  2CWT A;  1Q9E A;  4R80 A;  3X42 A;  4J8T A;  1L5G B;  1BRS A;  5IG4 A;  3N9H A;  3D3L A;  1STD A;  1T5Y A;  1EA2 A;  3KCH A;  3CCL 3;  1AVK A;  1WTH A;  2XRX B;  1RRH A;  1QAF A;  5IG3 A;  3EB8 A;  5AI1 A;  3EN8 A;  2OTJ 3;  1TRP A;  2W56 A;  4WYK B;  3N8B A;  1B20 A;  1TUH A;  5IF6 A;  1LXE A;  2OOV C;  1EUI C;  4HM0 B;  3X3X A;  1B2Z A;  2R41 A;  2ZL8 A;  1LNH A;  3NV0 B;  5BXQ A;  5LC6 A;  1BNE A;  3CCQ 3;  1VQP 3;  2B1X B;  1M1X B;  3CNM A;  3LYG A;  1GSP A;  5A0O B;  3LOY A;  2ZDJ A;  2E2T A;  3FG1 A;  1YGE A;  3FH1 A;  2W0Q A;  3BNB A;  3EC9 A;  1SQW A;  3K7C A;  3KFQ C;  4HM7 B;  1I3I A;  1W7C A;  3OV4 A;  2W9P A;  2XGL A;  5AYS C;  1GOU A;  2AAE A;  3AGN A;  3UNL A;  1TU5 A;  1ULJ B;  3WMD A;  1V74 A;  5RNT A;  1NB3 I;  1OUN A;  1WNH A;  1AVL A;  1B21 A;  3KSP A;  1Q7H A;  2P05 A;  1VQK 3;  3MHE A;  1CYU A;  2GEX A;  2XSH B;  2R4I A;  1K73 4;  1UGI A;  5G1L A;  5M1A A;  4WYK A;  1IQX A;  3Q2P A;  4MMY B;  1BU4 A;  2HMO B;  3AHW A;  4AKZ A;  3U1W A;  4L8O A;  3PGB A;  3NX0 A;  1JB5 A;  3ER7 A;  4RNY A;  1IU7 A;  2Y74 A;  1B2M A;  2XFT A;  1DVD A;  1CQS A;  1AQZ A;  1LOW A;  1ZGX A;  4J5K A;  2HML B;  1PYL A;  3WR2 A;  1MWS A;  1STF I;  2HMM B;  4HM1 B;  1M90 4;  1HZ1 A;  1RJO A;  1OH0 A;  1MGW A;  3EHC A;  3NHX A;  1LOY A;  1E3R A;  2ML5 A;  3G0K A;  2OQE C;  7GSP A;  3CC7 3;  4I5Q A;  4EV5 A;  1YIT 3;  1EG9 B;  1W6C A;  3BU4 A;  3Q1C A;  1BNS A;  1WMP A;  4BL3 A;  3D79 A;  3OX9 A;  1IV9 A;  5BIR A;  2IUK A;  4X2O A;  3FG4 A;  3CXC 2;  3MG1 A;  1IT8 A;  1VQL 3;  2PNC A;  1LOX A;  1BRK A;  1FGR A;  2BNG A;  3ALA A;  3MYT A;  4MMZ B;  3S5C A;  3NQY A;  5CF2 A;  1CYV A;  3GSP A;  4WP5 A;  2Z76 A;  3EN1 B;  2QA4 3;  1B2X A;  3AMO A;  3JVC A;  3S29 A;  2V1L A;  3DH2 A;  2H0H A;  1WMN A;  2CFG A;  1SPU A;  4HOH A;  2F4Y A;  1JBR A;  3T8U A;  1DYU A;  1W01 A;  3K0Z A;  4KVH A;  3WOE B;  4STD A;  5JPP A;  1ZX2 A;  2F5W A;  5HGR A;  5IEP A;  2JDI H;  1IVX A;  4EXR A;  3CCJ 3;  4HJL B;  1BSA A;  2K3D A;  3A5E A;  2BU4 A;  2GU3 A;  3CC2 3;  1KQS 2;  3MWZ A;  1G96 A;  1RCL A;  3SED A;  1GMQ A;  1M1K 4;  1YNV X;  3A76 A;  3HI7 A;  4LMI A;  3J7Y d;  3K63 A;  1CEW I;  1LVN A;  2CHC A;  1IV7 A;  1JKG A;  3WHO A;  1UUV B;  4AKY A;  4HM2 B;  1GYB A;  4BTW A;  3Q90 A;  1OGZ A;  5D82 A;  1UCL A;  3JUO A;  3LTA A;  5FW5 A;  2HMK B;  3DM8 A;  2KRT A;  1R4Y A;  1BVI A;  3G6E 3;  3AGO A;  4HBR A;  2GBW B;  4HVN A;  1BIR A;  3RDE A;  1GY7 A;  1EEJ A;  1Z1S A;  3NBJ A;  2PZV A;  3F14 A;  3JUM A;  3DUK A;  1BSE A;  1Y4K A;  3F7X A;  4X2H A;  1I2G A;  1HKX A;  3UL6 A;  4HM3 B;  1YJW 3;  3CMA 3;  4GSP A;  3SVA A;  1AR0 A;  3B4O A;  1I0V A;  2CFL A;  3DY5 A;  3LXU X;  1NB5 I;  4FMB A;  1U8C B;  1W6G A;  2WGO A;  1N8Q A;  2P38 A;  2XFS A;  3DGM A;  3HIG A;  1VQO 3;  1TFK A;  2L1S A;  4O8S A;  2Y73 A;  3F9S A;  3CC4 3;  1Q40 A;  2UX0 A;  3EBT A;  4N3V A;  1VQ6 3;  3OWS A;  4DKI A;  1OF5 B;  3B8L A;  3K9M C;  4WFO A;  5IG0 A;  3SX1 A;  9RNT A;  3PCS A;  2HMN B;  1B3S A;  4RBN A;  4K61 A;  1FUW A;  2FGT A;  3STD A;  1VQ4 3;  3NQZ A;  1ASK A;  1RRL A;  3G16 A;  1BSB A;  3SOY A;  1B27 A;  3V99 A;  1X1W A;  4HAA A;  1RGA A;  1UI8 A;  3CCS 3;  2CX0 A;  1ULI B;  3FGY A;  3KKG A;  1YIJ 3;  3CPW 2;  3OXA A;  3D4A A;  1RN4 A;  1VQ5 3;  1A2P A;  3MG3 A;  1TTO A;  2KAA A;  3NXJ A;  4GL6 A;  4R1K A;  3T8N A;  1V58 A;  2K0M A;  3QRD A;  2OTL 3;  3MSO A;  4XDV A;  3H3H A;  2YFL B;  3DMC A;  3LT8 A;  1NO3 A;  5FGO A;  4OK0 A;  2HMJ B;  2CC3 A;  4FMC A;  2C11 A;  3G8Z A;  1N5P A;  4XDW A;  3WOF B;  3M8C A;  1X1U A;  4N6L A;  3S67 A;  4N6V 0;  1PY3 A;  3VGN A;  5JBS A;  2OCT A;  2CH9 A;  3OWY A;  1VQ9 3;  2C10 A;  1RGE A;  3AHS A;  3BNC A;  4CDL A;  4XBX A;  5CF1 A;  1LOV A;  1IT7 A;  3LT9 A;  1N5H A;  1W2Z A;  1RNB A;  1BNF A;  1YGW A;  1DMM A;  1JN5 B;  1GMR A;  2BMO B;  1PFP A;  1A2K A;  3FZW A;  5LC7 A;  2XF3 A;  2OWP A;  3SOA A;  2KF4 A;  1I2F A;  1FGQ A;  1DE3 A;  1KSI A;  1KWI A;  3WA2 X;  4LSO A;  5DRE A;  3D5I A;  3CCE 3;  1OCV A;  2UUG C;  3LZA A;  4JRF A;  2OOV A;  1FW7 A;  4LYL B;  1D6Z A;  1Q81 4;  1T2H A;  2P0M A;  3RNT A;  3LTC A;  3NV0 A;  1RHL A;  2XH9 A;  4O3V A;  2WO0 A;  1Q86 4;  7STD A;  2KF5 A;  2RSX A;  4EV2 A;  2CG0 A;  3GZX B;  1BOX A;  4N6T A;  1RN7 A;  4KFF A;  3SYU A;  4N6U A;  4LZI A;  5AIG A;  5D83 A;  1Q82 4;  2IY2 A;  4MJD A;  1F8N A;  5ELJ A;  1BSD A;  3PYJ A; 
#chains in the Genus database with same CATH homology
 3D9R A;  5CXO A;  3X3Z A;  1FGM A;  2YX9 A;  3EJV A;  3QK9 A;  2MF7 A;  4HKV B;  4FCJ A;  1JN5 A;  4WHA A;  1JV2 B;  1ROA A;  3S27 A;  1O7G B;  1U5O A;  2E2U A;  1EQK A;  1E97 A;  3DZL A;  2CK3 H;  3F40 A;  3X3Y A;  4RNZ A;  3IPT A;  2KXG A;  3KZT A;  3T0U A;  2RCD A;  3NM2 A;  3EX9 A;  1O7W B;  5BVB A;  4MEI A;  3CU3 A;  3VSY A;  3EF8 A;  4TX4 A;  4FR9 A;  4XBY A;  1O7H B;  3RGA A;  4JF8 A;  1OPY A;  1K28 A;  1OGX A;  1O7P B;  2OQE A;  1ROV A;  3FF0 A;  3BNE A;  4EYC A;  1OHP A;  3NBR A;  1K41 A;  5KP3 A;  1FGT A;  4NRE A;  4KZ1 A;  2L4V A;  1UI7 A;  3KII A;  4Q53 A;  3CCV 3;  2GU1 A;  1E3V A;  3LTD A;  4G1M B;  3FSD A;  3HX8 A;  3JUN A;  2YFJ B;  2Z6B A;  1FGO A;  1W02 A;  3CPO A;  3FG3 A;  4NHF A;  4J9A A;  1SIH A;  1VQ7 3;  1YHQ 3;  1GS3 A;  5STD A;  1GD3 A;  2E2V A;  3IJE B;  3ROB A;  4MMX B;  4EC6 A;  8CHO A;  4FCM A;  3I55 3;  1N8R 4;  3V98 A;  4R9L A;  2CG1 A;  4LGQ A;  2LQV A;  3LH4 A;  1DVC A;  3EBY A;  3L0R A;  3CD6 3;  3PS8 A;  1K8A 4;  3FLJ A;  2CFW A;  5IEN A;  1JB4 A;  1W4N A;  3FCS B;  3PZW A;  5AEW B;  1C7H A;  1N9E A;  4HZB B;  5AEU B;  4GB5 A;  2CFD A;  5IER A;  1NDO B;  3N54 B;  1RKY A;  3GZY B;  4HYZ A;  1QAK A;  2O3O A;  1QMA A;  4R9K A;  4U13 A;  3CCU 3;  3WA3 A;  1QAL A;  2W56 B;  4R4K A;  2CFK A;  2WGQ A;  2SBL A;  1YJN 3;  1SJW A;  3FKA A;  3VF1 A;  3NUV A;  1NWW A;  3BB9 A;  2LYX A;  3KE7 A;  3WOD G;  3X41 A;  3TDG A;  3F8H A;  1O7M B;  3EQQ B;  2RFR A;  5G2G A;  2STD A;  3BLZ A;  5AIF A;  4L8P A;  1D6U A;  3B7C A;  1M9G A;  3X40 A;  3G71 3;  1US1 A;  2D42 A;  3FF2 A;  4HZ9 B;  3SXX A;  4HM6 B;  5AII A;  4CCV A;  3JUQ A;  2CWV A;  2BMQ B;  2K54 A;  4QWT A;  2FXT A;  3HZP A;  4OUQ A;  1OF5 A;  1W00 A;  5KP1 A;  4K1U A;  1WQL B;  3DGN A;  4N6N B;  1GY5 A;  1K9M 4;  3MKI A;  4PEJ A;  2YFI B;  1W5Z A;  1VZZ A;  4O2H A;  2Q07 A;  1IQ8 A;  1TIJ A;  3CCR 3;  2WOH A;  1Q42 A;  3NM7 A;  3F8X A;  4ORL A;  5DRV A;  2KCD A;  1NJI 4;  1QVG 2;  2XSO B;  6STD A;  1Q7Y 4;  1VQN 3;  4I4K A;  2BT3 A;  4BTY A;  3H51 A;  3EE1 A;  5CK6 A;  1A90 A;  4BTX A;  1YI2 3;  4HM8 B;  3PCR A;  1FA3 A;  4HM4 B;  3DGL A;  3U97 A;  1VQ8 3;  2W04 A;  3CME 3;  1SII A;  3GZR A;  1KD1 4;  1OHS A;  1JNQ A;  3GRD A;  3I56 3;  4ZM8 A;  1N9J A;  5EVH A;  2QGU A;  1MOL A;  3O8Y A;  1IK3 A;  2IA7 A;  2W2C A;  3AMO B;  1YVB I;  1W6Y A;  3HII A;  2Z77 A;  3OWU A;  3MG2 A;  5JPU A;  2W9Q A;  3S28 A;  2IMJ A;  5KP4 A;  3WDG B;  3MPH A;  4FMD A;  5CLK A;  5TGN A;  3B4P A;  4FCZ A;  1DMN A;  3BND A;  5IEO A;  1W2B 2;  1EKM A;  4H3U A;  3V92 A;  1UUW B;  3KN4 A;  2INX A;  4N6O B;  1OHO A;  1KC8 4;  4RZM A;  2CKF B;  2W03 A;  3NBB A;  5IW9 A;  1D6Y A;  1S5A A;  1JKG B;  4XBT A;  1BUQ A;  3LML A;  5I97 A;  1O7N B;  2F98 A;  2Z7A A;  1JB2 A;  3UB1 A;  3I0Y A;  1TFO A;  1IQY A;  4XB5 A;  1IDP A;  4K1V A;  3PXM A;  3JUP A;  2D1W A;  3G4S 3;  5EQL A;  1IVV A;  2CIU A;  1TP6 A;  3E99 A;  2GXF A;  3LTB A;  3KSE D;  1JJ2 2;  2QIY A;  2B24 B;  4N6M A;  4O02 B;  4OVM A;  1HU9 A;  2IUJ A;  1J2B A;  3IMA B;  1IVU A;  4IT7 A;  2JQ5 A;  1QJG A;  2GBX B;  4KFE A;  1GD4 A;  1YJ9 3;  3DXO A;  1ISK A;  2XEP A;  3ECF A;  4IPB A;  1Q40 B;  4XM4 A;  1JRQ A;  2GEY A;  4AEQ A;  1GY6 A;  2P0X A;  1AV4 A;  5AYR B;  3HK4 A;  3DGO A;  4IIA A;  3UJM A;  1ZO2 A;  1DMQ A;  4K90 B;  4L7K A;  2XR8 B;  1UW1 A;  2RGQ A;  2ML6 A;  2P09 A;  2I9W A;  2WOF A;  2FNQ A;  1R4C A;  1A2V A;  3OW2 2;  3UL5 A;  2W6J H;  5EEO A;  2XGN A;  4KFD A;  3RGR A;  5IG5 A;  2CW9 A;  2F99 A;  2BO9 B;  1WMO A;  3CNX A;  2BHM A;  1NU3 A;  3GWR A;  2QEX 3;  5D81 A;  4FMA A;  1VQM 3;  2CWU A;  3K5T A;  4H61 A;  3GZB A;  2BMR B;  2M7O A;  1IVW A;  3GAX A;  2MC8 A;  3SLU A;  1QVF 2;  2F86 B;  1A67 A;  1PU4 A;  1OAC A;  4HM5 B;  4LEH A;  2A15 A;  4EBG A;  1S72 3;  2O9U X;  1MNL A;  3F7S A;  5ELU A;  3CCM 3;  5AIH A;  2CWT A;  5IG4 A;  4R80 A;  3X42 A;  4J8T A;  1L5G B;  3N9H A;  3D3L A;  1STD A;  1T5Y A;  1EA2 A;  3CCL 3;  1AVK A;  1WTH A;  2XRX B;  1RRH A;  1QAF A;  5IG3 A;  3EB8 A;  5AI1 A;  3EN8 A;  2OTJ 3;  2W56 A;  4WYK B;  3N8B A;  1TUH A;  5IF6 A;  1LXE A;  2OOV C;  4HM0 B;  3X3X A;  2ZL8 A;  1LNH A;  3NV0 B;  5BXQ A;  5LC6 A;  3CCQ 3;  1VQP 3;  2B1X B;  1M1X B;  3CNM A;  3LYG A;  5A0O B;  3LOY A;  2ZDJ A;  2E2T A;  3FG1 A;  1YGE A;  3FH1 A;  2W0Q A;  3BNB A;  3EC9 A;  1SQW A;  3K7C A;  3KFQ C;  4HM7 B;  1W7C A;  3OV4 A;  2W9P A;  2XGL A;  5AYS C;  3UNL A;  1TU5 A;  1ULJ B;  3WMD A;  1V74 A;  1NB3 I;  1OUN A;  1WNH A;  1AVL A;  3KSP A;  1VQK 3;  2P05 A;  3MHE A;  1CYU A;  2GEX A;  2XSH B;  2R4I A;  1K73 4;  4WYK A;  1IQX A;  3Q2P A;  4MMY B;  2HMO B;  4AKZ A;  3U1W A;  4L8O A;  3PGB A;  3NX0 A;  1JB5 A;  3ER7 A;  4RNY A;  1IU7 A;  2Y74 A;  1DVD A;  2XFT A;  1CQS A;  2HML B;  1STF I;  2HMM B;  4HM1 B;  1M90 4;  1RJO A;  1OH0 A;  3EHC A;  3NHX A;  1E3R A;  2ML5 A;  3G0K A;  2OQE C;  3CC7 3;  1YIT 3;  4EV5 A;  1EG9 B;  1W6C A;  3Q1C A;  1WMP A;  3OX9 A;  1IV9 A;  2IUK A;  4X2O A;  3FG4 A;  3CXC 2;  3MG1 A;  1IT8 A;  1VQL 3;  2PNC A;  1LOX A;  1FGR A;  2BNG A;  3ALA A;  3MYT A;  4MMZ B;  3S5C A;  5CF2 A;  3NQY A;  1CYV A;  4WP5 A;  2Z76 A;  3EN1 B;  2QA4 3;  3AMO A;  3JVC A;  3S29 A;  2V1L A;  1WMN A;  2CFG A;  1SPU A;  3T8U A;  1DYU A;  1W01 A;  3K0Z A;  4KVH A;  3WOE B;  4STD A;  5JPP A;  1ZX2 A;  5HGR A;  5IEP A;  2JDI H;  1IVX A;  4EXR A;  3CCJ 3;  4HJL B;  2GU3 A;  3CC2 3;  1KQS 2;  3MWZ A;  1G96 A;  3SED A;  1M1K 4;  3A76 A;  3HI7 A;  4LMI A;  3J7Y d;  3K63 A;  1LVN A;  1CEW I;  2CHC A;  1IV7 A;  1JKG A;  4AKY A;  1UUV B;  4HM2 B;  1GYB A;  4BTW A;  3Q90 A;  1OGZ A;  5D82 A;  3JUO A;  3LTA A;  5FW5 A;  2HMK B;  3DM8 A;  2KRT A;  3G6E 3;  4HBR A;  2GBW B;  4HVN A;  3RDE A;  1GY7 A;  1Z1S A;  3NBJ A;  2PZV A;  3F14 A;  3JUM A;  3DUK A;  3UL6 A;  1Y4K A;  3F7X A;  4X2H A;  1YJW 3;  1HKX A;  3CMA 3;  4HM3 B;  3SVA A;  1AR0 A;  3B4O A;  2CFL A;  3DY5 A;  3LXU X;  1NB5 I;  4FMB A;  1U8C B;  1W6G A;  2WGO A;  1N8Q A;  2P38 A;  2XFS A;  3DGM A;  3HIG A;  1VQO 3;  1TFK A;  4O8S A;  2Y73 A;  3F9S A;  3CC4 3;  1Q40 A;  2UX0 A;  3EBT A;  4N3V A;  1VQ6 3;  3OWS A;  1OF5 B;  3B8L A;  3K9M C;  4WFO A;  5IG0 A;  3SX1 A;  3PCS A;  2HMN B;  4RBN A;  4K61 A;  1FUW A;  2FGT A;  3STD A;  1VQ4 3;  3NQZ A;  1ASK A;  1RRL A;  3G16 A;  3SOY A;  3V99 A;  1UI8 A;  3CCS 3;  1ULI B;  3FGY A;  3KKG A;  1YIJ 3;  3CPW 2;  3OXA A;  1VQ5 3;  3MG3 A;  4GL6 A;  3NXJ A;  3T8N A;  4R1K A;  2K0M A;  3QRD A;  2OTL 3;  3MSO A;  4XDV A;  3H3H A;  2YFL B;  3DMC A;  3LT8 A;  1NO3 A;  5FGO A;  4OK0 A;  2HMJ B;  2CC3 A;  4FMC A;  2C11 A;  3G8Z A;  1N5P A;  4XDW A;  3WOF B;  3M8C A;  4N6L A;  3S67 A;  4N6V 0;  3VGN A;  5JBS A;  2OCT A;  2CH9 A;  3OWY A;  1VQ9 3;  2C10 A;  3BNC A;  4CDL A;  4XBX A;  5CF1 A;  1IT7 A;  3LT9 A;  1N5H A;  1W2Z A;  1DMM A;  1JN5 B;  2BMO B;  1PFP A;  1A2K A;  3FZW A;  5LC7 A;  2XF3 A;  2OWP A;  3SOA A;  1FGQ A;  1KSI A;  1KWI A;  3WA2 X;  4LSO A;  5DRE A;  3CCE 3;  1OCV A;  3LZA A;  2OOV A;  4JRF A;  1D6Z A;  1Q81 4;  2P0M A;  3LTC A;  3NV0 A;  2XH9 A;  4O3V A;  1Q86 4;  2WO0 A;  7STD A;  2RSX A;  4EV2 A;  2CG0 A;  3GZX B;  4N6T A;  1RN7 A;  4KFF A;  4N6U A;  4LZI A;  5AIG A;  5D83 A;  1Q82 4;  4MJD A;  1F8N A;  5ELJ A;  4WWU C;  3PYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...