4O2HA

Crystal structure of bcam1869 protein (rsam homolog) from burkholderia cenocepacia
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
TSPLLHPVPGPSPDGYVRLSEGALAALVLDHVASGLDPSLLAELRDNAIDARLAGYTEWHRTAGAGVAYVTVGWDWYLERATGTFVIAGGDVRSNVMAIDAKGADIGMLRTAAALAARLAALDWPAAVASALLGHND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords protein BCAM1869
publication title RsaM: a transcriptional regulator of Burkholderia spp. with novel fold.
pubmed doi rcsb
source organism Burkholderia cenocepacia
total genus 33
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16245 DUF4902 Domain of unknown function (DUF4902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.610 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o2hA00
4O2HA
chains in the Genus database with same CATH superfamily
1UCIA 2P38A 2XEPA 2WGQA 3CC23 4ILFA 1ZS7A 1VQO3 3JUPA 2OQEC 3NHXA 2IUKA 1GOVA 3EBTA 3EQQB 1K734 4EXRA 4JRFA 1B2ZA 3MKIA 1BRNL 3K5TA 1I70A 2Q07A 4MMYB 2UX0A 1N5PA 1MOLA 4O02B 4XDWA 1Q864 1RNBA 1BSEA 1E97A 4XDVA 1JRQA 1ROVA 4FMDA 5D83A 3D9RA 4WWUC 4CDLA 4FCJA 4EW5A 1B20A 3I563 1JN5A 1BANA 1M1XB 3U1WA 1ZGXA 5KP4A 4BTYA 2GBXB 3CCV3 5EEOA 3KIIA 3CCS3 3UB1A 1RN7A 2KF5A 1U8CB 3G6E3 2H0HA 1GY5A 2QGUA 1VQ63 1OF5A 4HZBB 7RNTA 1X1WA 3NV0A 2Z77A 1I0VA 3SYUA 4OUQA 5D82A 1JBSA 4FMCA 2XSOB 3G16A 3GZXB 4IPBA 1C54A 1C7HA 1W01A 3MYTA 1Q824 3EJVA 5IG4A 1IT7A 1W02A 3N8BA 2FGTA 5IG3A 2MC8A 3MPHA 2C11A 1BNEA 4LSOA 2UUGC 3CMA3 1N8QA 1SIHA 2W2CA 1FUTA 1A67A 2D42A 5RNTA 4MJDA 3WA3A 2J8XB 3CCL3 2HMNB 3D79A 1R4CA 1STDA 3GSPA 4N6TA 1OUNA 1D6ZA 4BL3A 3LXUX 1CYVA 1DVCA 3MHEA 4JF8A 5I97A 5IEOA 2O3OA 3K63A 4EBGA 1WMOA 1YI23 1LRAA 1EQKA 4GSPA 2BMRB 5AIGA 2KF6A 5ELJA 3S28A 1Q42A 1AV4A 3PYJA 1SJWA 4LYLB 3DXOA 3LYGA 5AEUB 1A90A 1IT8A 1IV7A 1SPUA 3F7XA 8RNTA 4HM8B 1B2MA 3KFQC 1DMNA 3T8UA 4HOHA 4R9KA 3CC73 1BIRA 1IVWA 1EEJA 3M8CA 1K9M4 1WQLB 1Q40B 1RJOA 1HZ1A 3F40A 1LOWA 1D6UA 3LT8A 1S723 1VQL3 2KF3A 2AADA 2C4BA 5IEPA 4WFOA 2JDIH 3WOFB 3G713 2CKFB 1NB3I 1DE3A 5HGRA 2CFDA 2XR8B 1UCJA 1TJDA 3B8LA 4HM4B 3UNLA 4HM0B 4RNYA 1Z1SA 2WOHA 5CXOA 1NJI4 1N8R4 3STDA 1JB4A 1TTOA 3BU4A 4WYKA 1DETA 1QJGA 1VQQA 3FGYA 1ULJB 3EX9A 1BSBA 1R4YA 4O8SA 1IQ8A 1GMPA 1BNRA 1FUWA 1O7HB 1OACA 4N6LA 1BRHA 2ZA4A 1BSCA 1MWRA 3F14A 3WA2X 2B1XB 2R41A 3FG3A 3MWZA 6GSPA 1RKYA 2W04A 4H3UA 1RSNA 1T3BA 3OV4A 3FG1A 3DGNA 1B2UA 2ML6A 2XH9A 4GHOA 4FCZA 3B4OA 3DH2A 3GWRA 2GXFA 3OW22 3SEDA 1UI8A 1JZOA 3UL6A 3HI7A 1YJ93 4DKIA 1WMNA 3H3HA 3GRDA 2BMOB 2W6JH 3BLZA 1T2HA 1YHQ3 1YGEA 2XFTA 3V99A 1BRKA 2L1SA 1U5OA 1GD4A 4KFFA 1W6YA 4BU4A 2CHCA 2XGLA 4K1UA 1PYLA 2GEYA 2PNCA 3D5GA 1HU9A 3GZYB 1OH0A 5JBSA 1G96A 1BOXA 2CG0A 1RMSA 1QVG2 3VF1A 3MG3A 1UUWB 1JN5B 4HVNA 3J7Yd 4WHAA 1A2PA 2ML5A 3D5IA 1DYUA 3H51A 3KSED 1TU5A 1UCKA 4OVMA 4WP5A 2KXGA 4KZ1A 5AEWB 2K0MA 3KCHA 3FH1A 4HM5B 3LTAA 3SX1A 5HOHA 1OF5B 2GSPA 5AIIA 3NV0B 3NM7A 1IU7A 1MNLA 3B7CA 1HKXA 4G1MB 4KT3B 1QALA 5AYSC 4PEJA 1BNSA 3FSDA 1RNTA 1BGSA 1GY6A 3EHCA 3PGBA 4L8PA 1ZX2A 1G0TA 1LNHA 4XB5A 2WOFA 2GU1A 1ZO2A 1RGKA 1W7CA 3AMOA 3N54B 3Q1CA 3ROBA 4R4KA 2KRTA 3CU3A 1VZZA 2UGIA 2W56A 4XBYA 3S5CA 3S29A 1GY7A 1UUGB 1FYSA 2OTL3 3DGOA 1BRGA 2BMQB 3WR2A 3NXJA 4KVHA 1OGXA 1X1XA 1O7PB 5LC7A 1RCKA 5IENA 1CH0A 1BU4A 3LH4A 3F8XA 1RTUA 4STDA 1NWWA 1JKGB 3DGYA 4KFDA 4LMIA 1BRJA 5AIHA 3S67A 1EA2A 1LOXA 4RZMA 2V1LA 3T8NA 1IQYA 2GEXA 1GMRA 1D6YA 2YFJB 1FA3A 4MMZB 3IMAB 3CCJ3 1VQP3 1QMAA 4OK0A 5TGNA 1GOUA 3BNBA 2SARA 1I8VA 3CCU3 3ER7A 1V57A 4HM6B 4I5QA 1VQ43 1BRIA 1DMQA 2CC3A 4HYZA 4LGQA 2RSXA 1MGWA 1YNVX 4KFEA 4J8TA 2SBLA 5ELUA 2F86B 1KD14 1NO3A 2R4IA 3IPTA 3F8HA 3LOYA 4N6NB 5M1AA 2GU3A 4NHFA 4H61A 5CLKA 1I3IA 4HM7B 3URPA 1BAOA 1JV2B 4HZ9B 6RNTA 4FR9A 5AYRB 3CCQ3 4BIRA 1VQ53 2YX9A 2Y73A 5GSPA 2OTJ3 2B24B 3ALAA 1JKGA 3JUNA 2LQVA 4HJLB 1DVDA 1YGWA 1W6CA 3FCSB 1UCLA 5CF1A 2INXA 1RDSA 4WYKB 1KC84 5AI1A 1IVVA 2HMKB 5DREA 5IW9A 1JZDA 5LC6A 3U97A 3S27A 3UJMA 1BUJA 2AAEA 3Q2PA 2CIUA 1GD3A 2Z6BA 3WOEB 1GMQA 3MG2A 1N5HA 2JQ5A 3PCSA 3PS8A 1RGGA 1STFI 2CWVA 2QEX3 3RNTA 2XGNA 3OX9A 4EV2A 7GSPA 2C10A 1QVF2 2XRXB 2RFRA 2WGOA 4N6MA 1VQM3 2W03A 3NQZA 1ULIB 3SLUA 4TX4A 3LTDA 1LNIA 1I0XA 3CCE3 2RCDA 1I2GA 1RRLA 2CH9A 2CX0A 3NBJA 2D1WA 4L8OA 1CEWI 8CHOA 1I2FA 1QAKA 1BRSA 1N9JA 2YFLB 2KAAA 1A2VA 1YJW3 2Z7AA 4R80A 2LYXA 2HMOB 1FGRA 1IV9A 2A15A 1FW7A 4AEQA 5G1LA 1IQXA 1W4NA 1TP6A 1JB5A 2W9PA 2IY2A 2XF3A 3F9SA 2HMLB 4RNZA 3WDGB 1M904 1K28A 4L7KA 1IK3A 3X41A 1B27A 2BO9B 2I9WA 4AKYA 2E2UA 3CD63 2FNQA 3NUVA 1BNFA 1VQK3 2MF7A 4N6V0 1LQMB 1ROAA 5CF2A 3K0ZA 2QA43 2OOVC 3RGRA 1EUIC 1GS3A 1X1UA 2P05A 3JVCA 3X40A 1T5YA 3I553 1QAFA 3JUOA 4K90B 1YIT3 3B4PA 4LEHA 5BXQA 1B2XA 3RGAA 3CCR3 1B21A 1RN1A 3FF2A 2W0QA 1UW1A 2K54A 3AMOB 5CK6A 1NU3A 1RGAA 2K3DA 2W56B 5EQLA 4HM1B 1K8A4 3NQYA 3LZAA 5JPPA 3K7CA 1RGCA 4EV5A 3L0RA 1W2B2 1RLSA 2BU4A 1VQ93 1L5GB 1KWIA 1AVKA 1FGQA 4O3VA 4HBRA 3NBBA 1NNVA 1JB2A 4GB5A 5D81A 3RDEA 2IMJA 3EE1A 4R1KA 1G02A 4IIAA 3JUQA 1J2BA 3IJEB 4XM4A 1BSAA 3OWSA 3PZWA 1RCLA 1US1A 1IYYA 1O7NB 1SQWA 1OPYA 4N6OB 5JPUA 9RNTA 1IDPA 1AR0A 3CNMA 3FZWA 1W00A 2P09A 3AGNA 1W6GA 3EN1B 4J5GA 3CXC2 3HZPA 4U13A 3SOYA 3HIGA 3G8ZA 3BNCA 3QK9A 1SIIA 1TRPA 1RGEA 3CME3 4J9AA 1ISKA 3GZRA 4NPBA 3DMCA 4RBNA 1OCVA 1E3VA 5STDA 3CPW2 3K9MC 2F5WA 1OHPA 2XFSA 2CFWA 4FMAA 1DMMA 2CK3H 2F99A 3N9HA 2F5MA 1RN4A 4CPKA 1BNIA 2RGQA 5KP3A 2GBWB 1IVUA 2M7OA 4RNTA 2Z76A 4XBXA 4AKZA 1OHSA 1RGFA 1TFKA 3BIRA 4R9LA 3ZG5A 3EF8A 1O7GB 3ZFZA 3DZLA 5BVBA 1WNHA 3SVAA 1X1YA 1I2EA 3LT9A 3MSOA 3ZG0A 2CFKA 3KN4A 2F98A 3BNDA 4HAAA 1NB5I 1I3FA 2PZVA 1K41A 2P0MA 4BTXA 2F56A 3LTBA 1HYFA 3LTCA 5DRVA 3EBYA 3X3ZA 4MEIA 5M19A 4BL2A 3CNXA 5IERA 3E99A 1AVLA 3EC9A 3FKAA 1RRHA 1MGRA 2HOHA 1TIJA 5IF6A 3GZBA 2CWTA 3NBRA 2STDA 3AGOA 4FMBA 1UI7A 3WHOA 1GSPA 5G1KA 3MG1A 1ASKA 5FW5A 2YFIB 3WMDA 2OWPA 3VSYA 2E2VA 2QIYA 3AHWA 1W2ZA 2WO0A 1PY3A 3BNEA 1M9GA 3DGLA 2CFLA 1WMPA 2O9UX 2E2TA 3ECFA 3OWYA 1KQS2 2OCTA 2KF4A 2BHMA 1LXEA 4K61A 4QWTA 1T2IA 1MWTA 2ZHXB 3HK4A 3PCRA 4J5KA 1E3RA 1UGHI 4N3VA 2CG1A 3T0UA 3WODG 1CQSA 3Q90A 1FGTA 3LMLA 4BTWA 1FGMA 2IUJA 3HIIA 5EVHA 1NDOB 2FXTA 3DY5A 3CCM3 3CC43 1KSIA 3HX8A 1S5AA 5IG0A 2P0XA 3F7SA 2H0GA 3D4AA 1JNQA 1YVBI 5G2GA 2OOVA 1N9EA 1UGIA 1A2KA 2HMMB 1MWUA 3DM8A 1YJN3 3DGMA 2KCDA 1FGOA 1YVSA 3Q3FA 4X2OA 3X42A 3PXMA 4X2HA 1BSDA 3G4S3 4N6UA 3UL5A 3KZTA 2BIRA 3FG4A 3QRDA 1TRQA 4LZIA 3O8YA 3FLJA 1TFOA 2HMJB 3NX0A 1RHLA 3GAXA 1Q9EA 1W5ZA 1Y4KA 2CW9A 3KKGA 4Q53A 4CJNA 1O7MB 2BNGA 1UUVB 4HKVB 2RBIA 4XBTA 4EC6A 1BNJA 1UDII 1O7WB 2CWUA 1CYUA 1LOYA 4FCMA 3X3XA 4ZM8A 4IT7A 1FZUA 3EB8A 1AY7A 1SARA 5A0OB 1GOYA 1IVXA 1LQGC 5IG5A 3HOHA 4O2HA 1V74A 4MMXB 1VQ83 1LOVA 1OHOA 3V98A 1V58A 1EKMA 2BT3A 3KSPA 4I4KA 2XSHB 1BUQA 2L4VA 1M1K4 5KP1A 1LVNA 1Q814 1BVIA 2CX1A 3EN8A 3OXAA 2IA7A 2Y74A 1PFPA 3VGNA 1AQZA 1MWSA 4GL6A 1RGHA 4NREA 1Q40A 5BIRA 1RGLA 3OWUA 2W9QA 4HM3B 3SOAA 4EYCA 2ZDJA 3NM2A 1B3SA 3I0YA 1EG9B 2H0IA 1TUHA 3BB9A 4HM2B 1JBTA 5FGOA 1GYBA 3D3LA 2OQEA 5BU4A 7STDA 5M18A 1Q7Y4 6STDA 1YIJ3 1JJ22 1OGZA 2F4YA 3JUMA 3KE7A 3DUKA 1BNGA 3SXXA 3V92A 4ORLA 1WTHA 3CPOA 2CFGA 1F8NA 3AHSA 1VQN3 1FUSA 2ZL8A 1PU4A 5AIFA 1JBRA 1B2SA 3A5EA 3X3YA 2IYJA 2RNTA 3A76A 3TDGA 4CCVA 3G0KA 1Q7HA 3FF0A 4K1VA 1VQ73
chains in the Genus database with same CATH topology
2P38A 2XEPA 2WGQA 3CC23 1VQO3 3JUPA 2OQEC 3NHXA 2IUKA 3EBTA 3EQQB 1K734 4EXRA 4JRFA 3MKIA 3K5TA 2Q07A 4MMYB 2UX0A 1N5PA 1MOLA 4O02B 4XDWA 1Q864 1E97A 4XDVA 1JRQA 1ROVA 4FMDA 5D83A 3D9RA 4WWUC 4CDLA 4FCJA 3I563 1JN5A 1M1XB 3U1WA 5KP4A 4BTYA 2GBXB 3CCV3 5EEOA 3KIIA 3CCS3 3UB1A 1RN7A 1U8CB 3G6E3 1GY5A 2QGUA 1VQ63 1OF5A 4HZBB 3NV0A 2Z77A 4OUQA 5D82A 4FMCA 2XSOB 3G16A 3GZXB 4IPBA 1C7HA 1W01A 3MYTA 1Q824 3EJVA 5IG4A 1IT7A 1W02A 3N8BA 2FGTA 5IG3A 2MC8A 3MPHA 2C11A 4LSOA 3CMA3 1N8QA 1SIHA 2W2CA 1A67A 2D42A 4MJDA 3WA3A 3CCL3 2HMNB 1R4CA 1STDA 4N6TA 1OUNA 1D6ZA 3LXUX 1CYVA 1DVCA 3MHEA 4JF8A 5I97A 5IEOA 2O3OA 3K63A 4EBGA 1WMOA 1YI23 1EQKA 2BMRB 5AIGA 5ELJA 3S28A 1Q42A 1AV4A 3PYJA 1SJWA 3DXOA 3LYGA 5AEUB 1A90A 1IT8A 1IV7A 1SPUA 3F7XA 4HM8B 3KFQC 1DMNA 3T8UA 4R9KA 3CC73 1IVWA 3M8CA 1K9M4 1WQLB 1Q40B 1RJOA 3F40A 1D6UA 3LT8A 1S723 1VQL3 5IEPA 4WFOA 2JDIH 3WOFB 3G713 2CKFB 1NB3I 5HGRA 2CFDA 2XR8B 3B8LA 4HM4B 3UNLA 4HM0B 4RNYA 1Z1SA 2WOHA 5CXOA 1NJI4 1N8R4 3STDA 1JB4A 4WYKA 1QJGA 3FGYA 1ULJB 3EX9A 4O8SA 1IQ8A 1FUWA 1O7HB 1OACA 4N6LA 3F14A 3WA2X 2B1XB 3FG3A 3MWZA 1RKYA 2W04A 4H3UA 3OV4A 3FG1A 3DGNA 2ML6A 2XH9A 4FCZA 3B4OA 3GWRA 2GXFA 3OW22 3SEDA 1UI8A 3UL6A 3HI7A 1YJ93 1WMNA 3H3HA 3GRDA 2BMOB 2W6JH 3BLZA 1YHQ3 1YGEA 2XFTA 3V99A 1U5OA 1GD4A 4KFFA 1W6YA 2CHCA 2XGLA 4K1UA 2GEYA 2PNCA 1HU9A 3GZYB 1OH0A 5JBSA 1G96A 2CG0A 1QVG2 3VF1A 3MG3A 1UUWB 1JN5B 4HVNA 3J7Yd 4WHAA 2ML5A 1DYUA 3H51A 3KSED 1TU5A 4OVMA 4WP5A 2KXGA 4KZ1A 5AEWB 2K0MA 4HM5B 3FH1A 3SX1A 3LTAA 1OF5B 5AIIA 3NV0B 3NM7A 1IU7A 1MNLA 3B7CA 1HKXA 4G1MB 1QALA 5AYSC 4PEJA 3FSDA 3EHCA 1GY6A 3PGBA 4L8PA 1ZX2A 1LNHA 4XB5A 2WOFA 2GU1A 1ZO2A 1W7CA 3AMOA 3N54B 3Q1CA 3ROBA 4R4KA 2KRTA 3CU3A 1VZZA 2W56A 4XBYA 3S5CA 3S29A 1GY7A 2OTL3 3DGOA 2BMQB 3NXJA 4KVHA 1OGXA 1O7PB 5LC7A 5IENA 3LH4A 3F8XA 4STDA 1NWWA 1JKGB 4KFDA 4LMIA 5AIHA 3S67A 1EA2A 1LOXA 4RZMA 2V1LA 3T8NA 1IQYA 2GEXA 1D6YA 2YFJB 1FA3A 4MMZB 3IMAB 3CCJ3 1VQP3 1QMAA 4OK0A 5TGNA 3BNBA 3CCU3 3ER7A 4HM6B 1VQ43 1DMQA 2CC3A 4HYZA 4LGQA 2RSXA 4KFEA 4J8TA 2SBLA 5ELUA 2F86B 1KD14 1NO3A 2R4IA 3IPTA 3F8HA 3LOYA 4N6NB 2GU3A 4NHFA 4H61A 5CLKA 4HM7B 1JV2B 4HZ9B 4FR9A 5AYRB 3CCQ3 1VQ53 2YX9A 2Y73A 2OTJ3 2B24B 3ALAA 1JKGA 3JUNA 2LQVA 4HJLB 1DVDA 1W6CA 3FCSB 5CF1A 2INXA 4WYKB 1KC84 5AI1A 1IVVA 2HMKB 5DREA 5IW9A 5LC6A 3U97A 3S27A 3UJMA 3Q2PA 2CIUA 1GD3A 2Z6BA 3WOEB 3MG2A 1N5HA 2JQ5A 3PCSA 3PS8A 1STFI 2CWVA 2QEX3 2XGNA 3OX9A 4EV2A 2C10A 1QVF2 2XRXB 2RFRA 2WGOA 4N6MA 1VQM3 2W03A 3NQZA 1ULIB 3SLUA 4TX4A 3LTDA 3CCE3 2RCDA 2CH9A 1RRLA 3NBJA 2D1WA 4L8OA 1CEWI 8CHOA 1QAKA 1N9JA 2YFLB 1YJW3 1A2VA 2Z7AA 4R80A 2LYXA 2HMOB 1FGRA 1IV9A 2A15A 4AEQA 1IQXA 1W4NA 1TP6A 1JB5A 2W9PA 2XF3A 3F9SA 2HMLB 4RNZA 3WDGB 1M904 1K28A 4L7KA 1IK3A 3X41A 2BO9B 2I9WA 4AKYA 2E2UA 3CD63 2FNQA 3NUVA 1VQK3 2MF7A 4N6V0 1ROAA 5CF2A 3K0ZA 2QA43 2OOVC 3RGRA 1GS3A 2P05A 3JVCA 3X40A 1T5YA 3I553 1QAFA 3JUOA 4K90B 1YIT3 3B4PA 4LEHA 5BXQA 3RGAA 3CCR3 3FF2A 2W0QA 1UW1A 2K54A 3AMOB 5CK6A 1NU3A 2W56B 5EQLA 4HM1B 1K8A4 3NQYA 3LZAA 5JPPA 3K7CA 4EV5A 3L0RA 1W2B2 1VQ93 1L5GB 1KWIA 1AVKA 1FGQA 4O3VA 4HBRA 3NBBA 4GB5A 1JB2A 5D81A 3RDEA 2IMJA 3EE1A 4R1KA 4IIAA 3JUQA 1J2BA 3IJEB 4XM4A 3OWSA 3PZWA 1US1A 1O7NB 1SQWA 1OPYA 4N6OB 5JPUA 1IDPA 1AR0A 3CNMA 3FZWA 1W00A 2P09A 1W6GA 3EN1B 3CXC2 3HZPA 4U13A 3SOYA 3HIGA 3G8ZA 3BNCA 3QK9A 1SIIA 3CME3 4J9AA 1ISKA 3GZRA 3DMCA 4RBNA 1OCVA 1E3VA 5STDA 3CPW2 3K9MC 1OHPA 2XFSA 2CFWA 4FMAA 1DMMA 2CK3H 2F99A 3N9HA 2RGQA 5KP3A 2GBWB 1IVUA 2M7OA 2Z76A 4XBXA 4AKZA 1OHSA 1TFKA 4R9LA 3EF8A 1O7GB 3DZLA 5BVBA 1WNHA 3SVAA 3LT9A 3MSOA 2CFKA 3KN4A 2F98A 3BNDA 1NB5I 2PZVA 1K41A 2P0MA 4BTXA 3LTBA 3LTCA 5DRVA 3EBYA 3X3ZA 4MEIA 3CNXA 5IERA 3E99A 1AVLA 3EC9A 3FKAA 1RRHA 1TIJA 5IF6A 3GZBA 2CWTA 3NBRA 2STDA 4FMBA 1UI7A 3MG1A 1ASKA 5FW5A 2YFIB 3WMDA 2OWPA 3VSYA 2E2VA 2QIYA 1W2ZA 2WO0A 3BNEA 1M9GA 3DGLA 2CFLA 1WMPA 2O9UX 2E2TA 3ECFA 3OWYA 1KQS2 2OCTA 2BHMA 1LXEA 4K61A 4QWTA 3T0UA 3HK4A 3PCRA 1E3RA 4N3VA 3WODG 2CG1A 1CQSA 3Q90A 1FGTA 3LMLA 4BTWA 1FGMA 2IUJA 3HIIA 5EVHA 1NDOB 2FXTA 3DY5A 3CCM3 3CC43 1KSIA 3HX8A 1S5AA 5IG0A 2P0XA 3F7SA 2OOVA 5G2GA 1JNQA 1YVBI 1N9EA 1A2KA 2HMMB 3DM8A 1YJN3 3DGMA 2KCDA 1FGOA 4X2OA 3X42A 3PXMA 4X2HA 3G4S3 4N6UA 3UL5A 3KZTA 3FG4A 3QRDA 4LZIA 3O8YA 3FLJA 1TFOA 2HMJB 3NX0A 3GAXA 1W5ZA 2CW9A 1Y4KA 3KKGA 4Q53A 1O7MB 2BNGA 1UUVB 4HKVB 4XBTA 4EC6A 1O7WB 2CWUA 1CYUA 4FCMA 3X3XA 4ZM8A 4IT7A 3EB8A 5A0OB 1IVXA 5IG5A 4O2HA 1V74A 4MMXB 1VQ83 3V98A 1OHOA 1EKMA 2BT3A 3KSPA 4I4KA 2XSHB 1BUQA 2L4VA 1M1K4 5KP1A 1LVNA 1Q814 3EN8A 3OXAA 2IA7A 2Y74A 1PFPA 3VGNA 4GL6A 4NREA 1Q40A 3OWUA 2W9QA 4HM3B 3SOAA 4EYCA 2ZDJA 3NM2A 3I0YA 1EG9B 1TUHA 3BB9A 4HM2B 5FGOA 1GYBA 3D3LA 2OQEA 7STDA 1Q7Y4 6STDA 1YIJ3 1JJ22 1OGZA 3JUMA 3KE7A 3DUKA 3SXXA 3V92A 4ORLA 1WTHA 3CPOA 2CFGA 1F8NA 1VQN3 2ZL8A 1PU4A 5AIFA 3X3YA 3TDGA 3A76A 4CCVA 3G0KA 3FF0A 4K1VA 1VQ73
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2H A; 
#chains in the Genus database with same CATH topology
 1UCI A;  2P38 A;  2XEP A;  2WGQ A;  3CC2 3;  4ILF A;  1ZS7 A;  1VQO 3;  3JUP A;  2OQE C;  3NHX A;  2IUK A;  1GOV A;  3EBT A;  3EQQ B;  1K73 4;  4EXR A;  4JRF A;  1B2Z A;  3MKI A;  1BRN L;  3K5T A;  1I70 A;  2Q07 A;  4MMY B;  2UX0 A;  1N5P A;  1MOL A;  4O02 B;  4XDW A;  1Q86 4;  1RNB A;  1BSE A;  1E97 A;  4XDV A;  1JRQ A;  1ROV A;  4FMD A;  5D83 A;  3D9R A;  4WWU C;  4CDL A;  4FCJ A;  4EW5 A;  1B20 A;  3I56 3;  1JN5 A;  1BAN A;  1M1X B;  3U1W A;  1ZGX A;  5KP4 A;  4BTY A;  2GBX B;  3CCV 3;  5EEO A;  3KII A;  3CCS 3;  3UB1 A;  1RN7 A;  2KF5 A;  1U8C B;  3G6E 3;  2H0H A;  1GY5 A;  2QGU A;  1VQ6 3;  1OF5 A;  4HZB B;  7RNT A;  1X1W A;  3NV0 A;  2Z77 A;  1I0V A;  3SYU A;  4OUQ A;  5D82 A;  1JBS A;  4FMC A;  2XSO B;  3G16 A;  3GZX B;  4IPB A;  1C54 A;  1C7H A;  1W01 A;  3MYT A;  1Q82 4;  3EJV A;  5IG4 A;  1IT7 A;  1W02 A;  3N8B A;  2FGT A;  5IG3 A;  2MC8 A;  3MPH A;  2C11 A;  1BNE A;  4LSO A;  2UUG C;  3CMA 3;  1N8Q A;  1SIH A;  2W2C A;  1FUT A;  1A67 A;  2D42 A;  5RNT A;  4MJD A;  3WA3 A;  2J8X B;  3CCL 3;  2HMN B;  3D79 A;  1R4C A;  1STD A;  3GSP A;  4N6T A;  1OUN A;  1D6Z A;  4BL3 A;  3LXU X;  1CYV A;  1DVC A;  3MHE A;  4JF8 A;  5I97 A;  5IEO A;  2O3O A;  3K63 A;  4EBG A;  1WMO A;  1YI2 3;  1LRA A;  1EQK A;  4GSP A;  2BMR B;  5AIG A;  2KF6 A;  5ELJ A;  3S28 A;  1Q42 A;  1AV4 A;  3PYJ A;  1SJW A;  4LYL B;  3DXO A;  3LYG A;  5AEU B;  1A90 A;  1IT8 A;  1IV7 A;  1SPU A;  3F7X A;  8RNT A;  4HM8 B;  1B2M A;  3KFQ C;  1DMN A;  3T8U A;  4HOH A;  4R9K A;  3CC7 3;  1BIR A;  1IVW A;  1EEJ A;  3M8C A;  1K9M 4;  1WQL B;  1Q40 B;  1RJO A;  1HZ1 A;  3F40 A;  1LOW A;  1D6U A;  3LT8 A;  1S72 3;  1VQL 3;  2KF3 A;  2AAD A;  2C4B A;  5IEP A;  4WFO A;  2JDI H;  3WOF B;  3G71 3;  2CKF B;  1NB3 I;  1DE3 A;  5HGR A;  2CFD A;  2XR8 B;  1UCJ A;  1TJD A;  3B8L A;  4HM4 B;  3UNL A;  4HM0 B;  4RNY A;  1Z1S A;  2WOH A;  5CXO A;  1NJI 4;  1N8R 4;  3STD A;  1JB4 A;  1TTO A;  3BU4 A;  4WYK A;  1DET A;  1QJG A;  1VQQ A;  3FGY A;  1ULJ B;  3EX9 A;  1BSB A;  1R4Y A;  4O8S A;  1IQ8 A;  1GMP A;  1BNR A;  1FUW A;  1O7H B;  1OAC A;  4N6L A;  1BRH A;  2ZA4 A;  1BSC A;  1MWR A;  3F14 A;  3WA2 X;  2B1X B;  2R41 A;  3FG3 A;  3MWZ A;  6GSP A;  1RKY A;  2W04 A;  4H3U A;  1RSN A;  1T3B A;  3OV4 A;  3FG1 A;  3DGN A;  1B2U A;  2ML6 A;  2XH9 A;  4GHO A;  4FCZ A;  3B4O A;  3DH2 A;  3GWR A;  2GXF A;  3OW2 2;  3SED A;  1UI8 A;  1JZO A;  3UL6 A;  3HI7 A;  1YJ9 3;  4DKI A;  1WMN A;  3H3H A;  3GRD A;  2BMO B;  2W6J H;  3BLZ A;  1T2H A;  1YHQ 3;  1YGE A;  2XFT A;  3V99 A;  1BRK A;  2L1S A;  1U5O A;  1GD4 A;  4KFF A;  1W6Y A;  4BU4 A;  2CHC A;  2XGL A;  4K1U A;  1PYL A;  2GEY A;  2PNC A;  3D5G A;  1HU9 A;  3GZY B;  1OH0 A;  5JBS A;  1G96 A;  1BOX A;  2CG0 A;  1RMS A;  1QVG 2;  3VF1 A;  3MG3 A;  1UUW B;  1JN5 B;  4HVN A;  3J7Y d;  4WHA A;  1A2P A;  2ML5 A;  3D5I A;  1DYU A;  3H51 A;  3KSE D;  1TU5 A;  1UCK A;  4OVM A;  4WP5 A;  2KXG A;  4KZ1 A;  5AEW B;  2K0M A;  3KCH A;  3FH1 A;  4HM5 B;  3LTA A;  3SX1 A;  5HOH A;  1OF5 B;  2GSP A;  5AII A;  3NV0 B;  3NM7 A;  1IU7 A;  1MNL A;  3B7C A;  1HKX A;  4G1M B;  4KT3 B;  1QAL A;  5AYS C;  4PEJ A;  1BNS A;  3FSD A;  1RNT A;  1BGS A;  1GY6 A;  3EHC A;  3PGB A;  4L8P A;  1ZX2 A;  1G0T A;  1LNH A;  4XB5 A;  2WOF A;  2GU1 A;  1ZO2 A;  1RGK A;  1W7C A;  3AMO A;  3N54 B;  3Q1C A;  3ROB A;  4R4K A;  2KRT A;  3CU3 A;  1VZZ A;  2UGI A;  2W56 A;  4XBY A;  3S5C A;  3S29 A;  1GY7 A;  1UUG B;  1FYS A;  2OTL 3;  3DGO A;  1BRG A;  2BMQ B;  3WR2 A;  3NXJ A;  4KVH A;  1OGX A;  1X1X A;  1O7P B;  5LC7 A;  1RCK A;  5IEN A;  1CH0 A;  1BU4 A;  3LH4 A;  3F8X A;  1RTU A;  4STD A;  1NWW A;  1JKG B;  3DGY A;  4KFD A;  4LMI A;  1BRJ A;  5AIH A;  3S67 A;  1EA2 A;  1LOX A;  4RZM A;  2V1L A;  3T8N A;  1IQY A;  2GEX A;  1GMR A;  1D6Y A;  2YFJ B;  1FA3 A;  4MMZ B;  3IMA B;  3CCJ 3;  1VQP 3;  1QMA A;  4OK0 A;  5TGN A;  1GOU A;  3BNB A;  2SAR A;  1I8V A;  3CCU 3;  3ER7 A;  1V57 A;  4HM6 B;  4I5Q A;  1VQ4 3;  1BRI A;  1DMQ A;  2CC3 A;  4HYZ A;  4LGQ A;  2RSX A;  1MGW A;  1YNV X;  4KFE A;  4J8T A;  2SBL A;  5ELU A;  2F86 B;  1KD1 4;  1NO3 A;  2R4I A;  3IPT A;  3F8H A;  3LOY A;  4N6N B;  5M1A A;  2GU3 A;  4NHF A;  4H61 A;  5CLK A;  1I3I A;  4HM7 B;  3URP A;  1BAO A;  1JV2 B;  4HZ9 B;  6RNT A;  4FR9 A;  5AYR B;  3CCQ 3;  4BIR A;  1VQ5 3;  2YX9 A;  2Y73 A;  5GSP A;  2OTJ 3;  2B24 B;  3ALA A;  1JKG A;  3JUN A;  2LQV A;  4HJL B;  1DVD A;  1YGW A;  1W6C A;  3FCS B;  1UCL A;  5CF1 A;  2INX A;  1RDS A;  4WYK B;  1KC8 4;  5AI1 A;  1IVV A;  2HMK B;  5DRE A;  5IW9 A;  1JZD A;  5LC6 A;  3U97 A;  3S27 A;  3UJM A;  1BUJ A;  2AAE A;  3Q2P A;  2CIU A;  1GD3 A;  2Z6B A;  3WOE B;  1GMQ A;  3MG2 A;  1N5H A;  2JQ5 A;  3PCS A;  3PS8 A;  1RGG A;  1STF I;  2CWV A;  2QEX 3;  3RNT A;  2XGN A;  3OX9 A;  4EV2 A;  7GSP A;  2C10 A;  1QVF 2;  2XRX B;  2RFR A;  2WGO A;  4N6M A;  1VQM 3;  2W03 A;  3NQZ A;  1ULI B;  3SLU A;  4TX4 A;  3LTD A;  1LNI A;  1I0X A;  3CCE 3;  2RCD A;  1I2G A;  1RRL A;  2CH9 A;  2CX0 A;  3NBJ A;  2D1W A;  4L8O A;  1CEW I;  8CHO A;  1I2F A;  1QAK A;  1BRS A;  1N9J A;  2YFL B;  2KAA A;  1A2V A;  1YJW 3;  2Z7A A;  4R80 A;  2LYX A;  2HMO B;  1FGR A;  1IV9 A;  2A15 A;  1FW7 A;  4AEQ A;  5G1L A;  1IQX A;  1W4N A;  1TP6 A;  1JB5 A;  2W9P A;  2IY2 A;  2XF3 A;  3F9S A;  2HML B;  4RNZ A;  3WDG B;  1M90 4;  1K28 A;  4L7K A;  1IK3 A;  3X41 A;  1B27 A;  2BO9 B;  2I9W A;  4AKY A;  2E2U A;  3CD6 3;  2FNQ A;  3NUV A;  1BNF A;  1VQK 3;  2MF7 A;  4N6V 0;  1LQM B;  1ROA A;  5CF2 A;  3K0Z A;  2QA4 3;  2OOV C;  3RGR A;  1EUI C;  1GS3 A;  1X1U A;  2P05 A;  3JVC A;  3X40 A;  1T5Y A;  3I55 3;  1QAF A;  3JUO A;  4K90 B;  1YIT 3;  3B4P A;  4LEH A;  5BXQ A;  1B2X A;  3RGA A;  3CCR 3;  1B21 A;  1RN1 A;  3FF2 A;  2W0Q A;  1UW1 A;  2K54 A;  3AMO B;  5CK6 A;  1NU3 A;  1RGA A;  2K3D A;  2W56 B;  5EQL A;  4HM1 B;  1K8A 4;  3NQY A;  3LZA A;  5JPP A;  3K7C A;  1RGC A;  4EV5 A;  3L0R A;  1W2B 2;  1RLS A;  2BU4 A;  1VQ9 3;  1L5G B;  1KWI A;  1AVK A;  1FGQ A;  4O3V A;  4HBR A;  3NBB A;  1NNV A;  1JB2 A;  4GB5 A;  5D81 A;  3RDE A;  2IMJ A;  3EE1 A;  4R1K A;  1G02 A;  4IIA A;  3JUQ A;  1J2B A;  3IJE B;  4XM4 A;  1BSA A;  3OWS A;  3PZW A;  1RCL A;  1US1 A;  1IYY A;  1O7N B;  1SQW A;  1OPY A;  4N6O B;  5JPU A;  9RNT A;  1IDP A;  1AR0 A;  3CNM A;  3FZW A;  1W00 A;  2P09 A;  3AGN A;  1W6G A;  3EN1 B;  4J5G A;  3CXC 2;  3HZP A;  4U13 A;  3SOY A;  3HIG A;  3G8Z A;  3BNC A;  3QK9 A;  1SII A;  1TRP A;  1RGE A;  3CME 3;  4J9A A;  1ISK A;  3GZR A;  4NPB A;  3DMC A;  4RBN A;  1OCV A;  1E3V A;  5STD A;  3CPW 2;  3K9M C;  2F5W A;  1OHP A;  2XFS A;  2CFW A;  4FMA A;  1DMM A;  2CK3 H;  2F99 A;  3N9H A;  2F5M A;  1RN4 A;  4CPK A;  1BNI A;  2RGQ A;  5KP3 A;  2GBW B;  1IVU A;  2M7O A;  4RNT A;  2Z76 A;  4XBX A;  4AKZ A;  1OHS A;  1RGF A;  1TFK A;  3BIR A;  4R9L A;  3ZG5 A;  3EF8 A;  1O7G B;  3ZFZ A;  3DZL A;  5BVB A;  1WNH A;  3SVA A;  1X1Y A;  1I2E A;  3LT9 A;  3MSO A;  3ZG0 A;  2CFK A;  3KN4 A;  2F98 A;  3BND A;  4HAA A;  1NB5 I;  1I3F A;  2PZV A;  1K41 A;  2P0M A;  4BTX A;  2F56 A;  3LTB A;  1HYF A;  3LTC A;  5DRV A;  3EBY A;  3X3Z A;  4MEI A;  5M19 A;  4BL2 A;  3CNX A;  5IER A;  3E99 A;  1AVL A;  3EC9 A;  3FKA A;  1RRH A;  1MGR A;  2HOH A;  1TIJ A;  5IF6 A;  3GZB A;  2CWT A;  3NBR A;  2STD A;  3AGO A;  4FMB A;  1UI7 A;  3WHO A;  1GSP A;  5G1K A;  3MG1 A;  1ASK A;  5FW5 A;  2YFI B;  3WMD A;  2OWP A;  3VSY A;  2E2V A;  2QIY A;  3AHW A;  1W2Z A;  2WO0 A;  1PY3 A;  3BNE A;  1M9G A;  3DGL A;  2CFL A;  1WMP A;  2O9U X;  2E2T A;  3ECF A;  3OWY A;  1KQS 2;  2OCT A;  2KF4 A;  2BHM A;  1LXE A;  4K61 A;  4QWT A;  1T2I A;  1MWT A;  2ZHX B;  3HK4 A;  3PCR A;  4J5K A;  1E3R A;  1UGH I;  4N3V A;  2CG1 A;  3T0U A;  3WOD G;  1CQS A;  3Q90 A;  1FGT A;  3LML A;  4BTW A;  1FGM A;  2IUJ A;  3HII A;  5EVH A;  1NDO B;  2FXT A;  3DY5 A;  3CCM 3;  3CC4 3;  1KSI A;  3HX8 A;  1S5A A;  5IG0 A;  2P0X A;  3F7S A;  2H0G A;  3D4A A;  1JNQ A;  1YVB I;  5G2G A;  2OOV A;  1N9E A;  1UGI A;  1A2K A;  2HMM B;  1MWU A;  3DM8 A;  1YJN 3;  3DGM A;  2KCD A;  1FGO A;  1YVS A;  3Q3F A;  4X2O A;  3X42 A;  3PXM A;  4X2H A;  1BSD A;  3G4S 3;  4N6U A;  3UL5 A;  3KZT A;  2BIR A;  3FG4 A;  3QRD A;  1TRQ A;  4LZI A;  3O8Y A;  3FLJ A;  1TFO A;  2HMJ B;  3NX0 A;  1RHL A;  3GAX A;  1Q9E A;  1W5Z A;  1Y4K A;  2CW9 A;  3KKG A;  4Q53 A;  4CJN A;  1O7M B;  2BNG A;  1UUV B;  4HKV B;  2RBI A;  4XBT A;  4EC6 A;  1BNJ A;  1UDI I;  1O7W B;  2CWU A;  1CYU A;  1LOY A;  4FCM A;  3X3X A;  4ZM8 A;  4IT7 A;  1FZU A;  3EB8 A;  1AY7 A;  1SAR A;  5A0O B;  1GOY A;  1IVX A;  1LQG C;  5IG5 A;  3HOH A;  4O2H A;  1V74 A;  4MMX B;  1VQ8 3;  1LOV A;  1OHO A;  3V98 A;  1V58 A;  1EKM A;  2BT3 A;  3KSP A;  4I4K A;  2XSH B;  1BUQ A;  2L4V A;  1M1K 4;  5KP1 A;  1LVN A;  1Q81 4;  1BVI A;  2CX1 A;  3EN8 A;  3OXA A;  2IA7 A;  2Y74 A;  1PFP A;  3VGN A;  1AQZ A;  1MWS A;  4GL6 A;  1RGH A;  4NRE A;  1Q40 A;  5BIR A;  1RGL A;  3OWU A;  2W9Q A;  4HM3 B;  3SOA A;  4EYC A;  2ZDJ A;  3NM2 A;  1B3S A;  3I0Y A;  1EG9 B;  2H0I A;  1TUH A;  3BB9 A;  4HM2 B;  1JBT A;  5FGO A;  1GYB A;  3D3L A;  2OQE A;  5BU4 A;  7STD A;  5M18 A;  1Q7Y 4;  6STD A;  1YIJ 3;  1JJ2 2;  1OGZ A;  2F4Y A;  3JUM A;  3KE7 A;  3DUK A;  1BNG A;  3SXX A;  3V92 A;  4ORL A;  1WTH A;  3CPO A;  2CFG A;  1F8N A;  3AHS A;  1VQN 3;  1FUS A;  2ZL8 A;  1PU4 A;  5AIF A;  1JBR A;  1B2S A;  3A5E A;  3X3Y A;  2IYJ A;  2RNT A;  3A76 A;  3TDG A;  4CCV A;  3G0K A;  1Q7H A;  3FF0 A;  4K1V A;  1VQ7 3; 
#chains in the Genus database with same CATH homology
 2P38 A;  2XEP A;  2WGQ A;  3CC2 3;  1VQO 3;  3JUP A;  2OQE C;  3NHX A;  2IUK A;  3EBT A;  3EQQ B;  1K73 4;  4EXR A;  4JRF A;  3MKI A;  3K5T A;  2Q07 A;  4MMY B;  2UX0 A;  1N5P A;  1MOL A;  4O02 B;  4XDW A;  1Q86 4;  1E97 A;  4XDV A;  1JRQ A;  1ROV A;  4FMD A;  5D83 A;  3D9R A;  4WWU C;  4CDL A;  4FCJ A;  3I56 3;  1JN5 A;  1M1X B;  3U1W A;  5KP4 A;  4BTY A;  2GBX B;  3CCV 3;  5EEO A;  3KII A;  3CCS 3;  3UB1 A;  1RN7 A;  1U8C B;  3G6E 3;  1GY5 A;  2QGU A;  1VQ6 3;  1OF5 A;  4HZB B;  3NV0 A;  2Z77 A;  4OUQ A;  5D82 A;  4FMC A;  2XSO B;  3G16 A;  3GZX B;  4IPB A;  1C7H A;  1W01 A;  3MYT A;  1Q82 4;  3EJV A;  5IG4 A;  1IT7 A;  1W02 A;  3N8B A;  2FGT A;  5IG3 A;  2MC8 A;  3MPH A;  2C11 A;  4LSO A;  3CMA 3;  1N8Q A;  1SIH A;  2W2C A;  1A67 A;  2D42 A;  4MJD A;  3WA3 A;  3CCL 3;  2HMN B;  1R4C A;  1STD A;  4N6T A;  1OUN A;  1D6Z A;  3LXU X;  1CYV A;  1DVC A;  3MHE A;  4JF8 A;  5I97 A;  5IEO A;  2O3O A;  3K63 A;  4EBG A;  1WMO A;  1YI2 3;  1EQK A;  2BMR B;  5AIG A;  5ELJ A;  3S28 A;  1Q42 A;  1AV4 A;  3PYJ A;  1SJW A;  3DXO A;  3LYG A;  5AEU B;  1A90 A;  1IT8 A;  1IV7 A;  1SPU A;  3F7X A;  4HM8 B;  3KFQ C;  1DMN A;  3T8U A;  4R9K A;  3CC7 3;  1IVW A;  3M8C A;  1K9M 4;  1WQL B;  1Q40 B;  1RJO A;  3F40 A;  1D6U A;  3LT8 A;  1S72 3;  1VQL 3;  5IEP A;  4WFO A;  2JDI H;  3WOF B;  3G71 3;  2CKF B;  1NB3 I;  5HGR A;  2CFD A;  2XR8 B;  3B8L A;  4HM4 B;  3UNL A;  4HM0 B;  4RNY A;  1Z1S A;  2WOH A;  5CXO A;  1NJI 4;  1N8R 4;  3STD A;  1JB4 A;  4WYK A;  1QJG A;  3FGY A;  1ULJ B;  3EX9 A;  4O8S A;  1IQ8 A;  1FUW A;  1O7H B;  1OAC A;  4N6L A;  3F14 A;  3WA2 X;  2B1X B;  3FG3 A;  3MWZ A;  1RKY A;  2W04 A;  4H3U A;  3OV4 A;  3FG1 A;  3DGN A;  2ML6 A;  2XH9 A;  4FCZ A;  3B4O A;  3GWR A;  2GXF A;  3OW2 2;  3SED A;  1UI8 A;  3UL6 A;  3HI7 A;  1YJ9 3;  1WMN A;  3H3H A;  3GRD A;  2BMO B;  2W6J H;  3BLZ A;  1YHQ 3;  1YGE A;  2XFT A;  3V99 A;  1U5O A;  1GD4 A;  4KFF A;  1W6Y A;  2CHC A;  2XGL A;  4K1U A;  2GEY A;  2PNC A;  1HU9 A;  3GZY B;  1OH0 A;  5JBS A;  1G96 A;  2CG0 A;  1QVG 2;  3VF1 A;  3MG3 A;  1UUW B;  1JN5 B;  4HVN A;  3J7Y d;  4WHA A;  2ML5 A;  1DYU A;  3H51 A;  3KSE D;  1TU5 A;  4OVM A;  4WP5 A;  2KXG A;  4KZ1 A;  5AEW B;  2K0M A;  4HM5 B;  3FH1 A;  3SX1 A;  3LTA A;  1OF5 B;  5AII A;  3NV0 B;  3NM7 A;  1IU7 A;  1MNL A;  3B7C A;  1HKX A;  4G1M B;  1QAL A;  5AYS C;  4PEJ A;  3FSD A;  3EHC A;  1GY6 A;  3PGB A;  4L8P A;  1ZX2 A;  1LNH A;  4XB5 A;  2WOF A;  2GU1 A;  1ZO2 A;  1W7C A;  3AMO A;  3N54 B;  3Q1C A;  3ROB A;  4R4K A;  2KRT A;  3CU3 A;  1VZZ A;  2W56 A;  4XBY A;  3S5C A;  3S29 A;  1GY7 A;  2OTL 3;  3DGO A;  2BMQ B;  3NXJ A;  4KVH A;  1OGX A;  1O7P B;  5LC7 A;  5IEN A;  3LH4 A;  3F8X A;  4STD A;  1NWW A;  1JKG B;  4KFD A;  4LMI A;  5AIH A;  3S67 A;  1EA2 A;  1LOX A;  4RZM A;  2V1L A;  3T8N A;  1IQY A;  2GEX A;  1D6Y A;  2YFJ B;  1FA3 A;  4MMZ B;  3IMA B;  3CCJ 3;  1VQP 3;  1QMA A;  4OK0 A;  5TGN A;  3BNB A;  3CCU 3;  3ER7 A;  4HM6 B;  1VQ4 3;  1DMQ A;  2CC3 A;  4HYZ A;  4LGQ A;  2RSX A;  4KFE A;  4J8T A;  2SBL A;  5ELU A;  2F86 B;  1KD1 4;  1NO3 A;  2R4I A;  3IPT A;  3F8H A;  3LOY A;  4N6N B;  2GU3 A;  4NHF A;  4H61 A;  5CLK A;  4HM7 B;  1JV2 B;  4HZ9 B;  4FR9 A;  5AYR B;  3CCQ 3;  1VQ5 3;  2YX9 A;  2Y73 A;  2OTJ 3;  2B24 B;  3ALA A;  1JKG A;  3JUN A;  2LQV A;  4HJL B;  1DVD A;  1W6C A;  3FCS B;  5CF1 A;  2INX A;  4WYK B;  1KC8 4;  5AI1 A;  1IVV A;  2HMK B;  5DRE A;  5IW9 A;  5LC6 A;  3U97 A;  3S27 A;  3UJM A;  3Q2P A;  2CIU A;  1GD3 A;  2Z6B A;  3WOE B;  3MG2 A;  1N5H A;  2JQ5 A;  3PCS A;  3PS8 A;  1STF I;  2CWV A;  2QEX 3;  2XGN A;  3OX9 A;  4EV2 A;  2C10 A;  1QVF 2;  2XRX B;  2RFR A;  2WGO A;  4N6M A;  1VQM 3;  2W03 A;  3NQZ A;  1ULI B;  3SLU A;  4TX4 A;  3LTD A;  3CCE 3;  2RCD A;  2CH9 A;  1RRL A;  3NBJ A;  2D1W A;  4L8O A;  1CEW I;  8CHO A;  1QAK A;  1N9J A;  2YFL B;  1YJW 3;  1A2V A;  2Z7A A;  4R80 A;  2LYX A;  2HMO B;  1FGR A;  1IV9 A;  2A15 A;  4AEQ A;  1IQX A;  1W4N A;  1TP6 A;  1JB5 A;  2W9P A;  2XF3 A;  3F9S A;  2HML B;  4RNZ A;  3WDG B;  1M90 4;  1K28 A;  4L7K A;  1IK3 A;  3X41 A;  2BO9 B;  2I9W A;  4AKY A;  2E2U A;  3CD6 3;  2FNQ A;  3NUV A;  1VQK 3;  2MF7 A;  4N6V 0;  1ROA A;  5CF2 A;  3K0Z A;  2QA4 3;  2OOV C;  3RGR A;  1GS3 A;  2P05 A;  3JVC A;  3X40 A;  1T5Y A;  3I55 3;  1QAF A;  3JUO A;  4K90 B;  1YIT 3;  3B4P A;  4LEH A;  5BXQ A;  3RGA A;  3CCR 3;  3FF2 A;  2W0Q A;  1UW1 A;  2K54 A;  3AMO B;  5CK6 A;  1NU3 A;  2W56 B;  5EQL A;  4HM1 B;  1K8A 4;  3NQY A;  3LZA A;  5JPP A;  3K7C A;  4EV5 A;  3L0R A;  1W2B 2;  1VQ9 3;  1L5G B;  1KWI A;  1AVK A;  1FGQ A;  4O3V A;  4HBR A;  3NBB A;  4GB5 A;  1JB2 A;  5D81 A;  3RDE A;  2IMJ A;  3EE1 A;  4R1K A;  4IIA A;  3JUQ A;  1J2B A;  3IJE B;  4XM4 A;  3OWS A;  3PZW A;  1US1 A;  1O7N B;  1SQW A;  1OPY A;  4N6O B;  5JPU A;  1IDP A;  1AR0 A;  3CNM A;  3FZW A;  1W00 A;  2P09 A;  1W6G A;  3EN1 B;  3CXC 2;  3HZP A;  4U13 A;  3SOY A;  3HIG A;  3G8Z A;  3BNC A;  3QK9 A;  1SII A;  3CME 3;  4J9A A;  1ISK A;  3GZR A;  3DMC A;  4RBN A;  1OCV A;  1E3V A;  5STD A;  3CPW 2;  3K9M C;  1OHP A;  2XFS A;  2CFW A;  4FMA A;  1DMM A;  2CK3 H;  2F99 A;  3N9H A;  2RGQ A;  5KP3 A;  2GBW B;  1IVU A;  2M7O A;  2Z76 A;  4XBX A;  4AKZ A;  1OHS A;  1TFK A;  4R9L A;  3EF8 A;  1O7G B;  3DZL A;  5BVB A;  1WNH A;  3SVA A;  3LT9 A;  3MSO A;  2CFK A;  3KN4 A;  2F98 A;  3BND A;  1NB5 I;  2PZV A;  1K41 A;  2P0M A;  4BTX A;  3LTB A;  3LTC A;  5DRV A;  3EBY A;  3X3Z A;  4MEI A;  3CNX A;  5IER A;  3E99 A;  1AVL A;  3EC9 A;  3FKA A;  1RRH A;  1TIJ A;  5IF6 A;  3GZB A;  2CWT A;  3NBR A;  2STD A;  4FMB A;  1UI7 A;  3MG1 A;  1ASK A;  5FW5 A;  2YFI B;  3WMD A;  2OWP A;  3VSY A;  2E2V A;  2QIY A;  1W2Z A;  2WO0 A;  3BNE A;  1M9G A;  3DGL A;  2CFL A;  1WMP A;  2O9U X;  2E2T A;  3ECF A;  3OWY A;  1KQS 2;  2OCT A;  2BHM A;  1LXE A;  4K61 A;  4QWT A;  3T0U A;  3HK4 A;  3PCR A;  1E3R A;  4N3V A;  3WOD G;  2CG1 A;  1CQS A;  3Q90 A;  1FGT A;  3LML A;  4BTW A;  1FGM A;  2IUJ A;  3HII A;  5EVH A;  1NDO B;  2FXT A;  3DY5 A;  3CCM 3;  3CC4 3;  1KSI A;  3HX8 A;  1S5A A;  5IG0 A;  2P0X A;  3F7S A;  2OOV A;  5G2G A;  1JNQ A;  1YVB I;  1N9E A;  1A2K A;  2HMM B;  3DM8 A;  1YJN 3;  3DGM A;  2KCD A;  1FGO A;  4X2O A;  3X42 A;  3PXM A;  4X2H A;  3G4S 3;  4N6U A;  3UL5 A;  3KZT A;  3FG4 A;  3QRD A;  4LZI A;  3O8Y A;  3FLJ A;  1TFO A;  2HMJ B;  3NX0 A;  3GAX A;  1W5Z A;  2CW9 A;  1Y4K A;  3KKG A;  4Q53 A;  1O7M B;  2BNG A;  1UUV B;  4HKV B;  4XBT A;  4EC6 A;  1O7W B;  2CWU A;  1CYU A;  4FCM A;  3X3X A;  4ZM8 A;  4IT7 A;  3EB8 A;  5A0O B;  1IVX A;  5IG5 A;  4O2H A;  1V74 A;  4MMX B;  1VQ8 3;  3V98 A;  1OHO A;  1EKM A;  2BT3 A;  3KSP A;  4I4K A;  2XSH B;  1BUQ A;  2L4V A;  1M1K 4;  5KP1 A;  1LVN A;  1Q81 4;  3EN8 A;  3OXA A;  2IA7 A;  2Y74 A;  1PFP A;  3VGN A;  4GL6 A;  4NRE A;  1Q40 A;  3OWU A;  2W9Q A;  4HM3 B;  3SOA A;  4EYC A;  2ZDJ A;  3NM2 A;  3I0Y A;  1EG9 B;  1TUH A;  3BB9 A;  4HM2 B;  5FGO A;  1GYB A;  3D3L A;  2OQE A;  7STD A;  1Q7Y 4;  6STD A;  1YIJ 3;  1JJ2 2;  1OGZ A;  3JUM A;  3KE7 A;  3DUK A;  3SXX A;  3V92 A;  4ORL A;  1WTH A;  3CPO A;  2CFG A;  1F8N A;  1VQN 3;  2ZL8 A;  1PU4 A;  5AIF A;  3X3Y A;  3TDG A;  3A76 A;  4CCV A;  3G0K A;  3FF0 A;  4K1V A;  1VQ7 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...