4O2HA

Crystal structure of bcam1869 protein (rsam homolog) from burkholderia cenocepacia
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
TSPLLHPVPGPSPDGYVRLSEGALAALVLDHVASGLDPSLLAELRDNAIDARLAGYTEWHRTAGAGVAYVTVGWDWYLERATGTFVIAGGDVRSNVMAIDAKGADIGMLRTAAALAARLAALDWPAAVASALLGHND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RsaM: a transcriptional regulator of Burkholderia spp. with novel fold.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Structural genomics, unknown function
molecule keywords protein BCAM1869
total genus 33
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16245 DUF4902 Domain of unknown function (DUF4902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.610 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o2hA00
4O2HA
chains in the Genus database with same CATH superfamily
1TU5A 1MWSA 1ROAA 3KE7A 3CC73 3CCS3 2JQ5A 4FMCA 3OXAA 1W4NA 4EC6A 3H3HA 4AKYA 1YJW3 2W04A 3D5IA 4K1UA 2YFIB 3BNCA 1B3SA 1IVXA 1F8NA 1IDPA 1X1YA 3F9SA 1JB4A 1RGLA 1S723 2CWVA 3BU4A 1MGWA 1OACA 3MKIA 2ZL8A 2BO9B 2HMKB 1I0VA 4HM0B 3KSED 1GOUA 3I563 2W0QA 4HM6B 1UUGB 4BTYA 1W5ZA 4OVMA 1BRNL 2CX0A 2OOVA 1ISKA 1LVNA 4R9KA 1D6YA 3KN4A 2HMJB 3DY5A 5A0OB 2KCDA 1Z1SA 1A2PA 2XSOB 1M904 1BUQA 1G02A 3EHCA 4IPBA 3QK9A 1CYVA 2CFLA 2WGOA 3RGRA 4ILFA 4RNYA 1X1WA 3CMA3 1CH0A 3DGNA 1YJ93 4EYCA 1GMQA 4GL6A 1PYLA 2UX0A 1YJN3 4J5KA 5EEOA 3A5EA 3RGAA 1JJ22 4XB5A 1I8VA 1N5HA 2P0MA 3LOYA 1EQKA 1W00A 3GZXB 3NV0B 2I9WA 2RFRA 1Y4KA 2ML6A 1FUSA 4H61A 1OHPA 2FGTA 2KF5A 1QVF2 5CXOA 1VQ53 1LXEA 1I3FA 1W6CA 2F5WA 2WO0A 3F7SA 1IU7A 1OF5A 4EV5A 4LZIA 2CK3H 2IUKA 3F8HA 1I0XA 1OUNA 4GHOA 1FUWA 3KFQC 1BRIA 3DGLA 3ER7A 5BVBA 3K0ZA 1GD4A 1ROVA 4X2HA 4XBYA 2IUJA 1E3VA 4EXRA 1BSDA 1QMAA 2JDIH 2XFTA 1UDII 2XGNA 3BIRA 2C4BA 3OWSA 4J8TA 2W56B 1RN4A 2GXFA 2QGUA 4HM1B 5AIIA 3ZG0A 4AEQA 2D1WA 1BRSA 1RRLA 1RNTA 1HKXA 3GSPA 1KSIA 2CWUA 1K41A 4XDVA 3CNXA 4GSPA 3MHEA 1JBRA 1IT8A 3U97A 1K8A4 3BB9A 1GYBA 1JNQA 4BU4A 3DZLA 4RZMA 3DXOA 3CCR3 5JBSA 3OW22 1B27A 1FYSA 3EN8A 4XBTA 1AR0A 1IQYA 1MWTA 3CME3 1A2KA 1B20A 2Y74A 4FMBA 1D6UA 2BNGA 2L4VA 2OOVC 3HIGA 4HYZA 4EW5A 3G713 1BANA 2F98A 4NREA 1I2FA 3B4OA 4HOHA 3NV0A 1LOYA 3NBJA 2CX1A 3AGOA 1HU9A 2H0GA 2QIYA 1K28A 4R1KA 1NJI4 5IG5A 3BNBA 1NB3I 3NM7A 3NXJA 4RNTA 4LMIA 1TRQA 1OF5B 1K9M4 3ECFA 4HM2B 3JUOA 5DRVA 1VQN3 1RJOA 1JB2A 4O3VA 1FGOA 1NB5I 1M1XB 5IG0A 1RKYA 3RNTA 2KF4A 3V98A 1M1K4 4J5GA 1RTUA 1STFI 2W56A 5IEOA 3CC23 3CCM3 3CCU3 1BNRA 5FGOA 1S5AA 3DGYA 1KC84 3JUNA 1BNEA 3WA2X 1CEWI 1SIHA 1C7HA 5FW5A 3Q2PA 3VGNA 1PU4A 1C54A 5TGNA 1FA3A 2WOFA 1BGSA 1LQGC 4STDA 1AQZA 1OGZA 2KRTA 3HK4A 4MMYB 3UL6A 3PCRA 1UUVB 2CKFB 2KAAA 4CDLA 4AKZA 4KT3B 3FH1A 2Q07A 3F14A 1UCLA 1X1UA 1RCKA 5KP4A 4MMZB 3SLUA 1RGHA 2CFWA 3J7Yd 1BUJA 1VQQA 2O3OA 2STDA 3EBYA 4HM7B 2CW9A 3CD63 3PS8A 3G16A 1RCLA 1BAOA 2B24B 3UB1A 1RGEA 3WHOA 3ZFZA 3HX8A 1Q42A 2ML5A 2UGIA 4TX4A 1W6YA 3SXXA 1BNJA 1IVWA 3OV4A 1N9JA 5AYRB 2BU4A 1GMPA 1YHQ3 1WMOA 3I553 1WMPA 5CLKA 1VQ43 1Q40A 3NUVA 3CPOA 1MWRA 1N8QA 2W2CA 3CCJ3 3LTCA 3UJMA 2CFKA 2CHCA 1LQMB 3H51A 1J2BA 3OWYA 4NPBA 1I2GA 4MMXB 1VQ83 1KD14 1T2IA 1MNLA 2Y73A 1EUIC 2F56A 3LT9A 4RBNA 5EVHA 1Q824 3E99A 1IV7A 1VQ73 2F86B 2SBLA 1BNFA 3SX1A 4R80A 3T8NA 3MG3A 2AADA 1G0TA 3I0YA 3KIIA 1VZZA 1O7PB 2LYXA 3PGBA 2IY2A 5D81A 1NU3A 7GSPA 1UUWB 3Q90A 3EQQB 3AMOB 2P05A 1JB5A 5IEPA 3MG2A 1IK3A 3N9HA 4JRFA 3KKGA 1BRJA 3JUPA 4K90B 2RSXA 3EX9A 4XDWA 5KP3A 5IW9A 1SARA 5D82A 3X3XA 3LYGA 3FF2A 2K0MA 1IT7A 3FG4A 1UCIA 3MWZA 3AGNA 1BRKA 1CYUA 4XBXA 5ELUA 2W9QA 3FSDA 2BMRB 1UI8A 3NQZA 3LXUX 3NBRA 4GB5A 4HKVB 2B1XB 1BSAA 4J9AA 4LSOA 3EE1A 4BL2A 4FMAA 3X42A 1VQ93 3G4S3 5AEUB 2PNCA 3CNMA 1GY7A 3EF8A 2SARA 1RSNA 3CCE3 1VQL3 1N9EA 2ZDJA 2HOHA 4K61A 5M19A 1JBSA 4L8OA 1LNIA 3CCQ3 1AVKA 3PZWA 1UGHI 4MEIA 2BMOB 3LTDA 3PYJA 1BOXA 2L1SA 4ORLA 5G1LA 4HJLB 1IVVA 5AEWB 3X41A 2YX9A 2F5MA 4HM3B 2E2TA 3S67A 2C10A 1FGRA 1GS3A 3U1WA 1BSEA 3WODG 5RNTA 1JV2B 2YFJB 1L5GB 1JRQA 1LOXA 2WGQA 1DMNA 2XR8B 8CHOA 3K7CA 3CXC2 4OK0A 2WOHA 1B2XA 3HOHA 1GOYA 2RNTA 3PCSA 5BIRA 1NWWA 1TIJA 2PZVA 2V1LA 1TUHA 2BHMA 3FGYA 5IG3A 3DGOA 1N8R4 1Q7Y4 4I4KA 7RNTA 2H0HA 4WYKB 4HZBB 3S27A 1DETA 2LQVA 5JPUA 2QEX3 3L0RA 5BXQA 5EQLA 3GZBA 1JN5B 2CC3A 1BIRA 3MSOA 4Q53A 4CJNA 3WA3A 2OTJ3 1O7GB 3CC43 1RGGA 1KQS2 3K9MC 4FCMA 4N6LA 1RGCA 1N5PA 1Q40B 2BIRA 2P0XA 4LEHA 4QWTA 4CPKA 1X1XA 4FR9A 1BU4A 4WFOA 1ZGXA 2K54A 3BLZA 5AI1A 3SOYA 3D5GA 5GSPA 3M8CA 3T8UA 5IG4A 1SPUA 4KFFA 2XF3A 3SEDA 3KZTA 3S5CA 3WDGB 3WOEB 1OPYA 2CH9A 4HM8B 1TFKA 3MG1A 2ZHXB 2XEPA 4CCVA 1W01A 3AMOA 1IV9A 3B4PA 2W03A 3N8BA 3VF1A 2D42A 1KWIA 2UUGC 5DREA 1RGKA 3DM8A 1GD3A 1FUTA 1BSBA 2BT3A 5HGRA 1R4YA 4HAAA 3EJVA 1U8CB 4N6NB 4HM4B 1LRAA 5AIHA 2QA43 1DVCA 2HMOB 3FZWA 1VQO3 3NQYA 1TJDA 2CG0A 1BVIA 2KF3A 1R4CA 4U13A 4WYKA 5G1KA 1LOVA 3LZAA 1YVSA 1BRGA 1YVBI 3SOAA 3D9RA 1T3BA 3CCV3 1EEJA 1E3RA 1O7MB 3KCHA 1EG9B 1TTOA 1OGXA 2RCDA 3GWRA 3G0KA 4H3UA 3AHWA 5JPPA 1ULJB 4EV2A 1RRHA 1PFPA 4MJDA 4R4KA 4LYLB 3V92A 2OQEA 4BL3A 3QRDA 6STDA 3DUKA 2AAEA 3D79A 1O7HB 4XM4A 5LC6A 1HZ1A 4K1VA 1M9GA 1I3IA 1W7CA 5ELJA 1ZO2A 1A2VA 1RDSA 1GMRA 1WMNA 3F7XA 4N6OB 2CG1A 3DMCA 1CQSA 2XGLA 3ROBA 3GZRA 4KFEA 1NO3A 2GU3A 3V99A 3CCL3 4O02B 4N6V0 2XSHB 2R4IA 1LOWA 1JZOA 1GSPA 2F99A 2RBIA 5IF6A 4DKIA 1NNVA 3RDEA 1IQ8A 4HBRA 1IYYA 3HZPA 3NBBA 1VQP3 1SQWA 3DGMA 2Z76A 5AYSC 3VSYA 4L8PA 2KF6A 2P09A 3WR2A 5CF2A 4FMDA 2XH9A 3GAXA 4WHAA 3FCSB 4NHFA 2E2UA 3JUQA 1DYUA 2F4YA 2YFLB 2GEYA 2XRXB 1FZUA 1UCJA 5CK6A 1DMMA 1JN5A 1UCKA 1UW1A 5LC7A 3SVAA 4BIRA 4JF8A 1QALA 2IYJA 3LMLA 3T0UA 1W2ZA 1GOVA 2Z77A 4WP5A 4N6UA 1RHLA 2BMQB 3KSPA 1VQK3 1OH0A 1BNSA 3BNDA 4HM5B 2INXA 7STDA 4ZM8A 3LTBA 3S29A 1JBTA 6GSPA 1B2ZA 1YGEA 5IENA 1D6ZA 2A15A 2O9UX 1RN7A 1JKGB 3BNEA 3D4AA 4BTXA 3A76A 3STDA 3WOFB 1US1A 3X3YA 1O7NB 4HZ9B 2FXTA 1T5YA 3F40A 4EBGA 3GRDA 3GZYB 3K63A 1YGWA 4O2HA 1A67A 2K3DA 2OQEC 4KFDA 1IQXA 1MGRA 2KXGA 3G8ZA 1WTHA 9RNTA 4L7KA 3HIIA 3UNLA 4G1MB 5G2GA 4I5QA 3ALAA 4FCJA 2GBXB 1BRHA 2GBWB 3CU3A 5KP1A 3JVCA 3IPTA 1EKMA 1RNBA 2OCTA 5STDA 1TRPA 1SJWA 5AIGA 2FNQA 1BNIA 1RLSA 1ZS7A 1AV4A 1STDA 4RNZA 1W02A 3TDGA 1ZX2A 4FCZA 3URPA 5M1AA 3UL5A 2R41A 1ULIB 3NX0A 3K5TA 3N54B 2OTL3 1A90A 1B21A 3FKAA 1MOLA 1YIT3 1B2MA 1RGAA 1V57A 3F8XA 1TFOA 1IVUA 1TP6A 1VQM3 2Z7AA 1FW7A 1DE3A 1Q814 1NDOB 1OCVA 2XFSA 1I2EA 8RNTA 2E2VA 2GU1A 4PEJA 2IA7A 4N6MA 1UI7A 1BSCA 1HYFA 2W9PA 3DH2A 1Q7HA 5I97A 1RN1A 1GY5A 4WWUC 1W2B2 1Q9EA 1FGQA 2MF7A 2W6JH 1T2HA 3EB8A 3G6E3 1ASKA 1V74A 3IMAB 1FGTA 3Q1CA 3Q3FA 4N6TA 4LGQA 4X2OA 2GEXA 1K734 1LNHA 2C11A 1YI23 3NHXA 3X3ZA 3SYUA 1OHOA 3EBTA 1PY3A 3EC9A 3HI7A 2MC8A 2IMJA 1WNHA 5IERA 1V58A 3LT8A 1E97A 3LTAA 3B7CA 5BU4A 3B8LA 2ZA4A 4IIAA 4IT7A 1MWUA 3X40A 1QAKA 1G96A 3EN1B 3FG1A 2J8XB 1GY6A 1WQLB 5M18A 1U5OA 1Q864 1BNGA 4R9LA 5AIFA 3O8YA 3WMDA 1RMSA 1RGFA 1B2UA 1YIJ3 2OWPA 3FLJA 1VQ63 1QJGA 4BTWA 1I70A 5D83A 2CFGA 1W6GA 2HMNB 1OHSA 3IJEB 3PXMA 2CIUA 2CWTA 4KVHA 4O8SA 2GSPA 4OUQA 3ZG5A 1SIIA 1YNVX 2RGQA 3D3LA 3CPW2 2M7OA 3AHSA 3NM2A 1QVG2 1JKGA 3OX9A 1DMQA 3JUMA 2H0IA 1DVDA 1JZDA 2HMMB 1UGIA 2CFDA 3LH4A 2Z6BA 3FF0A 3MYTA 4HVNA 1FGMA 3OWUA 1AY7A 3MPHA 5CF1A 1AVLA 1O7WB 5HOHA 3S28A 6RNTA 3FG3A 1QAFA 2P38A 4N3VA 1B2SA 4KZ1A 2HMLB 1EA2A
chains in the Genus database with same CATH topology
1TU5A 3CCS3 1ROAA 3KE7A 3CC73 2JQ5A 4FMCA 1W4NA 4EC6A 3H3HA 4AKYA 1YJW3 2W04A 4K1UA 2YFIB 3BNCA 1F8NA 1IVXA 1IDPA 3F9SA 1S723 1JB4A 2CWVA 1OACA 3MKIA 2ZL8A 2BO9B 2HMKB 4HM0B 3KSED 3I563 2W0QA 4HM6B 4BTYA 1W5ZA 4OVMA 2OOVA 1ISKA 1LVNA 4R9KA 1D6YA 3KN4A 2HMJB 3DY5A 5A0OB 2KCDA 1Z1SA 2XSOB 1M904 1BUQA 4IPBA 3EHCA 3QK9A 1CYVA 2CFLA 2WGOA 3RGRA 4RNYA 3CMA3 3DGNA 1YJ93 4EYCA 4GL6A 2UX0A 1YJN3 3RGAA 5EEOA 1JJ22 4XB5A 1EQKA 1N5HA 2P0MA 3LOYA 1W00A 3GZXB 3NV0B 2I9WA 2RFRA 1Y4KA 2ML6A 4H61A 1OHPA 2FGTA 1QVF2 5CXOA 1VQ53 1LXEA 1W6CA 2WO0A 3F7SA 1IU7A 1OF5A 4EV5A 4LZIA 2CK3H 2IUKA 3F8HA 1OUNA 1FUWA 3KFQC 3DGLA 3ER7A 5BVBA 3K0ZA 1GD4A 1ROVA 4X2HA 4XBYA 2IUJA 1E3VA 4EXRA 1QMAA 2JDIH 2XFTA 2XGNA 3OWSA 4J8TA 2W56B 5AIIA 2GXFA 2QGUA 4HM1B 4AEQA 2D1WA 1RRLA 1HKXA 1KSIA 2CWUA 1K41A 4XDVA 3CNXA 3MHEA 1IT8A 3U97A 1K8A4 3BB9A 1GYBA 1JNQA 3DZLA 4RZMA 3DXOA 3CCR3 5JBSA 3OW22 3EN8A 4XBTA 1AR0A 1IQYA 3CME3 1A2KA 4FMBA 2Y74A 1D6UA 2BNGA 2L4VA 2OOVC 3HIGA 4HYZA 3G713 2F98A 4NREA 3B4OA 3NV0A 3NBJA 1HU9A 4R1KA 2QIYA 1K28A 1NJI4 5IG5A 3BNBA 1NB3I 3NM7A 3NXJA 4LMIA 1K9M4 1OF5B 3ECFA 4HM2B 3JUOA 5DRVA 1VQN3 1RJOA 1JB2A 4O3VA 1FGOA 1NB5I 1M1XB 5IG0A 3V98A 1M1K4 5IEOA 2W56A 1STFI 3CC23 3CCM3 3CCU3 5FGOA 1S5AA 3JUNA 3WA2X 1CEWI 1SIHA 1C7HA 5FW5A 3Q2PA 3VGNA 1PU4A 5TGNA 1FA3A 2WOFA 4STDA 2KRTA 1OGZA 3HK4A 4MMYB 3UL6A 3PCRA 1UUVB 2CKFB 4CDLA 4AKZA 3FH1A 2Q07A 3F14A 5KP4A 4MMZB 3SLUA 2CFWA 3J7Yd 2O3OA 2STDA 3EBYA 4HM7B 2CW9A 3CD63 3PS8A 3G16A 2B24B 3UB1A 3HX8A 1Q42A 2ML5A 4TX4A 1W6YA 3SXXA 1IVWA 3OV4A 1N9JA 5AYRB 1YHQ3 1WMOA 3I553 1WMPA 5CLKA 1VQ43 1Q40A 3NUVA 3CPOA 1N8QA 2W2CA 3CCJ3 3LTCA 3UJMA 2CFKA 2CHCA 3H51A 1J2BA 3OWYA 1VQ83 4MMXB 1KD14 2Y73A 1MNLA 3LT9A 4RBNA 5EVHA 1Q824 3E99A 1IV7A 1VQ73 2F86B 2SBLA 3SX1A 4R80A 3T8NA 3MG3A 3I0YA 3KIIA 1VZZA 1O7PB 3PGBA 5D81A 1NU3A 1UUWB 3Q90A 3EQQB 3AMOB 2P05A 1JB5A 5IEPA 3MG2A 1IK3A 3N9HA 3KKGA 3JUPA 4K90B 2RSXA 3EX9A 4XDWA 5KP3A 5IW9A 5D82A 3X3XA 3LYGA 3FF2A 2K0MA 1IT7A 3FG4A 1CYUA 3MWZA 4XBXA 5ELUA 2W9QA 3FSDA 2BMRB 1UI8A 3NQZA 3LXUX 3NBRA 4GB5A 4HKVB 2B1XB 4JRFA 4J9AA 4LSOA 3EE1A 1VQ93 4FMAA 3X42A 3G4S3 5AEUB 2PNCA 3CNMA 1GY7A 3EF8A 3CCE3 1VQL3 1N9EA 2ZDJA 4K61A 4L8OA 3CCQ3 1AVKA 3PZWA 4MEIA 2BMOB 3LTDA 3PYJA 4ORLA 4HJLB 1IVVA 5AEWB 3X41A 2YX9A 4HM3B 2E2TA 3S67A 2C10A 1FGRA 1GS3A 3U1WA 3WODG 1RKYA 1JV2B 2YFJB 1L5GB 1LOXA 1JRQA 2WGQA 1DMNA 2XR8B 8CHOA 3K7CA 3CXC2 4OK0A 2WOHA 3PCSA 1NWWA 1TIJA 2PZVA 2V1LA 1TUHA 2BHMA 3FGYA 5IG3A 3DGOA 1N8R4 1Q7Y4 4I4KA 4WYKB 4HZBB 3S27A 2LQVA 5JPUA 2QEX3 3L0RA 5BXQA 5EQLA 3GZBA 1JN5B 2CC3A 3MSOA 4Q53A 3WA3A 2OTJ3 1O7GB 3CC43 1KQS2 3K9MC 4FCMA 4N6LA 1N5PA 1Q40B 2P0XA 4LEHA 4QWTA 4FR9A 4WFOA 2K54A 3BLZA 5AI1A 3SOYA 3T8UA 5IG4A 3M8CA 1SPUA 4KFFA 2XF3A 3SEDA 3KZTA 3S5CA 3WDGB 3WOEB 1OPYA 2CH9A 4HM8B 1TFKA 3MG1A 2XEPA 4CCVA 1W01A 3AMOA 1IV9A 3B4PA 2W03A 3N8BA 3VF1A 2D42A 1KWIA 5DREA 3DM8A 1GD3A 2BT3A 5HGRA 3EJVA 1U8CB 4N6NB 4HM4B 5AIHA 2QA43 1DVCA 2HMOB 3FZWA 1VQO3 3NQYA 2CG0A 1R4CA 4U13A 4WYKA 3LZAA 1YVBI 3SOAA 3D9RA 3CCV3 1E3RA 1O7MB 1EG9B 1OGXA 2RCDA 3GWRA 3G0KA 4H3UA 5JPPA 1ULJB 4EV2A 1RRHA 1PFPA 4MJDA 4R4KA 3V92A 6STDA 2OQEA 3QRDA 3DUKA 1O7HB 4XM4A 5LC6A 4K1VA 1M9GA 1W7CA 5ELJA 1ZO2A 1A2VA 3F7XA 1WMNA 4N6OB 2CG1A 3DMCA 1CQSA 2XGLA 3ROBA 3GZRA 4KFEA 1NO3A 2GU3A 3V99A 3CCL3 4O02B 4N6V0 2XSHB 2R4IA 1EA2A 5IF6A 2F99A 3RDEA 1IQ8A 4HBRA 3HZPA 3NBBA 1VQP3 1SQWA 3DGMA 2Z76A 5AYSC 3VSYA 4L8PA 2P09A 5CF2A 4FMDA 2XH9A 3GAXA 4WHAA 3FCSB 4NHFA 2E2UA 3JUQA 1DYUA 2YFLB 5CK6A 2GEYA 2XRXB 1DMMA 1JN5A 1UW1A 5LC7A 3SVAA 4JF8A 1QALA 3LMLA 3T0UA 1W2ZA 2Z77A 4WP5A 4N6UA 2BMQB 3KSPA 1VQK3 1OH0A 3BNDA 4HM5B 2INXA 7STDA 4ZM8A 3LTBA 3S29A 1YGEA 5IENA 1D6ZA 2A15A 2O9UX 1RN7A 1JKGB 3BNEA 4BTXA 3A76A 3STDA 3WOFB 1US1A 3X3YA 1O7NB 4HZ9B 2FXTA 1T5YA 3F40A 4EBGA 3GRDA 3GZYB 3K63A 4O2HA 1A67A 2OQEC 4KFDA 1IQXA 2KXGA 3G8ZA 1WTHA 4L7KA 3HIIA 3UNLA 4G1MB 5G2GA 3ALAA 4FCJA 2GBXB 2GBWB 3CU3A 5KP1A 3JVCA 3IPTA 1EKMA 2OCTA 5STDA 5AIGA 1SJWA 2FNQA 1AV4A 1STDA 4RNZA 1W02A 3TDGA 1ZX2A 4FCZA 3UL5A 3NX0A 1ULIB 3K5TA 3N54B 2OTL3 1A90A 3FKAA 1MOLA 1YIT3 3F8XA 1TFOA 1IVUA 1TP6A 1VQM3 2Z7AA 1Q814 1NDOB 1OCVA 2XFSA 2E2VA 2GU1A 4PEJA 2IA7A 4N6MA 1UI7A 2W9PA 1W2B2 5I97A 4WWUC 1GY5A 1FGQA 2MF7A 2W6JH 3EB8A 3G6E3 1ASKA 1V74A 3IMAB 1FGTA 3Q1CA 4N6TA 4LGQA 4X2OA 2GEXA 1K734 1LNHA 2C11A 1YI23 3NHXA 3X3ZA 1OHOA 3EBTA 3EC9A 3HI7A 2MC8A 2IMJA 1WNHA 5IERA 3LT8A 1E97A 3LTAA 3B7CA 3B8LA 4IIAA 4IT7A 3X40A 1QAKA 1G96A 3EN1B 3FG1A 1GY6A 1WQLB 1U5OA 1Q864 5AIFA 4R9LA 3O8YA 3WMDA 1YIJ3 2OWPA 3FLJA 1VQ63 1QJGA 4BTWA 5D83A 2CFGA 1W6GA 2HMNB 1OHSA 3IJEB 3PXMA 2CIUA 2CWTA 4KVHA 4O8SA 4OUQA 3CPW2 1KC84 1SIIA 1QVG2 3D3LA 2RGQA 2M7OA 3NM2A 1JKGA 3OX9A 1DMQA 3JUMA 1DVDA 3MYTA 2HMMB 2CFDA 3LH4A 2Z6BA 3FF0A 4HVNA 1FGMA 3OWUA 3MPHA 5CF1A 1AVLA 1O7WB 3S28A 3FG3A 1QAFA 2P38A 4N3VA 3OXAA 4KZ1A 2HMLB 2LYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2H A; 
#chains in the Genus database with same CATH topology
 1TU5 A;  1MWS A;  1ROA A;  3KE7 A;  3CC7 3;  3CCS 3;  2JQ5 A;  4FMC A;  3OXA A;  1W4N A;  4EC6 A;  3H3H A;  4AKY A;  1YJW 3;  2W04 A;  3D5I A;  4K1U A;  2YFI B;  3BNC A;  1B3S A;  1IVX A;  1F8N A;  1IDP A;  1X1Y A;  3F9S A;  1JB4 A;  1RGL A;  1S72 3;  2CWV A;  3BU4 A;  1MGW A;  1OAC A;  3MKI A;  2ZL8 A;  2BO9 B;  2HMK B;  1I0V A;  4HM0 B;  3KSE D;  1GOU A;  3I56 3;  2W0Q A;  4HM6 B;  1UUG B;  4BTY A;  1W5Z A;  4OVM A;  1BRN L;  2CX0 A;  2OOV A;  1ISK A;  1LVN A;  4R9K A;  1D6Y A;  3KN4 A;  2HMJ B;  3DY5 A;  5A0O B;  2KCD A;  1Z1S A;  1A2P A;  2XSO B;  1M90 4;  1BUQ A;  1G02 A;  3EHC A;  4IPB A;  3QK9 A;  1CYV A;  2CFL A;  2WGO A;  3RGR A;  4ILF A;  4RNY A;  1X1W A;  3CMA 3;  1CH0 A;  3DGN A;  1YJ9 3;  4EYC A;  1GMQ A;  4GL6 A;  1PYL A;  2UX0 A;  1YJN 3;  4J5K A;  5EEO A;  3A5E A;  3RGA A;  1JJ2 2;  4XB5 A;  1I8V A;  1N5H A;  2P0M A;  3LOY A;  1EQK A;  1W00 A;  3GZX B;  3NV0 B;  2I9W A;  2RFR A;  1Y4K A;  2ML6 A;  1FUS A;  4H61 A;  1OHP A;  2FGT A;  2KF5 A;  1QVF 2;  5CXO A;  1VQ5 3;  1LXE A;  1I3F A;  1W6C A;  2F5W A;  2WO0 A;  3F7S A;  1IU7 A;  1OF5 A;  4EV5 A;  4LZI A;  2CK3 H;  2IUK A;  3F8H A;  1I0X A;  1OUN A;  4GHO A;  1FUW A;  3KFQ C;  1BRI A;  3DGL A;  3ER7 A;  5BVB A;  3K0Z A;  1GD4 A;  1ROV A;  4X2H A;  4XBY A;  2IUJ A;  1E3V A;  4EXR A;  1BSD A;  1QMA A;  2JDI H;  2XFT A;  1UDI I;  2XGN A;  3BIR A;  2C4B A;  3OWS A;  4J8T A;  2W56 B;  1RN4 A;  2GXF A;  2QGU A;  4HM1 B;  5AII A;  3ZG0 A;  4AEQ A;  2D1W A;  1BRS A;  1RRL A;  1RNT A;  1HKX A;  3GSP A;  1KSI A;  2CWU A;  1K41 A;  4XDV A;  3CNX A;  4GSP A;  3MHE A;  1JBR A;  1IT8 A;  3U97 A;  1K8A 4;  3BB9 A;  1GYB A;  1JNQ A;  4BU4 A;  3DZL A;  4RZM A;  3DXO A;  3CCR 3;  5JBS A;  3OW2 2;  1B27 A;  1FYS A;  3EN8 A;  4XBT A;  1AR0 A;  1IQY A;  1MWT A;  3CME 3;  1A2K A;  1B20 A;  2Y74 A;  4FMB A;  1D6U A;  2BNG A;  2L4V A;  2OOV C;  3HIG A;  4HYZ A;  4EW5 A;  3G71 3;  1BAN A;  2F98 A;  4NRE A;  1I2F A;  3B4O A;  4HOH A;  3NV0 A;  1LOY A;  3NBJ A;  2CX1 A;  3AGO A;  1HU9 A;  2H0G A;  2QIY A;  1K28 A;  4R1K A;  1NJI 4;  5IG5 A;  3BNB A;  1NB3 I;  3NM7 A;  3NXJ A;  4RNT A;  4LMI A;  1TRQ A;  1OF5 B;  1K9M 4;  3ECF A;  4HM2 B;  3JUO A;  5DRV A;  1VQN 3;  1RJO A;  1JB2 A;  4O3V A;  1FGO A;  1NB5 I;  1M1X B;  5IG0 A;  1RKY A;  3RNT A;  2KF4 A;  3V98 A;  1M1K 4;  4J5G A;  1RTU A;  1STF I;  2W56 A;  5IEO A;  3CC2 3;  3CCM 3;  3CCU 3;  1BNR A;  5FGO A;  1S5A A;  3DGY A;  1KC8 4;  3JUN A;  1BNE A;  3WA2 X;  1CEW I;  1SIH A;  1C7H A;  5FW5 A;  3Q2P A;  3VGN A;  1PU4 A;  1C54 A;  5TGN A;  1FA3 A;  2WOF A;  1BGS A;  1LQG C;  4STD A;  1AQZ A;  1OGZ A;  2KRT A;  3HK4 A;  4MMY B;  3UL6 A;  3PCR A;  1UUV B;  2CKF B;  2KAA A;  4CDL A;  4AKZ A;  4KT3 B;  3FH1 A;  2Q07 A;  3F14 A;  1UCL A;  1X1U A;  1RCK A;  5KP4 A;  4MMZ B;  3SLU A;  1RGH A;  2CFW A;  3J7Y d;  1BUJ A;  1VQQ A;  2O3O A;  2STD A;  3EBY A;  4HM7 B;  2CW9 A;  3CD6 3;  3PS8 A;  3G16 A;  1RCL A;  1BAO A;  2B24 B;  3UB1 A;  1RGE A;  3WHO A;  3ZFZ A;  3HX8 A;  1Q42 A;  2ML5 A;  2UGI A;  4TX4 A;  1W6Y A;  3SXX A;  1BNJ A;  1IVW A;  3OV4 A;  1N9J A;  5AYR B;  2BU4 A;  1GMP A;  1YHQ 3;  1WMO A;  3I55 3;  1WMP A;  5CLK A;  1VQ4 3;  1Q40 A;  3NUV A;  3CPO A;  1MWR A;  1N8Q A;  2W2C A;  3CCJ 3;  3LTC A;  3UJM A;  2CFK A;  2CHC A;  1LQM B;  3H51 A;  1J2B A;  3OWY A;  4NPB A;  1I2G A;  4MMX B;  1VQ8 3;  1KD1 4;  1T2I A;  1MNL A;  2Y73 A;  1EUI C;  2F56 A;  3LT9 A;  4RBN A;  5EVH A;  1Q82 4;  3E99 A;  1IV7 A;  1VQ7 3;  2F86 B;  2SBL A;  1BNF A;  3SX1 A;  4R80 A;  3T8N A;  3MG3 A;  2AAD A;  1G0T A;  3I0Y A;  3KII A;  1VZZ A;  1O7P B;  2LYX A;  3PGB A;  2IY2 A;  5D81 A;  1NU3 A;  7GSP A;  1UUW B;  3Q90 A;  3EQQ B;  3AMO B;  2P05 A;  1JB5 A;  5IEP A;  3MG2 A;  1IK3 A;  3N9H A;  4JRF A;  3KKG A;  1BRJ A;  3JUP A;  4K90 B;  2RSX A;  3EX9 A;  4XDW A;  5KP3 A;  5IW9 A;  1SAR A;  5D82 A;  3X3X A;  3LYG A;  3FF2 A;  2K0M A;  1IT7 A;  3FG4 A;  1UCI A;  3MWZ A;  3AGN A;  1BRK A;  1CYU A;  4XBX A;  5ELU A;  2W9Q A;  3FSD A;  2BMR B;  1UI8 A;  3NQZ A;  3LXU X;  3NBR A;  4GB5 A;  4HKV B;  2B1X B;  1BSA A;  4J9A A;  4LSO A;  3EE1 A;  4BL2 A;  4FMA A;  3X42 A;  1VQ9 3;  3G4S 3;  5AEU B;  2PNC A;  3CNM A;  1GY7 A;  3EF8 A;  2SAR A;  1RSN A;  3CCE 3;  1VQL 3;  1N9E A;  2ZDJ A;  2HOH A;  4K61 A;  5M19 A;  1JBS A;  4L8O A;  1LNI A;  3CCQ 3;  1AVK A;  3PZW A;  1UGH I;  4MEI A;  2BMO B;  3LTD A;  3PYJ A;  1BOX A;  2L1S A;  4ORL A;  5G1L A;  4HJL B;  1IVV A;  5AEW B;  3X41 A;  2YX9 A;  2F5M A;  4HM3 B;  2E2T A;  3S67 A;  2C10 A;  1FGR A;  1GS3 A;  3U1W A;  1BSE A;  3WOD G;  5RNT A;  1JV2 B;  2YFJ B;  1L5G B;  1JRQ A;  1LOX A;  2WGQ A;  1DMN A;  2XR8 B;  8CHO A;  3K7C A;  3CXC 2;  4OK0 A;  2WOH A;  1B2X A;  3HOH A;  1GOY A;  2RNT A;  3PCS A;  5BIR A;  1NWW A;  1TIJ A;  2PZV A;  2V1L A;  1TUH A;  2BHM A;  3FGY A;  5IG3 A;  3DGO A;  1N8R 4;  1Q7Y 4;  4I4K A;  7RNT A;  2H0H A;  4WYK B;  4HZB B;  3S27 A;  1DET A;  2LQV A;  5JPU A;  2QEX 3;  3L0R A;  5BXQ A;  5EQL A;  3GZB A;  1JN5 B;  2CC3 A;  1BIR A;  3MSO A;  4Q53 A;  4CJN A;  3WA3 A;  2OTJ 3;  1O7G B;  3CC4 3;  1RGG A;  1KQS 2;  3K9M C;  4FCM A;  4N6L A;  1RGC A;  1N5P A;  1Q40 B;  2BIR A;  2P0X A;  4LEH A;  4QWT A;  4CPK A;  1X1X A;  4FR9 A;  1BU4 A;  4WFO A;  1ZGX A;  2K54 A;  3BLZ A;  5AI1 A;  3SOY A;  3D5G A;  5GSP A;  3M8C A;  3T8U A;  5IG4 A;  1SPU A;  4KFF A;  2XF3 A;  3SED A;  3KZT A;  3S5C A;  3WDG B;  3WOE B;  1OPY A;  2CH9 A;  4HM8 B;  1TFK A;  3MG1 A;  2ZHX B;  2XEP A;  4CCV A;  1W01 A;  3AMO A;  1IV9 A;  3B4P A;  2W03 A;  3N8B A;  3VF1 A;  2D42 A;  1KWI A;  2UUG C;  5DRE A;  1RGK A;  3DM8 A;  1GD3 A;  1FUT A;  1BSB A;  2BT3 A;  5HGR A;  1R4Y A;  4HAA A;  3EJV A;  1U8C B;  4N6N B;  4HM4 B;  1LRA A;  5AIH A;  2QA4 3;  1DVC A;  2HMO B;  3FZW A;  1VQO 3;  3NQY A;  1TJD A;  2CG0 A;  1BVI A;  2KF3 A;  1R4C A;  4U13 A;  4WYK A;  5G1K A;  1LOV A;  3LZA A;  1YVS A;  1BRG A;  1YVB I;  3SOA A;  3D9R A;  1T3B A;  3CCV 3;  1EEJ A;  1E3R A;  1O7M B;  3KCH A;  1EG9 B;  1TTO A;  1OGX A;  2RCD A;  3GWR A;  3G0K A;  4H3U A;  3AHW A;  5JPP A;  1ULJ B;  4EV2 A;  1RRH A;  1PFP A;  4MJD A;  4R4K A;  4LYL B;  3V92 A;  2OQE A;  4BL3 A;  3QRD A;  6STD A;  3DUK A;  2AAE A;  3D79 A;  1O7H B;  4XM4 A;  5LC6 A;  1HZ1 A;  4K1V A;  1M9G A;  1I3I A;  1W7C A;  5ELJ A;  1ZO2 A;  1A2V A;  1RDS A;  1GMR A;  1WMN A;  3F7X A;  4N6O B;  2CG1 A;  3DMC A;  1CQS A;  2XGL A;  3ROB A;  3GZR A;  4KFE A;  1NO3 A;  2GU3 A;  3V99 A;  3CCL 3;  4O02 B;  4N6V 0;  2XSH B;  2R4I A;  1LOW A;  1JZO A;  1GSP A;  2F99 A;  2RBI A;  5IF6 A;  4DKI A;  1NNV A;  3RDE A;  1IQ8 A;  4HBR A;  1IYY A;  3HZP A;  3NBB A;  1VQP 3;  1SQW A;  3DGM A;  2Z76 A;  5AYS C;  3VSY A;  4L8P A;  2KF6 A;  2P09 A;  3WR2 A;  5CF2 A;  4FMD A;  2XH9 A;  3GAX A;  4WHA A;  3FCS B;  4NHF A;  2E2U A;  3JUQ A;  1DYU A;  2F4Y A;  2YFL B;  2GEY A;  2XRX B;  1FZU A;  1UCJ A;  5CK6 A;  1DMM A;  1JN5 A;  1UCK A;  1UW1 A;  5LC7 A;  3SVA A;  4BIR A;  4JF8 A;  1QAL A;  2IYJ A;  3LML A;  3T0U A;  1W2Z A;  1GOV A;  2Z77 A;  4WP5 A;  4N6U A;  1RHL A;  2BMQ B;  3KSP A;  1VQK 3;  1OH0 A;  1BNS A;  3BND A;  4HM5 B;  2INX A;  7STD A;  4ZM8 A;  3LTB A;  3S29 A;  1JBT A;  6GSP A;  1B2Z A;  1YGE A;  5IEN A;  1D6Z A;  2A15 A;  2O9U X;  1RN7 A;  1JKG B;  3BNE A;  3D4A A;  4BTX A;  3A76 A;  3STD A;  3WOF B;  1US1 A;  3X3Y A;  1O7N B;  4HZ9 B;  2FXT A;  1T5Y A;  3F40 A;  4EBG A;  3GRD A;  3GZY B;  3K63 A;  1YGW A;  4O2H A;  1A67 A;  2K3D A;  2OQE C;  4KFD A;  1IQX A;  1MGR A;  2KXG A;  3G8Z A;  1WTH A;  9RNT A;  4L7K A;  3HII A;  3UNL A;  4G1M B;  5G2G A;  4I5Q A;  3ALA A;  4FCJ A;  2GBX B;  1BRH A;  2GBW B;  3CU3 A;  5KP1 A;  3JVC A;  3IPT A;  1EKM A;  1RNB A;  2OCT A;  5STD A;  1TRP A;  1SJW A;  5AIG A;  2FNQ A;  1BNI A;  1RLS A;  1ZS7 A;  1AV4 A;  1STD A;  4RNZ A;  1W02 A;  3TDG A;  1ZX2 A;  4FCZ A;  3URP A;  5M1A A;  3UL5 A;  2R41 A;  1ULI B;  3NX0 A;  3K5T A;  3N54 B;  2OTL 3;  1A90 A;  1B21 A;  3FKA A;  1MOL A;  1YIT 3;  1B2M A;  1RGA A;  1V57 A;  3F8X A;  1TFO A;  1IVU A;  1TP6 A;  1VQM 3;  2Z7A A;  1FW7 A;  1DE3 A;  1Q81 4;  1NDO B;  1OCV A;  2XFS A;  1I2E A;  8RNT A;  2E2V A;  2GU1 A;  4PEJ A;  2IA7 A;  4N6M A;  1UI7 A;  1BSC A;  1HYF A;  2W9P A;  3DH2 A;  1Q7H A;  5I97 A;  1RN1 A;  1GY5 A;  4WWU C;  1W2B 2;  1Q9E A;  1FGQ A;  2MF7 A;  2W6J H;  1T2H A;  3EB8 A;  3G6E 3;  1ASK A;  1V74 A;  3IMA B;  1FGT A;  3Q1C A;  3Q3F A;  4N6T A;  4LGQ A;  4X2O A;  2GEX A;  1K73 4;  1LNH A;  2C11 A;  1YI2 3;  3NHX A;  3X3Z A;  3SYU A;  1OHO A;  3EBT A;  1PY3 A;  3EC9 A;  3HI7 A;  2MC8 A;  2IMJ A;  1WNH A;  5IER A;  1V58 A;  3LT8 A;  1E97 A;  3LTA A;  3B7C A;  5BU4 A;  3B8L A;  2ZA4 A;  4IIA A;  4IT7 A;  1MWU A;  3X40 A;  1QAK A;  1G96 A;  3EN1 B;  3FG1 A;  2J8X B;  1GY6 A;  1WQL B;  5M18 A;  1U5O A;  1Q86 4;  1BNG A;  4R9L A;  5AIF A;  3O8Y A;  3WMD A;  1RMS A;  1RGF A;  1B2U A;  1YIJ 3;  2OWP A;  3FLJ A;  1VQ6 3;  1QJG A;  4BTW A;  1I70 A;  5D83 A;  2CFG A;  1W6G A;  2HMN B;  1OHS A;  3IJE B;  3PXM A;  2CIU A;  2CWT A;  4KVH A;  4O8S A;  2GSP A;  4OUQ A;  3ZG5 A;  1SII A;  1YNV X;  2RGQ A;  3D3L A;  3CPW 2;  2M7O A;  3AHS A;  3NM2 A;  1QVG 2;  1JKG A;  3OX9 A;  1DMQ A;  3JUM A;  2H0I A;  1DVD A;  1JZD A;  2HMM B;  1UGI A;  2CFD A;  3LH4 A;  2Z6B A;  3FF0 A;  3MYT A;  4HVN A;  1FGM A;  3OWU A;  1AY7 A;  3MPH A;  5CF1 A;  1AVL A;  1O7W B;  5HOH A;  3S28 A;  6RNT A;  3FG3 A;  1QAF A;  2P38 A;  4N3V A;  1B2S A;  4KZ1 A;  2HML B;  1EA2 A; 
#chains in the Genus database with same CATH homology
 1TU5 A;  3CCS 3;  1ROA A;  3KE7 A;  3CC7 3;  2JQ5 A;  4FMC A;  1W4N A;  4EC6 A;  3H3H A;  4AKY A;  1YJW 3;  2W04 A;  4K1U A;  2YFI B;  3BNC A;  1F8N A;  1IVX A;  1IDP A;  3F9S A;  1S72 3;  1JB4 A;  2CWV A;  1OAC A;  3MKI A;  2ZL8 A;  2BO9 B;  2HMK B;  4HM0 B;  3KSE D;  3I56 3;  2W0Q A;  4HM6 B;  4BTY A;  1W5Z A;  4OVM A;  2OOV A;  1ISK A;  1LVN A;  4R9K A;  1D6Y A;  3KN4 A;  2HMJ B;  3DY5 A;  5A0O B;  2KCD A;  1Z1S A;  2XSO B;  1M90 4;  1BUQ A;  4IPB A;  3EHC A;  3QK9 A;  1CYV A;  2CFL A;  2WGO A;  3RGR A;  4RNY A;  3CMA 3;  3DGN A;  1YJ9 3;  4EYC A;  4GL6 A;  2UX0 A;  1YJN 3;  3RGA A;  5EEO A;  1JJ2 2;  4XB5 A;  1EQK A;  1N5H A;  2P0M A;  3LOY A;  1W00 A;  3GZX B;  3NV0 B;  2I9W A;  2RFR A;  1Y4K A;  2ML6 A;  4H61 A;  1OHP A;  2FGT A;  1QVF 2;  5CXO A;  1VQ5 3;  1LXE A;  1W6C A;  2WO0 A;  3F7S A;  1IU7 A;  1OF5 A;  4EV5 A;  4LZI A;  2CK3 H;  2IUK A;  3F8H A;  1OUN A;  1FUW A;  3KFQ C;  3DGL A;  3ER7 A;  5BVB A;  3K0Z A;  1GD4 A;  1ROV A;  4X2H A;  4XBY A;  2IUJ A;  1E3V A;  4EXR A;  1QMA A;  2JDI H;  2XFT A;  2XGN A;  3OWS A;  4J8T A;  2W56 B;  5AII A;  2GXF A;  2QGU A;  4HM1 B;  4AEQ A;  2D1W A;  1RRL A;  1HKX A;  1KSI A;  2CWU A;  1K41 A;  4XDV A;  3CNX A;  3MHE A;  1IT8 A;  3U97 A;  1K8A 4;  3BB9 A;  1GYB A;  1JNQ A;  3DZL A;  4RZM A;  3DXO A;  3CCR 3;  5JBS A;  3OW2 2;  3EN8 A;  4XBT A;  1AR0 A;  1IQY A;  3CME 3;  1A2K A;  4FMB A;  2Y74 A;  1D6U A;  2BNG A;  2L4V A;  2OOV C;  3HIG A;  4HYZ A;  3G71 3;  2F98 A;  4NRE A;  3B4O A;  3NV0 A;  3NBJ A;  1HU9 A;  4R1K A;  2QIY A;  1K28 A;  1NJI 4;  5IG5 A;  3BNB A;  1NB3 I;  3NM7 A;  3NXJ A;  4LMI A;  1K9M 4;  1OF5 B;  3ECF A;  4HM2 B;  3JUO A;  5DRV A;  1VQN 3;  1RJO A;  1JB2 A;  4O3V A;  1FGO A;  1NB5 I;  1M1X B;  5IG0 A;  3V98 A;  1M1K 4;  5IEO A;  2W56 A;  1STF I;  3CC2 3;  3CCM 3;  3CCU 3;  5FGO A;  1S5A A;  3JUN A;  3WA2 X;  1CEW I;  1SIH A;  1C7H A;  5FW5 A;  3Q2P A;  3VGN A;  1PU4 A;  5TGN A;  1FA3 A;  2WOF A;  4STD A;  2KRT A;  1OGZ A;  3HK4 A;  4MMY B;  3UL6 A;  3PCR A;  1UUV B;  2CKF B;  4CDL A;  4AKZ A;  3FH1 A;  2Q07 A;  3F14 A;  5KP4 A;  4MMZ B;  3SLU A;  2CFW A;  3J7Y d;  2O3O A;  2STD A;  3EBY A;  4HM7 B;  2CW9 A;  3CD6 3;  3PS8 A;  3G16 A;  2B24 B;  3UB1 A;  3HX8 A;  1Q42 A;  2ML5 A;  4TX4 A;  1W6Y A;  3SXX A;  1IVW A;  3OV4 A;  1N9J A;  5AYR B;  1YHQ 3;  1WMO A;  3I55 3;  1WMP A;  5CLK A;  1VQ4 3;  1Q40 A;  3NUV A;  3CPO A;  1N8Q A;  2W2C A;  3CCJ 3;  3LTC A;  3UJM A;  2CFK A;  2CHC A;  3H51 A;  1J2B A;  3OWY A;  1VQ8 3;  4MMX B;  1KD1 4;  2Y73 A;  1MNL A;  3LT9 A;  4RBN A;  5EVH A;  1Q82 4;  3E99 A;  1IV7 A;  1VQ7 3;  2F86 B;  2SBL A;  3SX1 A;  4R80 A;  3T8N A;  3MG3 A;  3I0Y A;  3KII A;  1VZZ A;  1O7P B;  3PGB A;  5D81 A;  1NU3 A;  1UUW B;  3Q90 A;  3EQQ B;  3AMO B;  2P05 A;  1JB5 A;  5IEP A;  3MG2 A;  1IK3 A;  3N9H A;  3KKG A;  3JUP A;  4K90 B;  2RSX A;  3EX9 A;  4XDW A;  5KP3 A;  5IW9 A;  5D82 A;  3X3X A;  3LYG A;  3FF2 A;  2K0M A;  1IT7 A;  3FG4 A;  1CYU A;  3MWZ A;  4XBX A;  5ELU A;  2W9Q A;  3FSD A;  2BMR B;  1UI8 A;  3NQZ A;  3LXU X;  3NBR A;  4GB5 A;  4HKV B;  2B1X B;  4JRF A;  4J9A A;  4LSO A;  3EE1 A;  1VQ9 3;  4FMA A;  3X42 A;  3G4S 3;  5AEU B;  2PNC A;  3CNM A;  1GY7 A;  3EF8 A;  3CCE 3;  1VQL 3;  1N9E A;  2ZDJ A;  4K61 A;  4L8O A;  3CCQ 3;  1AVK A;  3PZW A;  4MEI A;  2BMO B;  3LTD A;  3PYJ A;  4ORL A;  4HJL B;  1IVV A;  5AEW B;  3X41 A;  2YX9 A;  4HM3 B;  2E2T A;  3S67 A;  2C10 A;  1FGR A;  1GS3 A;  3U1W A;  3WOD G;  1RKY A;  1JV2 B;  2YFJ B;  1L5G B;  1LOX A;  1JRQ A;  2WGQ A;  1DMN A;  2XR8 B;  8CHO A;  3K7C A;  3CXC 2;  4OK0 A;  2WOH A;  3PCS A;  1NWW A;  1TIJ A;  2PZV A;  2V1L A;  1TUH A;  2BHM A;  3FGY A;  5IG3 A;  3DGO A;  1N8R 4;  1Q7Y 4;  4I4K A;  4WYK B;  4HZB B;  3S27 A;  2LQV A;  5JPU A;  2QEX 3;  3L0R A;  5BXQ A;  5EQL A;  3GZB A;  1JN5 B;  2CC3 A;  3MSO A;  4Q53 A;  3WA3 A;  2OTJ 3;  1O7G B;  3CC4 3;  1KQS 2;  3K9M C;  4FCM A;  4N6L A;  1N5P A;  1Q40 B;  2P0X A;  4LEH A;  4QWT A;  4FR9 A;  4WFO A;  2K54 A;  3BLZ A;  5AI1 A;  3SOY A;  3T8U A;  5IG4 A;  3M8C A;  1SPU A;  4KFF A;  2XF3 A;  3SED A;  3KZT A;  3S5C A;  3WDG B;  3WOE B;  1OPY A;  2CH9 A;  4HM8 B;  1TFK A;  3MG1 A;  2XEP A;  4CCV A;  1W01 A;  3AMO A;  1IV9 A;  3B4P A;  2W03 A;  3N8B A;  3VF1 A;  2D42 A;  1KWI A;  5DRE A;  3DM8 A;  1GD3 A;  2BT3 A;  5HGR A;  3EJV A;  1U8C B;  4N6N B;  4HM4 B;  5AIH A;  2QA4 3;  1DVC A;  2HMO B;  3FZW A;  1VQO 3;  3NQY A;  2CG0 A;  1R4C A;  4U13 A;  4WYK A;  3LZA A;  1YVB I;  3SOA A;  3D9R A;  3CCV 3;  1E3R A;  1O7M B;  1EG9 B;  1OGX A;  2RCD A;  3GWR A;  3G0K A;  4H3U A;  5JPP A;  1ULJ B;  4EV2 A;  1RRH A;  1PFP A;  4MJD A;  4R4K A;  3V92 A;  6STD A;  2OQE A;  3QRD A;  3DUK A;  1O7H B;  4XM4 A;  5LC6 A;  4K1V A;  1M9G A;  1W7C A;  5ELJ A;  1ZO2 A;  1A2V A;  3F7X A;  1WMN A;  4N6O B;  2CG1 A;  3DMC A;  1CQS A;  2XGL A;  3ROB A;  3GZR A;  4KFE A;  1NO3 A;  2GU3 A;  3V99 A;  3CCL 3;  4O02 B;  4N6V 0;  2XSH B;  2R4I A;  1EA2 A;  5IF6 A;  2F99 A;  3RDE A;  1IQ8 A;  4HBR A;  3HZP A;  3NBB A;  1VQP 3;  1SQW A;  3DGM A;  2Z76 A;  5AYS C;  3VSY A;  4L8P A;  2P09 A;  5CF2 A;  4FMD A;  2XH9 A;  3GAX A;  4WHA A;  3FCS B;  4NHF A;  2E2U A;  3JUQ A;  1DYU A;  2YFL B;  5CK6 A;  2GEY A;  2XRX B;  1DMM A;  1JN5 A;  1UW1 A;  5LC7 A;  3SVA A;  4JF8 A;  1QAL A;  3LML A;  3T0U A;  1W2Z A;  2Z77 A;  4WP5 A;  4N6U A;  2BMQ B;  3KSP A;  1VQK 3;  1OH0 A;  3BND A;  4HM5 B;  2INX A;  7STD A;  4ZM8 A;  3LTB A;  3S29 A;  1YGE A;  5IEN A;  1D6Z A;  2A15 A;  2O9U X;  1RN7 A;  1JKG B;  3BNE A;  4BTX A;  3A76 A;  3STD A;  3WOF B;  1US1 A;  3X3Y A;  1O7N B;  4HZ9 B;  2FXT A;  1T5Y A;  3F40 A;  4EBG A;  3GRD A;  3GZY B;  3K63 A;  4O2H A;  1A67 A;  2OQE C;  4KFD A;  1IQX A;  2KXG A;  3G8Z A;  1WTH A;  4L7K A;  3HII A;  3UNL A;  4G1M B;  5G2G A;  3ALA A;  4FCJ A;  2GBX B;  2GBW B;  3CU3 A;  5KP1 A;  3JVC A;  3IPT A;  1EKM A;  2OCT A;  5STD A;  5AIG A;  1SJW A;  2FNQ A;  1AV4 A;  1STD A;  4RNZ A;  1W02 A;  3TDG A;  1ZX2 A;  4FCZ A;  3UL5 A;  3NX0 A;  1ULI B;  3K5T A;  3N54 B;  2OTL 3;  1A90 A;  3FKA A;  1MOL A;  1YIT 3;  3F8X A;  1TFO A;  1IVU A;  1TP6 A;  1VQM 3;  2Z7A A;  1Q81 4;  1NDO B;  1OCV A;  2XFS A;  2E2V A;  2GU1 A;  4PEJ A;  2IA7 A;  4N6M A;  1UI7 A;  2W9P A;  1W2B 2;  5I97 A;  4WWU C;  1GY5 A;  1FGQ A;  2MF7 A;  2W6J H;  3EB8 A;  3G6E 3;  1ASK A;  1V74 A;  3IMA B;  1FGT A;  3Q1C A;  4N6T A;  4LGQ A;  4X2O A;  2GEX A;  1K73 4;  1LNH A;  2C11 A;  1YI2 3;  3NHX A;  3X3Z A;  1OHO A;  3EBT A;  3EC9 A;  3HI7 A;  2MC8 A;  2IMJ A;  1WNH A;  5IER A;  3LT8 A;  1E97 A;  3LTA A;  3B7C A;  3B8L A;  4IIA A;  4IT7 A;  3X40 A;  1QAK A;  1G96 A;  3EN1 B;  3FG1 A;  1GY6 A;  1WQL B;  1U5O A;  1Q86 4;  5AIF A;  4R9L A;  3O8Y A;  3WMD A;  1YIJ 3;  2OWP A;  3FLJ A;  1VQ6 3;  1QJG A;  4BTW A;  5D83 A;  2CFG A;  1W6G A;  2HMN B;  1OHS A;  3IJE B;  3PXM A;  2CIU A;  2CWT A;  4KVH A;  4O8S A;  4OUQ A;  3CPW 2;  1KC8 4;  1SII A;  1QVG 2;  3D3L A;  2RGQ A;  2M7O A;  3NM2 A;  1JKG A;  3OX9 A;  1DMQ A;  3JUM A;  1DVD A;  3MYT A;  2HMM B;  2CFD A;  3LH4 A;  2Z6B A;  3FF0 A;  4HVN A;  1FGM A;  3OWU A;  3MPH A;  5CF1 A;  1AVL A;  1O7W B;  3S28 A;  3FG3 A;  1QAF A;  2P38 A;  4N3V A;  3OXA A;  4KZ1 A;  2HML B;  2LYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...