4O2HA

Crystal structure of bcam1869 protein (rsam homolog) from burkholderia cenocepacia
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
TSPLLHPVPGPSPDGYVRLSEGALAALVLDHVASGLDPSLLAELRDNAIDARLAGYTEWHRTAGAGVAYVTVGWDWYLERATGTFVIAGGDVRSNVMAIDAKGADIGMLRTAAALAARLAALDWPAAVASALLGHND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RsaM: a transcriptional regulator of Burkholderia spp. with novel fold.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Structural genomics, unknown function
molecule keywords protein BCAM1869
total genus 33
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16245 DUF4902 Domain of unknown function (DUF4902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.610 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o2hA00
4O2HA
chains in the Genus database with same CATH superfamily
1RN7A 2BMQB 1WTHA 2RGQA 4I4KA 4PEJA 1QVF2 1DVDA 1I2FA 2FNQA 3MYTA 3EN1B 4EW5A 1IT8A 3JUPA 1JRQA 1Q864 2GBWB 4KFEA 2CFDA 3KKGA 3GZRA 1B21A 1STDA 1RTUA 1BNRA 1W2ZA 2XRXB 3NQZA 4GSPA 1GSPA 5FW5A 1DVCA 4XBTA 1LRAA 1UDII 4WFOA 3CC23 1Q9EA 3HIIA 1T2IA 4K90B 1N5PA 5IG4A 1BNSA 3CMA3 1GS3A 4HM8B 3CCS3 4NHFA 2RBIA 1WNHA 3FG3A 3LYGA 3UJMA 1RRHA 3HOHA 1BOXA 1ULJB 1UUGB 3T8NA 2YFLB 3M8CA 5KP4A 2ZHXB 3NXJA 3FG1A 3CC73 1AR0A 1B2ZA 1BVIA 3DGYA 8CHOA 1BSAA 2LQVA 1Y4KA 1YJ93 2M7OA 2XFSA 3BNCA 4EBGA 1MGWA 4KVHA 1JB5A 2CK3H 3H3HA 1MNLA 3LTCA 1TP6A 1BANA 1W5ZA 1Q7HA 1PU4A 1A2VA 1HU9A 4MMXB 1WMOA 3GAXA 4FCZA 4BL2A 5BU4A 2XH9A 3T8UA 5TGNA 3CCR3 1JBSA 1UGIA 3KCHA 3LMLA 2QA43 1RKYA 3CCL3 2K0MA 2XR8B 3HI7A 3D4AA 4CJNA 3JUQA 4IT7A 2YX9A 3EB8A 1IV9A 1JZDA 4N6NB 1OHOA 1RCLA 1W00A 1GY7A 1T5YA 5KP3A 1VQK3 1YNVX 4HKVB 1EKMA 3VSYA 2F98A 3Q1CA 3Q3FA 1IV7A 5IW9A 4MEIA 1RGAA 2KAAA 3F9SA 1EUIC 1TUHA 1FUWA 1AVLA 1ZGXA 2XF3A 3LT8A 1U8CB 1A2KA 3ZFZA 5AEWB 5BIRA 2IA7A 1LXEA 3F40A 2OTJ3 2IUJA 1SIIA 4R9LA 3CNXA 4TX4A 2KF4A 2P05A 5DRVA 2MF7A 3SYUA 3A76A 3F14A 3CCU3 1B20A 3UNLA 1FW7A 4WWUC 1I0XA 2HOHA 2H0HA 3OWSA 1S723 1NWWA 4MMZB 2ZDJA 1BSCA 1IVVA 1N9JA 2BO9B 2CC3A 3SLUA 3CCV3 5D82A 4BTWA 5I97A 4J9AA 2CWVA 1DMQA 3JUMA 1KQS2 1US1A 3ER7A 4HAAA 3D79A 2HMOB 3UL6A 1Z1SA 1BUQA 5AIHA 5D81A 1UCIA 5IG0A 1G02A 1YJW3 3D3LA 1U5OA 1K8A4 3PXMA 2E2VA 2Z77A 4BTYA 2F86B 1RNBA 5EEOA 2W6JH 2GSPA 3I563 5JPUA 3DM8A 1S5AA 2FXTA 3DGNA 3NHXA 3ZG5A 2B24B 5STDA 3I0YA 1MWTA 1IVUA 1JB4A 1UI7A 4K61A 3S28A 3GWRA 2B1XB 2P09A 3ECFA 3FLJA 1IDPA 2Z76A 7STDA 1YGEA 1LNIA 4G1MB 2E2TA 5CXOA 1WMNA 1BSBA 1V57A 4QWTA 1KD14 1VQL3 1BIRA 2K54A 3X41A 1GYBA 1CEWI 3V99A 1GD3A 3DY5A 1B27A 3V98A 2QGUA 4LYLB 2YFIB 2P0MA 4FCJA 1JV2B 3N8BA 3AGOA 3MWZA 3LXUX 1YHQ3 3NM7A 2KF5A 3UL5A 1RCKA 5CF1A 3LTAA 1DETA 3U97A 2O9UX 1M9GA 6STDA 2CW9A 1CQSA 4CCVA 3IJEB 2P38A 4H61A 1GY5A 2F56A 5RNTA 1ZX2A 8RNTA 4DKIA 4AKYA 2CWUA 1N8R4 1GOVA 1UUWB 5AIFA 3DGLA 3FF0A 2XGNA 4ZM8A 3CCJ3 1MOLA 2P0XA 3HX8A 1GD4A 3KFQC 5AI1A 6GSPA 5AYRB 3STDA 2W04A 2MC8A 1I2EA 4L8OA 1C7HA 3BLZA 1E3RA 4XDVA 5HGRA 2UX0A 2UUGC 3LH4A 2KCDA 2CFWA 3K9MC 4JRFA 5M18A 1BRGA 1ZO2A 1IK3A 3JUNA 1EG9B 4WYKB 1I0VA 2CFLA 4L8PA 3ALAA 4OK0A 4R1KA 5M19A 1Q40B 5EQLA 5G1LA 2OOVA 1W6GA 1FYSA 1AY7A 1K28A 2GU1A 3JUOA 3X3YA 1AV4A 1VQM3 2A15A 1TU5A 3CCM3 1BNIA 1BNEA 5M1AA 2HMMB 1MWRA 3WDGB 3CPW2 2OQEA 1RGKA 1SARA 3F7SA 5AIGA 1N5HA 2BMRB 1HYFA 2CIUA 3NBRA 1ULIB 3KSPA 4FR9A 1NJI4 1TIJA 1OCVA 3OWUA 2GXFA 3AGNA 1GOUA 3B4OA 1WMPA 3GRDA 3TDGA 3X3ZA 3GZYB 2BHMA 4KFFA 7RNTA 1SPUA 4OUQA 1LOVA 3WMDA 1OUNA 1V58A 3X3XA 3L0RA 3WHOA 1I3IA 2XEPA 3EHCA 1VQP3 4HOHA 5CF2A 3OXAA 3S5CA 1T3BA 2RCDA 4XBYA 1YVSA 1BNFA 1RSNA 5CLKA 3SXXA 1BSEA 1GMQA 3WOEB 1MWSA 1FGQA 3NX0A 3EX9A 4XDWA 1BRSA 2WO0A 4R9KA 4WHAA 3I553 4EXRA 1AQZA 1TJDA 1VQ83 3OWYA 3Q2PA 3H51A 1I3FA 1AVKA 4X2HA 3LTBA 1DMNA 5FGOA 4HZ9B 3AMOB 1Q42A 2KF3A 1G96A 3F8XA 3FGYA 3PYJA 1L5GB 4EC6A 1NNVA 3DGOA 3JVCA 1NB3I 3CCQ3 1Q824 3HZPA 1B2MA 1BAOA 1IQYA 1OHSA 3NV0B 1UCKA 3FCSB 3LT9A 2F99A 2CWTA 2J8XB 2JDIH 3K63A 1F8NA 1RLSA 1FGOA 3CXC2 1IQ8A 1W4NA 1OGZA 4I5QA 2V1LA 2WGQA 2BT3A 5DREA 4GL6A 1O7HB 2GEXA 3DXOA 1TTOA 1RNTA 1UCLA 3NUVA 1JBRA 5ELJA 2KRTA 3BIRA 1YGWA 1N9EA 4GB5A 3K0ZA 1O7MB 2F5WA 4JF8A 4STDA 3MG1A 1NO3A 2C4BA 5A0OB 1SQWA 3AMOA 3VGNA 3EC9A 1FZUA 2D42A 1K734 3G713 1OF5A 1QMAA 1BRHA 1NU3A 1V74A 3DH2A 3DZLA 1G0TA 2O3OA 1X1YA 2L4VA 3E99A 3FSDA 2XSOB 3DUKA 4NPBA 3T0UA 1CH0A 2W56A 2PNCA 3URPA 4RBNA 2Q07A 4RNYA 4X2OA 1FUSA 3LZAA 3OX9A 1GMRA 5G1KA 1DYUA 3HIGA 1A90A 7GSPA 4HBRA 4O3VA 2GEYA 3X40A 4HM4B 2C10A 1Q40A 2C11A 1A2PA 1VQ53 2OQEC 1IU7A 3UB1A 3PZWA 4AKZA 5CK6A 3EBTA 9RNTA 4HM6B 3BU4A 4HM3B 3S27A 3WR2A 1YVBI 3MKIA 4KFDA 1X1WA 5HOHA 3G16A 3IPTA 2CKFB 1BU4A 3S67A 5IERA 1GY6A 1LQMB 3RGRA 3N54B 4LSOA 4FMBA 1BNJA 2W56B 5ELUA 2STDA 4FMAA 3BNEA 2IMJA 4HM7B 1WQLB 5IG3A 2CG0A 4U13A 1QVG2 3G6E3 2PZVA 4LMIA 3BNDA 3CU3A 5IG5A 1VQ43 4N6MA 1O7WB 4Q53A 3RGAA 3FG4A 1RGGA 2UGIA 1B2XA 3KN4A 4KZ1A 2H0GA 4XB5A 1JZOA 2OWPA 2CHCA 6RNTA 3ROBA 2Z7AA 1W02A 1IYYA 4LEHA 1FA3A 3FH1A 1QALA 3KZTA 1LVNA 3RNTA 3SVAA 1NDOB 1R4YA 3KE7A 3QK9A 1UI8A 4RNTA 1RGCA 3MSOA 1ASKA 1FGRA 4HM0B 2E2UA 4K1VA 3LTDA 3B8LA 3G0KA 4R80A 3CC43 5JPPA 1JBTA 1YI23 3GSPA 2K3DA 1UW1A 3NBBA 4XBXA 1D6ZA 4LZIA 3SOYA 4FCMA 1TFOA 2IY2A 1D6UA 1OH0A 2HMNB 2Z6BA 2HMJB 1EEJA 3KIIA 2QIYA 1HKXA 2CX0A 2WOFA 3PS8A 4L7KA 3F7XA 1M1XB 2CX1A 5G2GA 3PCRA 5LC6A 3EF8A 4WP5A 2W2CA 3SOAA 1DMMA 3WA3A 1C54A 1IQXA 2W03A 5AIIA 3S29A 2BIRA 1ROAA 4O2HA 1T2HA 5AYSC 5BXQA 2RFRA 2XGLA 1JKGA 2AADA 3BB9A 4FMDA 3EQQB 4CPKA 3EBYA 1JB2A 3MG2A 1OF5B 5GSPA 1CYVA 4BTXA 1K9M4 1EQKA 1GOYA 4N3VA 4OVMA 1D6YA 3NQYA 1I70A 1B2UA 2ML6A 3BNBA 1LOWA 2HMKB 2OCTA 3G4S3 2F5MA 1TFKA 1O7NB 4IPBA 1RN1A 2CG1A 3O8YA 1O7PB 1VZZA 4BL3A 1SJWA 3NV0A 1RN4A 1SIHA 2Y73A 1OGXA 4MJDA 5KP1A 2Y74A 1BUJA 1RJOA 4GHOA 3SX1A 1W01A 3EE1A 1YIT3 3N9HA 1QJGA 2CH9A 2LYXA 1JKGB 1OHPA 1QAFA 3AHWA 4LGQA 1BRNL 4J8TA 1FGMA 1W6CA 1X1XA 3D9RA 1IVWA 1E3VA 3HK4A 4R4KA 1IVXA 1RHLA 3ZG0A 1NB5I 2CFKA 1CYUA 4ORLA 1DE3A 1IT7A 2SBLA 4O8SA 2IYJA 3X42A 4HJLB 1TRPA 4HYZA 3EJVA 1TRQA 3K5TA 3B7CA 2QEX3 1KWIA 1JJ22 3GZXB 3LOYA 1FUTA 4K1UA 2OTL3 1BSDA 3EN8A 1LOYA 2W0QA 1OACA 1ZS7A 4FMCA 1RGFA 4AEQA 3CNMA 3WOFB 5IF6A 1X1UA 3RDEA 3WA2X 3V92A 1BNGA 4HM1B 4N6OB 1I2GA 2W9QA 1MGRA 1YJN3 5IENA 2OOVC 1M1K4 1KC84 3FZWA 1LQGC 2HMLB 1FGTA 4HM2B 1JNQA 1EA2A 2JQ5A 4RZMA 5IEPA 1PFPA 5EVHA 2XFTA 3Q90A 1RGEA 4HVNA 3CPOA 1PY3A 3PCSA 1QAKA 2KF6A 4XM4A 3K7CA 2BNGA 2ZA4A 3G8ZA 1E97A 3DMCA 1BRJA 3NM2A 4N6LA 1JN5A 4KT3B 1YIJ3 4ILFA 1N8QA 2YFJB 4O02B 3SEDA 1Q7Y4 1STFI 3AHSA 1KSIA 2RSXA 3QRDA 1BRIA 2WGOA 4H3UA 4N6V0 4NREA 2BU4A 4EYCA 4MMYB 1RGHA 3FF2A 3CD63 1ROVA 1UCJA 1I8VA 2GBXB 2XSHB 4EV5A 2H0IA 2R4IA 1VQO3 1M904 1A67A 3F8HA 1MWUA 3U1WA 2WOHA 1OPYA 1W7CA 2INXA 4WYKA 2AAEA 2L1SA 3D5GA 5D83A 1VQ63 2GU3A 2CFGA 3CME3 1UUVB 3DGMA 1RDSA 2BMOB 5JBSA 4J5KA 1HZ1A 3A5EA 5AEUB 3B4PA 1JN5B 5LC7A 2IUKA 1R4CA 1VQ93 1B2SA 1ISKA 1RRLA 2RNTA 1LNHA 1VQN3 1J2BA 3IMAB 2F4YA 4BU4A 1VQ73 1RMSA 2I9WA 5BVBA 3PGBA 3VF1A 1K41A 3OV4A 3KSED 1O7GB 1RGLA 3CCE3 3OW22 1GMPA 1Q814 1W2B2 1B3SA 3MG3A 4N6TA 2D1WA 2SARA 4CDLA 3D5IA 2FGTA 2KXGA 1PYLA 4N6UA 4RNZA 4BIRA 2R41A 1LOXA 4EV2A 1W6YA 3NBJA 4J5GA 3FKAA 3GZBA 2ZL8A 3MPHA 3WODG 1BGSA 4HM5B 1UGHI 2W9PA 4HZBB 4IIAA 3MHEA 1VQQA 5IEOA 2ML5A 1BRKA 3J7Yd
chains in the Genus database with same CATH topology
1RN7A 2BMQB 1WTHA 2RGQA 4I4KA 4PEJA 1QVF2 1DVDA 2FNQA 3MYTA 3EN1B 1IT8A 3JUPA 1JRQA 1Q864 2GBWB 4KFEA 2CFDA 3KKGA 3GZRA 1STDA 1W2ZA 2XRXB 3NQZA 5FW5A 1DVCA 4XBTA 4WFOA 3CC23 3HIIA 4K90B 1N5PA 5IG4A 3CMA3 1GS3A 4HM8B 3CCS3 4NHFA 1WNHA 3FG3A 3LYGA 3UJMA 1RRHA 1ULJB 3T8NA 2YFLB 3M8CA 5KP4A 3NXJA 3FG1A 3CC73 1AR0A 8CHOA 1YJ93 2LQVA 1Y4KA 2XFSA 3BNCA 4EBGA 4KVHA 1JB5A 2CK3H 3H3HA 1MNLA 3LTCA 1TP6A 1W5ZA 1PU4A 1A2VA 1HU9A 4MMXB 1WMOA 3GAXA 4FCZA 2XH9A 3T8UA 5TGNA 3CCR3 3LMLA 2QA43 1RKYA 3CCL3 2K0MA 2XR8B 3HI7A 3JUQA 4IT7A 2YX9A 3EB8A 1IV9A 4N6NB 1OHOA 1W00A 1GY7A 1T5YA 5KP3A 1VQK3 4HKVB 1EKMA 3VSYA 2F98A 3Q1CA 1IV7A 5IW9A 4MEIA 3F9SA 1TUHA 1FUWA 1AVLA 5AEWB 2XF3A 3LT8A 1U8CB 1A2KA 2IA7A 1LXEA 3F40A 2OTJ3 2IUJA 1SIIA 4R9LA 3CNXA 4TX4A 2P05A 5DRVA 2MF7A 3A76A 3F14A 3CCU3 3UNLA 4WWUC 1S723 3OWSA 1NWWA 4MMZB 2ZDJA 3SLUA 1IVVA 1N9JA 2BO9B 2CC3A 3CCV3 5D82A 4BTWA 5I97A 4J9AA 2CWVA 1DMQA 3JUMA 1KQS2 1US1A 3ER7A 2HMOB 3UL6A 1Z1SA 1BUQA 5AIHA 5D81A 5IG0A 1YJW3 3D3LA 1U5OA 1K8A4 3PXMA 2E2VA 2Z77A 4BTYA 2F86B 5EEOA 2W6JH 3I563 5JPUA 3DM8A 1S5AA 2FXTA 3DGNA 3NHXA 2B24B 5STDA 3I0YA 1IVUA 1JB4A 1UI7A 4K61A 3S28A 3GWRA 2B1XB 2P09A 3ECFA 3FLJA 1IDPA 2Z76A 7STDA 1YGEA 4G1MB 2E2TA 5CXOA 1WMNA 1KD14 1VQL3 4QWTA 2K54A 3X41A 1GYBA 1CEWI 3V99A 1GD3A 3DY5A 3V98A 2QGUA 2YFIB 2P0MA 4FCJA 1JV2B 3N8BA 3MWZA 3LXUX 1YHQ3 3NM7A 3UL5A 5CF1A 3LTAA 3U97A 2O9UX 1M9GA 6STDA 2CW9A 1CQSA 4CCVA 3IJEB 2P38A 4H61A 1GY5A 1ZX2A 1N8R4 4AKYA 2CWUA 1UUWB 5AIFA 3DGLA 3FF0A 2XGNA 4ZM8A 3CCJ3 1MOLA 2P0XA 3HX8A 1GD4A 3KFQC 5AI1A 5AYRB 3STDA 2W04A 2MC8A 4L8OA 1C7HA 3BLZA 1E3RA 4XDVA 5HGRA 2UX0A 3LH4A 2KCDA 2CFWA 3K9MC 4JRFA 1ZO2A 1IK3A 3JUNA 1EG9B 4WYKB 2CFLA 4OK0A 4L8PA 3ALAA 4R1KA 1Q40B 5EQLA 2OOVA 1W6GA 2GU1A 3X3YA 1K28A 3JUOA 1AV4A 1VQM3 2A15A 1TU5A 3CCM3 2HMMB 3WDGB 3CPW2 2OQEA 3F7SA 5AIGA 1N5HA 2BMRB 2CIUA 3NBRA 1ULIB 3KSPA 4FR9A 1NJI4 1TIJA 1OCVA 3OWUA 2GXFA 3GRDA 3X3ZA 3B4OA 1WMPA 3TDGA 3GZYB 2BHMA 4KFFA 1SPUA 4OUQA 3WMDA 1OUNA 3X3XA 3L0RA 2XEPA 3EHCA 1VQP3 5CF2A 3OXAA 3S5CA 2RCDA 4XBYA 5CLKA 3SXXA 3WOEB 1FGQA 3NX0A 3EX9A 4XDWA 2WO0A 4R9KA 4WHAA 3I553 4EXRA 1VQ83 3OWYA 3Q2PA 3H51A 1AVKA 4X2HA 3LTBA 1DMNA 5FGOA 4HZ9B 3AMOB 1Q42A 1G96A 3F8XA 3FGYA 3PYJA 1L5GB 4EC6A 3DGOA 3JVCA 1NB3I 3CCQ3 1Q824 3HZPA 1IQYA 1OHSA 3NV0B 3FCSB 3LT9A 2F99A 2CWTA 2JDIH 3K63A 1F8NA 1FGOA 3CXC2 1IQ8A 1W4NA 1OGZA 2V1LA 2WGQA 2BT3A 5DREA 4GL6A 1O7HB 2GEXA 3DXOA 3NUVA 5ELJA 2KRTA 1N9EA 4GB5A 3K0ZA 1O7MB 4JF8A 4STDA 3MG1A 1NO3A 5A0OB 1SQWA 3AMOA 3VGNA 3EC9A 2D42A 1K734 3G713 1OF5A 1QMAA 1NU3A 1V74A 3DZLA 2O3OA 2L4VA 3E99A 3FSDA 2XSOB 3DUKA 3T0UA 2W56A 2PNCA 4RBNA 2Q07A 4RNYA 4X2OA 3LZAA 3OX9A 1DYUA 3HIGA 1A90A 4HBRA 4O3VA 2GEYA 3X40A 4HM4B 2C10A 1Q40A 2C11A 1VQ53 2OQEC 1IU7A 3UB1A 3PZWA 4AKZA 5CK6A 3EBTA 4HM6B 4HM3B 3S27A 1YVBI 3MKIA 4KFDA 3G16A 3IPTA 2CKFB 3S67A 5IERA 1GY6A 3RGRA 3N54B 4LSOA 4FMBA 2W56B 5ELUA 2STDA 4FMAA 3BNEA 2IMJA 4HM7B 1WQLB 5IG3A 2CG0A 4U13A 1QVG2 3G6E3 2PZVA 4LMIA 3BNDA 3CU3A 5IG5A 1VQ43 4N6MA 1O7WB 4Q53A 3RGAA 3FG4A 3KN4A 4KZ1A 4XB5A 2OWPA 2CHCA 3ROBA 2Z7AA 1W02A 4LEHA 1FA3A 3FH1A 1QALA 3KZTA 1LVNA 3SVAA 1NDOB 3KE7A 3QK9A 1UI8A 3MSOA 1ASKA 1FGRA 4HM0B 2E2UA 4K1VA 3LTDA 3B8LA 3G0KA 4R80A 3CC43 5JPPA 1YI23 3NBBA 1UW1A 4XBXA 1D6ZA 4LZIA 3SOYA 4FCMA 1TFOA 1D6UA 1OH0A 2HMNB 2Z6BA 2HMJB 3KIIA 2QIYA 1HKXA 3PS8A 2WOFA 4L7KA 3F7XA 1M1XB 5G2GA 3PCRA 5LC6A 3EF8A 4WP5A 2W2CA 3SOAA 1DMMA 3WA3A 1IQXA 2W03A 5AIIA 3S29A 1ROAA 4O2HA 5BXQA 5AYSC 2RFRA 2XGLA 1JKGA 3BB9A 4FMDA 3EQQB 3EBYA 1JB2A 3MG2A 1OF5B 4BTXA 1CYVA 1K9M4 1EQKA 4N3VA 4OVMA 1D6YA 3NQYA 2ML6A 3BNBA 2HMKB 2OCTA 3G4S3 1TFKA 1O7NB 4IPBA 2CG1A 3O8YA 1O7PB 1VZZA 1SJWA 3NV0A 1SIHA 4MJDA 2Y73A 1OGXA 5KP1A 2Y74A 1RJOA 3SX1A 1W01A 3EE1A 1YIT3 3N9HA 1QJGA 2CH9A 2LYXA 1JKGB 1OHPA 1QAFA 4LGQA 4J8TA 1FGMA 1W6CA 3D9RA 4R4KA 1IVWA 1E3VA 3HK4A 1IVXA 1NB5I 2CFKA 1CYUA 4ORLA 1IT7A 2SBLA 4O8SA 3X42A 4HJLB 4HYZA 3EJVA 3K5TA 3B7CA 2QEX3 1KWIA 1JJ22 3GZXB 3LOYA 2OTL3 4K1UA 4FMCA 3EN8A 2W0QA 1OACA 4AEQA 3CNMA 3WOFB 5IF6A 3RDEA 3WA2X 3V92A 4HM1B 4N6OB 2W9QA 1YJN3 5IENA 2OOVC 1M1K4 1KC84 3FZWA 2HMLB 1FGTA 4HM2B 1JNQA 1EA2A 2JQ5A 4RZMA 5IEPA 1PFPA 5EVHA 2XFTA 3Q90A 4HVNA 3CPOA 3PCSA 1QAKA 4XM4A 3K7CA 2BNGA 3G8ZA 1E97A 3DMCA 3NM2A 4N6LA 1JN5A 1YIJ3 1N8QA 2YFJB 4O02B 3SEDA 1Q7Y4 1STFI 1KSIA 2RSXA 3QRDA 2WGOA 4H3UA 4N6V0 4NREA 4EYCA 3CD63 4MMYB 3FF2A 1ROVA 2GBXB 2XSHB 4EV5A 2R4IA 1VQO3 1M904 1A67A 3F8HA 3U1WA 2WOHA 1OPYA 1W7CA 2INXA 4WYKA 5D83A 1VQ63 2GU3A 2CFGA 3CME3 1UUVB 3DGMA 2BMOB 5JBSA 1VQ93 5AEUB 3B4PA 1JN5B 5LC7A 2IUKA 1R4CA 1ISKA 1RRLA 1VQN3 1LNHA 1J2BA 3IMAB 1VQ73 2I9WA 5BVBA 3PGBA 3VF1A 1K41A 3OV4A 3KSED 1O7GB 3CCE3 3OW22 1Q814 1W2B2 3MG3A 4N6TA 2D1WA 4CDLA 2FGTA 2KXGA 4N6UA 4RNZA 1LOXA 4EV2A 1W6YA 3NBJA 3FKAA 3GZBA 2ZL8A 3MPHA 3WODG 4HM5B 2W9PA 4HZBB 4IIAA 3MHEA 5IEOA 2ML5A 2M7OA 3J7Yd
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2H A; 
#chains in the Genus database with same CATH topology
 1RN7 A;  2BMQ B;  1WTH A;  2RGQ A;  4I4K A;  4PEJ A;  1QVF 2;  1DVD A;  1I2F A;  2FNQ A;  3MYT A;  3EN1 B;  4EW5 A;  1IT8 A;  3JUP A;  1JRQ A;  1Q86 4;  2GBW B;  4KFE A;  2CFD A;  3KKG A;  3GZR A;  1B21 A;  1STD A;  1RTU A;  1BNR A;  1W2Z A;  2XRX B;  3NQZ A;  4GSP A;  1GSP A;  5FW5 A;  1DVC A;  4XBT A;  1LRA A;  1UDI I;  4WFO A;  3CC2 3;  1Q9E A;  3HII A;  1T2I A;  4K90 B;  1N5P A;  5IG4 A;  1BNS A;  3CMA 3;  1GS3 A;  4HM8 B;  3CCS 3;  4NHF A;  2RBI A;  1WNH A;  3FG3 A;  3LYG A;  3UJM A;  1RRH A;  3HOH A;  1BOX A;  1ULJ B;  1UUG B;  3T8N A;  2YFL B;  3M8C A;  5KP4 A;  2ZHX B;  3NXJ A;  3FG1 A;  3CC7 3;  1AR0 A;  1B2Z A;  1BVI A;  3DGY A;  8CHO A;  1BSA A;  2LQV A;  1Y4K A;  1YJ9 3;  2M7O A;  2XFS A;  3BNC A;  4EBG A;  1MGW A;  4KVH A;  1JB5 A;  2CK3 H;  3H3H A;  1MNL A;  3LTC A;  1TP6 A;  1BAN A;  1W5Z A;  1Q7H A;  1PU4 A;  1A2V A;  1HU9 A;  4MMX B;  1WMO A;  3GAX A;  4FCZ A;  4BL2 A;  5BU4 A;  2XH9 A;  3T8U A;  5TGN A;  3CCR 3;  1JBS A;  1UGI A;  3KCH A;  3LML A;  2QA4 3;  1RKY A;  3CCL 3;  2K0M A;  2XR8 B;  3HI7 A;  3D4A A;  4CJN A;  3JUQ A;  4IT7 A;  2YX9 A;  3EB8 A;  1IV9 A;  1JZD A;  4N6N B;  1OHO A;  1RCL A;  1W00 A;  1GY7 A;  1T5Y A;  5KP3 A;  1VQK 3;  1YNV X;  4HKV B;  1EKM A;  3VSY A;  2F98 A;  3Q1C A;  3Q3F A;  1IV7 A;  5IW9 A;  4MEI A;  1RGA A;  2KAA A;  3F9S A;  1EUI C;  1TUH A;  1FUW A;  1AVL A;  1ZGX A;  2XF3 A;  3LT8 A;  1U8C B;  1A2K A;  3ZFZ A;  5AEW B;  5BIR A;  2IA7 A;  1LXE A;  3F40 A;  2OTJ 3;  2IUJ A;  1SII A;  4R9L A;  3CNX A;  4TX4 A;  2KF4 A;  2P05 A;  5DRV A;  2MF7 A;  3SYU A;  3A76 A;  3F14 A;  3CCU 3;  1B20 A;  3UNL A;  1FW7 A;  4WWU C;  1I0X A;  2HOH A;  2H0H A;  3OWS A;  1S72 3;  1NWW A;  4MMZ B;  2ZDJ A;  1BSC A;  1IVV A;  1N9J A;  2BO9 B;  2CC3 A;  3SLU A;  3CCV 3;  5D82 A;  4BTW A;  5I97 A;  4J9A A;  2CWV A;  1DMQ A;  3JUM A;  1KQS 2;  1US1 A;  3ER7 A;  4HAA A;  3D79 A;  2HMO B;  3UL6 A;  1Z1S A;  1BUQ A;  5AIH A;  5D81 A;  1UCI A;  5IG0 A;  1G02 A;  1YJW 3;  3D3L A;  1U5O A;  1K8A 4;  3PXM A;  2E2V A;  2Z77 A;  4BTY A;  2F86 B;  1RNB A;  5EEO A;  2W6J H;  2GSP A;  3I56 3;  5JPU A;  3DM8 A;  1S5A A;  2FXT A;  3DGN A;  3NHX A;  3ZG5 A;  2B24 B;  5STD A;  3I0Y A;  1MWT A;  1IVU A;  1JB4 A;  1UI7 A;  4K61 A;  3S28 A;  3GWR A;  2B1X B;  2P09 A;  3ECF A;  3FLJ A;  1IDP A;  2Z76 A;  7STD A;  1YGE A;  1LNI A;  4G1M B;  2E2T A;  5CXO A;  1WMN A;  1BSB A;  1V57 A;  4QWT A;  1KD1 4;  1VQL 3;  1BIR A;  2K54 A;  3X41 A;  1GYB A;  1CEW I;  3V99 A;  1GD3 A;  3DY5 A;  1B27 A;  3V98 A;  2QGU A;  4LYL B;  2YFI B;  2P0M A;  4FCJ A;  1JV2 B;  3N8B A;  3AGO A;  3MWZ A;  3LXU X;  1YHQ 3;  3NM7 A;  2KF5 A;  3UL5 A;  1RCK A;  5CF1 A;  3LTA A;  1DET A;  3U97 A;  2O9U X;  1M9G A;  6STD A;  2CW9 A;  1CQS A;  4CCV A;  3IJE B;  2P38 A;  4H61 A;  1GY5 A;  2F56 A;  5RNT A;  1ZX2 A;  8RNT A;  4DKI A;  4AKY A;  2CWU A;  1N8R 4;  1GOV A;  1UUW B;  5AIF A;  3DGL A;  3FF0 A;  2XGN A;  4ZM8 A;  3CCJ 3;  1MOL A;  2P0X A;  3HX8 A;  1GD4 A;  3KFQ C;  5AI1 A;  6GSP A;  5AYR B;  3STD A;  2W04 A;  2MC8 A;  1I2E A;  4L8O A;  1C7H A;  3BLZ A;  1E3R A;  4XDV A;  5HGR A;  2UX0 A;  2UUG C;  3LH4 A;  2KCD A;  2CFW A;  3K9M C;  4JRF A;  5M18 A;  1BRG A;  1ZO2 A;  1IK3 A;  3JUN A;  1EG9 B;  4WYK B;  1I0V A;  2CFL A;  4L8P A;  3ALA A;  4OK0 A;  4R1K A;  5M19 A;  1Q40 B;  5EQL A;  5G1L A;  2OOV A;  1W6G A;  1FYS A;  1AY7 A;  1K28 A;  2GU1 A;  3JUO A;  3X3Y A;  1AV4 A;  1VQM 3;  2A15 A;  1TU5 A;  3CCM 3;  1BNI A;  1BNE A;  5M1A A;  2HMM B;  1MWR A;  3WDG B;  3CPW 2;  2OQE A;  1RGK A;  1SAR A;  3F7S A;  5AIG A;  1N5H A;  2BMR B;  1HYF A;  2CIU A;  3NBR A;  1ULI B;  3KSP A;  4FR9 A;  1NJI 4;  1TIJ A;  1OCV A;  3OWU A;  2GXF A;  3AGN A;  1GOU A;  3B4O A;  1WMP A;  3GRD A;  3TDG A;  3X3Z A;  3GZY B;  2BHM A;  4KFF A;  7RNT A;  1SPU A;  4OUQ A;  1LOV A;  3WMD A;  1OUN A;  1V58 A;  3X3X A;  3L0R A;  3WHO A;  1I3I A;  2XEP A;  3EHC A;  1VQP 3;  4HOH A;  5CF2 A;  3OXA A;  3S5C A;  1T3B A;  2RCD A;  4XBY A;  1YVS A;  1BNF A;  1RSN A;  5CLK A;  3SXX A;  1BSE A;  1GMQ A;  3WOE B;  1MWS A;  1FGQ A;  3NX0 A;  3EX9 A;  4XDW A;  1BRS A;  2WO0 A;  4R9K A;  4WHA A;  3I55 3;  4EXR A;  1AQZ A;  1TJD A;  1VQ8 3;  3OWY A;  3Q2P A;  3H51 A;  1I3F A;  1AVK A;  4X2H A;  3LTB A;  1DMN A;  5FGO A;  4HZ9 B;  3AMO B;  1Q42 A;  2KF3 A;  1G96 A;  3F8X A;  3FGY A;  3PYJ A;  1L5G B;  4EC6 A;  1NNV A;  3DGO A;  3JVC A;  1NB3 I;  3CCQ 3;  1Q82 4;  3HZP A;  1B2M A;  1BAO A;  1IQY A;  1OHS A;  3NV0 B;  1UCK A;  3FCS B;  3LT9 A;  2F99 A;  2CWT A;  2J8X B;  2JDI H;  3K63 A;  1F8N A;  1RLS A;  1FGO A;  3CXC 2;  1IQ8 A;  1W4N A;  1OGZ A;  4I5Q A;  2V1L A;  2WGQ A;  2BT3 A;  5DRE A;  4GL6 A;  1O7H B;  2GEX A;  3DXO A;  1TTO A;  1RNT A;  1UCL A;  3NUV A;  1JBR A;  5ELJ A;  2KRT A;  3BIR A;  1YGW A;  1N9E A;  4GB5 A;  3K0Z A;  1O7M B;  2F5W A;  4JF8 A;  4STD A;  3MG1 A;  1NO3 A;  2C4B A;  5A0O B;  1SQW A;  3AMO A;  3VGN A;  3EC9 A;  1FZU A;  2D42 A;  1K73 4;  3G71 3;  1OF5 A;  1QMA A;  1BRH A;  1NU3 A;  1V74 A;  3DH2 A;  3DZL A;  1G0T A;  2O3O A;  1X1Y A;  2L4V A;  3E99 A;  3FSD A;  2XSO B;  3DUK A;  4NPB A;  3T0U A;  1CH0 A;  2W56 A;  2PNC A;  3URP A;  4RBN A;  2Q07 A;  4RNY A;  4X2O A;  1FUS A;  3LZA A;  3OX9 A;  1GMR A;  5G1K A;  1DYU A;  3HIG A;  1A90 A;  7GSP A;  4HBR A;  4O3V A;  2GEY A;  3X40 A;  4HM4 B;  2C10 A;  1Q40 A;  2C11 A;  1A2P A;  1VQ5 3;  2OQE C;  1IU7 A;  3UB1 A;  3PZW A;  4AKZ A;  5CK6 A;  3EBT A;  9RNT A;  4HM6 B;  3BU4 A;  4HM3 B;  3S27 A;  3WR2 A;  1YVB I;  3MKI A;  4KFD A;  1X1W A;  5HOH A;  3G16 A;  3IPT A;  2CKF B;  1BU4 A;  3S67 A;  5IER A;  1GY6 A;  1LQM B;  3RGR A;  3N54 B;  4LSO A;  4FMB A;  1BNJ A;  2W56 B;  5ELU A;  2STD A;  4FMA A;  3BNE A;  2IMJ A;  4HM7 B;  1WQL B;  5IG3 A;  2CG0 A;  4U13 A;  1QVG 2;  3G6E 3;  2PZV A;  4LMI A;  3BND A;  3CU3 A;  5IG5 A;  1VQ4 3;  4N6M A;  1O7W B;  4Q53 A;  3RGA A;  3FG4 A;  1RGG A;  2UGI A;  1B2X A;  3KN4 A;  4KZ1 A;  2H0G A;  4XB5 A;  1JZO A;  2OWP A;  2CHC A;  6RNT A;  3ROB A;  2Z7A A;  1W02 A;  1IYY A;  4LEH A;  1FA3 A;  3FH1 A;  1QAL A;  3KZT A;  1LVN A;  3RNT A;  3SVA A;  1NDO B;  1R4Y A;  3KE7 A;  3QK9 A;  1UI8 A;  4RNT A;  1RGC A;  3MSO A;  1ASK A;  1FGR A;  4HM0 B;  2E2U A;  4K1V A;  3LTD A;  3B8L A;  3G0K A;  4R80 A;  3CC4 3;  5JPP A;  1JBT A;  1YI2 3;  3GSP A;  2K3D A;  1UW1 A;  3NBB A;  4XBX A;  1D6Z A;  4LZI A;  3SOY A;  4FCM A;  1TFO A;  2IY2 A;  1D6U A;  1OH0 A;  2HMN B;  2Z6B A;  2HMJ B;  1EEJ A;  3KII A;  2QIY A;  1HKX A;  2CX0 A;  2WOF A;  3PS8 A;  4L7K A;  3F7X A;  1M1X B;  2CX1 A;  5G2G A;  3PCR A;  5LC6 A;  3EF8 A;  4WP5 A;  2W2C A;  3SOA A;  1DMM A;  3WA3 A;  1C54 A;  1IQX A;  2W03 A;  5AII A;  3S29 A;  2BIR A;  1ROA A;  4O2H A;  1T2H A;  5AYS C;  5BXQ A;  2RFR A;  2XGL A;  1JKG A;  2AAD A;  3BB9 A;  4FMD A;  3EQQ B;  4CPK A;  3EBY A;  1JB2 A;  3MG2 A;  1OF5 B;  5GSP A;  1CYV A;  4BTX A;  1K9M 4;  1EQK A;  1GOY A;  4N3V A;  4OVM A;  1D6Y A;  3NQY A;  1I70 A;  1B2U A;  2ML6 A;  3BNB A;  1LOW A;  2HMK B;  2OCT A;  3G4S 3;  2F5M A;  1TFK A;  1O7N B;  4IPB A;  1RN1 A;  2CG1 A;  3O8Y A;  1O7P B;  1VZZ A;  4BL3 A;  1SJW A;  3NV0 A;  1RN4 A;  1SIH A;  2Y73 A;  1OGX A;  4MJD A;  5KP1 A;  2Y74 A;  1BUJ A;  1RJO A;  4GHO A;  3SX1 A;  1W01 A;  3EE1 A;  1YIT 3;  3N9H A;  1QJG A;  2CH9 A;  2LYX A;  1JKG B;  1OHP A;  1QAF A;  3AHW A;  4LGQ A;  1BRN L;  4J8T A;  1FGM A;  1W6C A;  1X1X A;  3D9R A;  1IVW A;  1E3V A;  3HK4 A;  4R4K A;  1IVX A;  1RHL A;  3ZG0 A;  1NB5 I;  2CFK A;  1CYU A;  4ORL A;  1DE3 A;  1IT7 A;  2SBL A;  4O8S A;  2IYJ A;  3X42 A;  4HJL B;  1TRP A;  4HYZ A;  3EJV A;  1TRQ A;  3K5T A;  3B7C A;  2QEX 3;  1KWI A;  1JJ2 2;  3GZX B;  3LOY A;  1FUT A;  4K1U A;  2OTL 3;  1BSD A;  3EN8 A;  1LOY A;  2W0Q A;  1OAC A;  1ZS7 A;  4FMC A;  1RGF A;  4AEQ A;  3CNM A;  3WOF B;  5IF6 A;  1X1U A;  3RDE A;  3WA2 X;  3V92 A;  1BNG A;  4HM1 B;  4N6O B;  1I2G A;  2W9Q A;  1MGR A;  1YJN 3;  5IEN A;  2OOV C;  1M1K 4;  1KC8 4;  3FZW A;  1LQG C;  2HML B;  1FGT A;  4HM2 B;  1JNQ A;  1EA2 A;  2JQ5 A;  4RZM A;  5IEP A;  1PFP A;  5EVH A;  2XFT A;  3Q90 A;  1RGE A;  4HVN A;  3CPO A;  1PY3 A;  3PCS A;  1QAK A;  2KF6 A;  4XM4 A;  3K7C A;  2BNG A;  2ZA4 A;  3G8Z A;  1E97 A;  3DMC A;  1BRJ A;  3NM2 A;  4N6L A;  1JN5 A;  4KT3 B;  1YIJ 3;  4ILF A;  1N8Q A;  2YFJ B;  4O02 B;  3SED A;  1Q7Y 4;  1STF I;  3AHS A;  1KSI A;  2RSX A;  3QRD A;  1BRI A;  2WGO A;  4H3U A;  4N6V 0;  4NRE A;  2BU4 A;  4EYC A;  4MMY B;  1RGH A;  3FF2 A;  3CD6 3;  1ROV A;  1UCJ A;  1I8V A;  2GBX B;  2XSH B;  4EV5 A;  2H0I A;  2R4I A;  1VQO 3;  1M90 4;  1A67 A;  3F8H A;  1MWU A;  3U1W A;  2WOH A;  1OPY A;  1W7C A;  2INX A;  4WYK A;  2AAE A;  2L1S A;  3D5G A;  5D83 A;  1VQ6 3;  2GU3 A;  2CFG A;  3CME 3;  1UUV B;  3DGM A;  1RDS A;  2BMO B;  5JBS A;  4J5K A;  1HZ1 A;  3A5E A;  5AEU B;  3B4P A;  1JN5 B;  5LC7 A;  2IUK A;  1R4C A;  1VQ9 3;  1B2S A;  1ISK A;  1RRL A;  2RNT A;  1LNH A;  1VQN 3;  1J2B A;  3IMA B;  2F4Y A;  4BU4 A;  1VQ7 3;  1RMS A;  2I9W A;  5BVB A;  3PGB A;  3VF1 A;  1K41 A;  3OV4 A;  3KSE D;  1O7G B;  1RGL A;  3CCE 3;  3OW2 2;  1GMP A;  1Q81 4;  1W2B 2;  1B3S A;  3MG3 A;  4N6T A;  2D1W A;  2SAR A;  4CDL A;  3D5I A;  2FGT A;  2KXG A;  1PYL A;  4N6U A;  4RNZ A;  4BIR A;  2R41 A;  1LOX A;  4EV2 A;  1W6Y A;  3NBJ A;  4J5G A;  3FKA A;  3GZB A;  2ZL8 A;  3MPH A;  3WOD G;  1BGS A;  4HM5 B;  1UGH I;  2W9P A;  4HZB B;  4IIA A;  3MHE A;  1VQQ A;  5IEO A;  2ML5 A;  1BRK A;  3J7Y d; 
#chains in the Genus database with same CATH homology
 1RN7 A;  2BMQ B;  1WTH A;  2RGQ A;  4I4K A;  4PEJ A;  1QVF 2;  1DVD A;  2FNQ A;  3MYT A;  3EN1 B;  1IT8 A;  3JUP A;  1JRQ A;  1Q86 4;  2GBW B;  4KFE A;  2CFD A;  3KKG A;  3GZR A;  1STD A;  1W2Z A;  2XRX B;  3NQZ A;  5FW5 A;  1DVC A;  4XBT A;  4WFO A;  3CC2 3;  3HII A;  4K90 B;  1N5P A;  5IG4 A;  3CMA 3;  1GS3 A;  4HM8 B;  3CCS 3;  4NHF A;  1WNH A;  3FG3 A;  3LYG A;  3UJM A;  1RRH A;  1ULJ B;  3T8N A;  2YFL B;  3M8C A;  5KP4 A;  3NXJ A;  3FG1 A;  3CC7 3;  1AR0 A;  8CHO A;  1YJ9 3;  2LQV A;  1Y4K A;  2XFS A;  3BNC A;  4EBG A;  4KVH A;  1JB5 A;  2CK3 H;  3H3H A;  1MNL A;  3LTC A;  1TP6 A;  1W5Z A;  1PU4 A;  1A2V A;  1HU9 A;  4MMX B;  1WMO A;  3GAX A;  4FCZ A;  2XH9 A;  3T8U A;  5TGN A;  3CCR 3;  3LML A;  2QA4 3;  1RKY A;  3CCL 3;  2K0M A;  2XR8 B;  3HI7 A;  3JUQ A;  4IT7 A;  2YX9 A;  3EB8 A;  1IV9 A;  4N6N B;  1OHO A;  1W00 A;  1GY7 A;  1T5Y A;  5KP3 A;  1VQK 3;  4HKV B;  1EKM A;  3VSY A;  2F98 A;  3Q1C A;  1IV7 A;  5IW9 A;  4MEI A;  3F9S A;  1TUH A;  1FUW A;  1AVL A;  5AEW B;  2XF3 A;  3LT8 A;  1U8C B;  1A2K A;  2IA7 A;  1LXE A;  3F40 A;  2OTJ 3;  2IUJ A;  1SII A;  4R9L A;  3CNX A;  4TX4 A;  2P05 A;  5DRV A;  2MF7 A;  3A76 A;  3F14 A;  3CCU 3;  3UNL A;  4WWU C;  1S72 3;  3OWS A;  1NWW A;  4MMZ B;  2ZDJ A;  3SLU A;  1IVV A;  1N9J A;  2BO9 B;  2CC3 A;  3CCV 3;  5D82 A;  4BTW A;  5I97 A;  4J9A A;  2CWV A;  1DMQ A;  3JUM A;  1KQS 2;  1US1 A;  3ER7 A;  2HMO B;  3UL6 A;  1Z1S A;  1BUQ A;  5AIH A;  5D81 A;  5IG0 A;  1YJW 3;  3D3L A;  1U5O A;  1K8A 4;  3PXM A;  2E2V A;  2Z77 A;  4BTY A;  2F86 B;  5EEO A;  2W6J H;  3I56 3;  5JPU A;  3DM8 A;  1S5A A;  2FXT A;  3DGN A;  3NHX A;  2B24 B;  5STD A;  3I0Y A;  1IVU A;  1JB4 A;  1UI7 A;  4K61 A;  3S28 A;  3GWR A;  2B1X B;  2P09 A;  3ECF A;  3FLJ A;  1IDP A;  2Z76 A;  7STD A;  1YGE A;  4G1M B;  2E2T A;  5CXO A;  1WMN A;  1KD1 4;  1VQL 3;  4QWT A;  2K54 A;  3X41 A;  1GYB A;  1CEW I;  3V99 A;  1GD3 A;  3DY5 A;  3V98 A;  2QGU A;  2YFI B;  2P0M A;  4FCJ A;  1JV2 B;  3N8B A;  3MWZ A;  3LXU X;  1YHQ 3;  3NM7 A;  3UL5 A;  5CF1 A;  3LTA A;  3U97 A;  2O9U X;  1M9G A;  6STD A;  2CW9 A;  1CQS A;  4CCV A;  3IJE B;  2P38 A;  4H61 A;  1GY5 A;  1ZX2 A;  1N8R 4;  4AKY A;  2CWU A;  1UUW B;  5AIF A;  3DGL A;  3FF0 A;  2XGN A;  4ZM8 A;  3CCJ 3;  1MOL A;  2P0X A;  3HX8 A;  1GD4 A;  3KFQ C;  5AI1 A;  5AYR B;  3STD A;  2W04 A;  2MC8 A;  4L8O A;  1C7H A;  3BLZ A;  1E3R A;  4XDV A;  5HGR A;  2UX0 A;  3LH4 A;  2KCD A;  2CFW A;  3K9M C;  4JRF A;  1ZO2 A;  1IK3 A;  3JUN A;  1EG9 B;  4WYK B;  2CFL A;  4OK0 A;  4L8P A;  3ALA A;  4R1K A;  1Q40 B;  5EQL A;  2OOV A;  1W6G A;  2GU1 A;  3X3Y A;  1K28 A;  3JUO A;  1AV4 A;  1VQM 3;  2A15 A;  1TU5 A;  3CCM 3;  2HMM B;  3WDG B;  3CPW 2;  2OQE A;  3F7S A;  5AIG A;  1N5H A;  2BMR B;  2CIU A;  3NBR A;  1ULI B;  3KSP A;  4FR9 A;  1NJI 4;  1TIJ A;  1OCV A;  3OWU A;  2GXF A;  3GRD A;  3X3Z A;  3B4O A;  1WMP A;  3TDG A;  3GZY B;  2BHM A;  4KFF A;  1SPU A;  4OUQ A;  3WMD A;  1OUN A;  3X3X A;  3L0R A;  2XEP A;  3EHC A;  1VQP 3;  5CF2 A;  3OXA A;  3S5C A;  2RCD A;  4XBY A;  5CLK A;  3SXX A;  3WOE B;  1FGQ A;  3NX0 A;  3EX9 A;  4XDW A;  2WO0 A;  4R9K A;  4WHA A;  3I55 3;  4EXR A;  1VQ8 3;  3OWY A;  3Q2P A;  3H51 A;  1AVK A;  4X2H A;  3LTB A;  1DMN A;  5FGO A;  4HZ9 B;  3AMO B;  1Q42 A;  1G96 A;  3F8X A;  3FGY A;  3PYJ A;  1L5G B;  4EC6 A;  3DGO A;  3JVC A;  1NB3 I;  3CCQ 3;  1Q82 4;  3HZP A;  1IQY A;  1OHS A;  3NV0 B;  3FCS B;  3LT9 A;  2F99 A;  2CWT A;  2JDI H;  3K63 A;  1F8N A;  1FGO A;  3CXC 2;  1IQ8 A;  1W4N A;  1OGZ A;  2V1L A;  2WGQ A;  2BT3 A;  5DRE A;  4GL6 A;  1O7H B;  2GEX A;  3DXO A;  3NUV A;  5ELJ A;  2KRT A;  1N9E A;  4GB5 A;  3K0Z A;  1O7M B;  4JF8 A;  4STD A;  3MG1 A;  1NO3 A;  5A0O B;  1SQW A;  3AMO A;  3VGN A;  3EC9 A;  2D42 A;  1K73 4;  3G71 3;  1OF5 A;  1QMA A;  1NU3 A;  1V74 A;  3DZL A;  2O3O A;  2L4V A;  3E99 A;  3FSD A;  2XSO B;  3DUK A;  3T0U A;  2W56 A;  2PNC A;  4RBN A;  2Q07 A;  4RNY A;  4X2O A;  3LZA A;  3OX9 A;  1DYU A;  3HIG A;  1A90 A;  4HBR A;  4O3V A;  2GEY A;  3X40 A;  4HM4 B;  2C10 A;  1Q40 A;  2C11 A;  1VQ5 3;  2OQE C;  1IU7 A;  3UB1 A;  3PZW A;  4AKZ A;  5CK6 A;  3EBT A;  4HM6 B;  4HM3 B;  3S27 A;  1YVB I;  3MKI A;  4KFD A;  3G16 A;  3IPT A;  2CKF B;  3S67 A;  5IER A;  1GY6 A;  3RGR A;  3N54 B;  4LSO A;  4FMB A;  2W56 B;  5ELU A;  2STD A;  4FMA A;  3BNE A;  2IMJ A;  4HM7 B;  1WQL B;  5IG3 A;  2CG0 A;  4U13 A;  1QVG 2;  3G6E 3;  2PZV A;  4LMI A;  3BND A;  3CU3 A;  5IG5 A;  1VQ4 3;  4N6M A;  1O7W B;  4Q53 A;  3RGA A;  3FG4 A;  3KN4 A;  4KZ1 A;  4XB5 A;  2OWP A;  2CHC A;  3ROB A;  2Z7A A;  1W02 A;  4LEH A;  1FA3 A;  3FH1 A;  1QAL A;  3KZT A;  1LVN A;  3SVA A;  1NDO B;  3KE7 A;  3QK9 A;  1UI8 A;  3MSO A;  1ASK A;  1FGR A;  4HM0 B;  2E2U A;  4K1V A;  3LTD A;  3B8L A;  3G0K A;  4R80 A;  3CC4 3;  5JPP A;  1YI2 3;  3NBB A;  1UW1 A;  4XBX A;  1D6Z A;  4LZI A;  3SOY A;  4FCM A;  1TFO A;  1D6U A;  1OH0 A;  2HMN B;  2Z6B A;  2HMJ B;  3KII A;  2QIY A;  1HKX A;  3PS8 A;  2WOF A;  4L7K A;  3F7X A;  1M1X B;  5G2G A;  3PCR A;  5LC6 A;  3EF8 A;  4WP5 A;  2W2C A;  3SOA A;  1DMM A;  3WA3 A;  1IQX A;  2W03 A;  5AII A;  3S29 A;  1ROA A;  4O2H A;  5BXQ A;  5AYS C;  2RFR A;  2XGL A;  1JKG A;  3BB9 A;  4FMD A;  3EQQ B;  3EBY A;  1JB2 A;  3MG2 A;  1OF5 B;  4BTX A;  1CYV A;  1K9M 4;  1EQK A;  4N3V A;  4OVM A;  1D6Y A;  3NQY A;  2ML6 A;  3BNB A;  2HMK B;  2OCT A;  3G4S 3;  1TFK A;  1O7N B;  4IPB A;  2CG1 A;  3O8Y A;  1O7P B;  1VZZ A;  1SJW A;  3NV0 A;  1SIH A;  4MJD A;  2Y73 A;  1OGX A;  5KP1 A;  2Y74 A;  1RJO A;  3SX1 A;  1W01 A;  3EE1 A;  1YIT 3;  3N9H A;  1QJG A;  2CH9 A;  2LYX A;  1JKG B;  1OHP A;  1QAF A;  4LGQ A;  4J8T A;  1FGM A;  1W6C A;  3D9R A;  4R4K A;  1IVW A;  1E3V A;  3HK4 A;  1IVX A;  1NB5 I;  2CFK A;  1CYU A;  4ORL A;  1IT7 A;  2SBL A;  4O8S A;  3X42 A;  4HJL B;  4HYZ A;  3EJV A;  3K5T A;  3B7C A;  2QEX 3;  1KWI A;  1JJ2 2;  3GZX B;  3LOY A;  2OTL 3;  4K1U A;  4FMC A;  3EN8 A;  2W0Q A;  1OAC A;  4AEQ A;  3CNM A;  3WOF B;  5IF6 A;  3RDE A;  3WA2 X;  3V92 A;  4HM1 B;  4N6O B;  2W9Q A;  1YJN 3;  5IEN A;  2OOV C;  1M1K 4;  1KC8 4;  3FZW A;  2HML B;  1FGT A;  4HM2 B;  1JNQ A;  1EA2 A;  2JQ5 A;  4RZM A;  5IEP A;  1PFP A;  5EVH A;  2XFT A;  3Q90 A;  4HVN A;  3CPO A;  3PCS A;  1QAK A;  4XM4 A;  3K7C A;  2BNG A;  3G8Z A;  1E97 A;  3DMC A;  3NM2 A;  4N6L A;  1JN5 A;  1YIJ 3;  1N8Q A;  2YFJ B;  4O02 B;  3SED A;  1Q7Y 4;  1STF I;  1KSI A;  2RSX A;  3QRD A;  2WGO A;  4H3U A;  4N6V 0;  4NRE A;  4EYC A;  3CD6 3;  4MMY B;  3FF2 A;  1ROV A;  2GBX B;  2XSH B;  4EV5 A;  2R4I A;  1VQO 3;  1M90 4;  1A67 A;  3F8H A;  3U1W A;  2WOH A;  1OPY A;  1W7C A;  2INX A;  4WYK A;  5D83 A;  1VQ6 3;  2GU3 A;  2CFG A;  3CME 3;  1UUV B;  3DGM A;  2BMO B;  5JBS A;  1VQ9 3;  5AEU B;  3B4P A;  1JN5 B;  5LC7 A;  2IUK A;  1R4C A;  1ISK A;  1RRL A;  1VQN 3;  1LNH A;  1J2B A;  3IMA B;  1VQ7 3;  2I9W A;  5BVB A;  3PGB A;  3VF1 A;  1K41 A;  3OV4 A;  3KSE D;  1O7G B;  3CCE 3;  3OW2 2;  1Q81 4;  1W2B 2;  3MG3 A;  4N6T A;  2D1W A;  4CDL A;  2FGT A;  2KXG A;  4N6U A;  4RNZ A;  1LOX A;  4EV2 A;  1W6Y A;  3NBJ A;  3FKA A;  3GZB A;  2ZL8 A;  3MPH A;  3WOD G;  4HM5 B;  2W9P A;  4HZB B;  4IIA A;  3MHE A;  5IEO A;  2ML5 A;  2M7O A;  3J7Y d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...