4O2HA

Crystal structure of bcam1869 protein (rsam homolog) from burkholderia cenocepacia
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
b'TSPLLHPVPGPSPDGYVRLSEGALAALVLDHVASGLDPSLLAELRDNAIDARLAGYTEWHRTAGAGVAYVTVGWDWYLERATGTFVIAGGDVRSNVMAIDAKGADIGMLRTAAALAARLAALDWPAAVASALLGHND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein BCAM1869
publication title RsaM: a transcriptional regulator of Burkholderia spp. with novel fold.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Structural genomics, unknown function
total genus 33
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16245 DUF4902 Domain of unknown function (DUF4902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.610 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o2hA00
4O2HA
chains in the Genus database with same CATH superfamily
1I3FA 1D6ZA 3NV0A 4R80A 3EHCA 4J5KA 4WHAA 2H0GA 3CCV3 4MMYB 4KFFA 1EG9B 4LGQA 2LYXA 2FNQA 2P38A 2QA43 1Q40B 3HI7A 3CCR3 3CNXA 4O02B 2CFDA 3MG3A 1RGEA 1UUWB 1OGZA 5AIHA 1VQ63 3B4PA 3VGNA 2KF6A 1C7HA 1ROAA 4H3UA 3T0UA 4NHFA 1HU9A 4ZM8A 2J8XB 5D81A 4WYKA 3GZRA 7STDA 1X1UA 4G1MB 5KP1A 3KCHA 1GY6A 1MGRA 1W6GA 3F8HA 4N6TA 1O7PB 1N9EA 3AGNA 2HMOB 3N8BA 2D42A 4L8OA 4AEQA 3NM7A 2ML5A 1JZOA 5I97A 4HM4B 5IG3A 3PCRA 3DMCA 2P09A 1IU7A 1GD3A 1QJGA 1BIRA 4ORLA 5CK6A 2IUKA 3NUVA 3CXC2 1VQ43 3NBJA 3MHEA 4EC6A 1A90A 3HOHA 1RGCA 3AGOA 4XB5A 3X42A 3EX9A 4KFEA 3IMAB 3SYUA 1TRQA 4GSPA 1E3RA 1FUSA 3LH4A 3OWYA 2BNGA 2F56A 2BHMA 1Z1SA 2BU4A 5IW9A 3KE7A 2BIRA 3DM8A 3FF2A 3CMA3 4BTWA 1T5YA 2CX0A 3Q3FA 2AADA 3NX0A 3F7SA 1RRLA 4XBXA 1OPYA 5IENA 1B20A 2LQVA 3E99A 1W00A 3MWZA 4O3VA 2K0MA 1Q9EA 1JN5B 1DVDA 3JUOA 4EV2A 2IYJA 1I0VA 2HMNB 3LXUX 4R9KA 1OGXA 2GSPA 4QWTA 2CW9A 1YJW3 1NDOB 1W4NA 2BMQB 2E2UA 3V99A 1K8A4 3A5EA 3QRDA 5CLKA 1RCKA 5D82A 2I9WA 1I2GA 1OH0A 1M1XB 1GOVA 2GEXA 1QVF2 5HOHA 3DXOA 3UNLA 1K41A 3WHOA 5M18A 2KRTA 1WTHA 2RBIA 1WQLB 4FCJA 1BSEA 3CU3A 3K0ZA 5IEOA 3FLJA 2BMOB 2FGTA 5G1LA 1IVXA 4BTYA 2CG0A 4GL6A 3RGAA 3CCQ3 1BNFA 5AIFA 1BNJA 4HM7B 2D1WA 3G0KA 4K1VA 4N6MA 1JBRA 1NJI4 3G4S3 2XRXB 3CPOA 4AKZA 1KQS2 4CJNA 1IK3A 2KCDA 5DREA 1G96A 4HKVB 3NBRA 5DRVA 2XFSA 3CME3 3BNEA 1UI7A 4HZ9B 1NB5I 1BRJA 2MC8A 1J2BA 2BMRB 2HMLB 3B4OA 1GMPA 1G0TA 3RGRA 3T8UA 4HM2B 2F86B 1W2ZA 3BNCA 3EQQB 1GY5A 2CX1A 1O7GB 2IMJA 2KF3A 4MMZB 2R4IA 5GSPA 5EEOA 1BAOA 1RDSA 2PNCA 3MG1A 1JN5A 2BO9B 3N9HA 1VQ73 1RGKA 2XH9A 5G2GA 3BB9A 4N6LA 3KN4A 4HJLB 4HM0B 4EYCA 1O7HB 3OWUA 4STDA 1F8NA 3FKAA 3KSED 1IV7A 4GB5A 3KFQC 1PY3A 4RBNA 1BVIA 4KVHA 1UCLA 2KAAA 2KF5A 2RCDA 4CDLA 1JKGB 1RCLA 1WMPA 3MYTA 3OXAA 1IQXA 1JB5A 1VQL3 1EQKA 3LT9A 2F5MA 3F9SA 3F8XA 1YIT3 2CH9A 2QEX3 1BGSA 1IQ8A 2H0HA 3BIRA 1GOUA 4RNYA 5IG0A 6RNTA 2CC3A 5AYSC 4XM4A 5CF2A 2XFTA 1GYBA 1JRQA 2WOFA 4N6UA 2O9UX 4HYZA 1LXEA 3LT8A 3FSDA 5HGRA 5IEPA 1FGMA 1BOXA 1UCJA 1JBSA 3X3ZA 2CWUA 3K5TA 4HM6B 1BUJA 4BL2A 5BU4A 2FXTA 5AEWB 1MOLA 3BU4A 1YIJ3 4JRFA 1BNRA 2UUGC 1JB2A 3MPHA 1E97A 1I2FA 3HIGA 7GSPA 3LTBA 3GRDA 4EW5A 4HAAA 4CPKA 7RNTA 2SBLA 2XEPA 2OOVA 1UCIA 1BRGA 1E3VA 3DGLA 1W5ZA 3VSYA 1I70A 1JBTA 2GBXB 1RNBA 1TUHA 1FZUA 3JUMA 2CK3H 1HYFA 3Q1CA 4FCMA 1UW1A 1OF5A 3G6E3 3S67A 2QIYA 1A2VA 2CFWA 1AR0A 2P0XA 3X40A 4N3VA 2IA7A 2Z7AA 3SXXA 1RGGA 1IVUA 2WOHA 1OCVA 1I8VA 1JKGA 2W56B 4NREA 1HZ1A 4K90B 3T8NA 2L1SA 1RRHA 3LTAA 4I4KA 1UUVB 3D4AA 3LTCA 3KZTA 3LYGA 2UGIA 5AI1A 3OWSA 1VQ83 1C54A 3FGYA 2H0IA 3X3YA 3FH1A 2HOHA 3B8LA 1V58A 2GEYA 4LSOA 2CFLA 4LEHA 1RTUA 5FW5A 4R9LA 1RGFA 4LMIA 1W7CA 5AEUB 2UX0A 3WR2A 1B2UA 1N5HA 4N6OB 3G8ZA 1X1WA 5RNTA 3WA2X 1VQP3 2Q07A 4HVNA 1W6CA 3AHSA 1IVVA 5CXOA 4FMDA 1R4YA 2XR8B 4FMAA 1IT7A 1BRNL 1Y4KA 1FGRA 3K63A 1LQMB 3UL5A 4KFDA 3HX8A 1B2SA 1MGWA 3Q90A 2A15A 3EBYA 5AYRB 3LMLA 4WFOA 5IG5A 1Q40A 1RGAA 3D3LA 1O7WB 1LRAA 3OX9A 3JUNA 1YVBI 5ELUA 1SARA 2P0MA 1RKYA 2OOVC 1WMOA 3Q2PA 1N8R4 2HMKB 2YFJB 3U1WA 2IUJA 3CC43 1BSBA 1N5PA 3F7XA 4PEJA 1RMSA 2W56A 1Q864 1W6YA 2HMJB 2XGLA 2SARA 1RN4A 3EN1B 1UCKA 1DYUA 1LOXA 3DH2A 1K734 2W0QA 2CG1A 3D5GA 6STDA 3L0RA 1SJWA 2WO0A 1T3BA 4K61A 3F14A 2YFIB 4R1KA 5D83A 1X1XA 3LTDA 3RDEA 4MEIA 1CYVA 5EQLA 4XDVA 2RNTA 3TDGA 5CF1A 4IIAA 3GZXB 3K9MC 3PGBA 1UUGB 4WP5A 1BUQA 1V74A 1SQWA 1GMRA 1YVSA 1BRIA 1RN1A 3ROBA 5IERA 3EN8A 1OHPA 4O2HA 1YJ93 6GSPA 1B27A 4I5QA 3SVAA 4RNTA 1BSDA 2GXFA 3CD63 2BT3A 2CHCA 1AV4A 3UL6A 1T2HA 1BSAA 3A76A 2C4BA 2C10A 1VQN3 3NM2A 8RNTA 1BNEA 1RGHA 2MF7A 1RHLA 1KC84 2JQ5A 4H61A 1M1K4 1A2PA 3CNMA 4XDWA 1US1A 1W01A 1S723 3URPA 3ALAA 2W9QA 1GMQA 3U97A 1SIHA 1VQO3 2AAEA 1SPUA 1EA2A 1EKMA 1FUTA 4IPBA 5A0OB 1CH0A 1NB3I 2KXGA 3NBBA 3NHXA 2Z77A 5AIIA 3CC73 2W2CA 2V1LA 1LOYA 1V57A 1ZO2A 3V92A 3WOFB 1RGLA 2RSXA 1YNVX 4J5GA 3K7CA 1GY7A 5STDA 1LQGC 1VZZA 3H51A 1LVNA 1BANA 3I0YA 3DZLA 1IT8A 4BIRA 1UDII 1LNHA 1A2KA 5IG4A 1UGHI 3DY5A 2QGUA 1EEJA 3CCJ3 2CKFB 3X3XA 3I563 1JNQA 2Y73A 3D5IA 3DUKA 2GBWB 4MJDA 3OW22 3ZG5A 1U8CB 4DKIA 2E2VA 3M8CA 3CPW2 2ZL8A 1OACA 2CWTA 3GSPA 3LOYA 3EC9A 1L5GB 1R4CA 3AMOB 3CCS3 1ASKA 5JPUA 4O8SA 1EUIC 1RJOA 4FR9A 1TJDA 4X2HA 1QAFA 1VQ93 1G02A 3PCSA 3S29A 4EV5A 2RGQA 1SIIA 3WDGB 1RSNA 4Q53A 2P05A 4WYKB 4BL3A 1B2MA 1NNVA 1DVCA 1B21A 3SOYA 1X1YA 1QVG2 2E2TA 3UJMA 1VQK3 3S5CA 4HZBB 3PXMA 1DE3A 3FG4A 3G16A 3FCSB 2W6JH 3EE1A 1S5AA 4EBGA 1OUNA 1CYUA 1U5OA 1QMAA 3SX1A 3WODG 3EB8A 1BSCA 3B7CA 3ZG0A 1FGQA 2CIUA 1STDA 1QAKA 4AKYA 1D6UA 1IDPA 3FZWA 3HIIA 5BIRA 1FW7A 2HMMB 2R41A 2OQEA 3AHWA 5ELJA 1O7NB 4N6NB 1K9M4 4FMBA 2PZVA 1BRHA 3ZFZA 1STFI 1DETA 3CC23 4LZIA 2K3DA 3DGMA 3EBTA 3BNBA 1PYLA 3AMOA 3SEDA 5KP3A 3CCU3 2O3OA 3EF8A 1IV9A 4L7KA 1GD4A 3STDA 1IQYA 4MMXB 1TFKA 3WMDA 4BTXA 2RFRA 1WNHA 1BNGA 1VQQA 4TX4A 1OHSA 1N9JA 4NPBA 1BRKA 1K28A 1ZS7A 2XSHB 3OV4A 4XBYA 4ILFA 1N8QA 1GSPA 3MKIA 2XF3A 1W02A 2XSOB 1BNSA 3JUPA 1FGTA 1TTOA 2F5WA 1TIJA 8CHOA 1ULIB 2Z6BA 3DGYA 1BU4A 2W04A 2OWPA 2WGQA 5M1AA 5KP4A 3BLZA 2W9PA 1AVKA 3H3HA 3HK4A 3DGOA 3JVCA 4HM1B 5LC6A 3SLUA 4BU4A 1UGIA 1JV2B 2CFKA 4GHOA 1I3IA 2YX9A 1MNLA 1ZX2A 1M9GA 3F40A 3G713 3EJVA 4FCZA 3KIIA 4FMCA 1YI23 3GAXA 1QALA 1O7MB 1A67A 3IJEB 3ECFA 3I553 4CCVA 2B1XB 2OQEC 3FF0A 4K1UA 2F98A 5JBSA 2OTJ3 3KSPA 2XGNA 3MG2A 4RZMA 5BVBA 3CCL3 2STDA 1RNTA 1GS3A 1NO3A 4LYLB 5FGOA 1DMQA 2YFLB 3PS8A 3VF1A 5AIGA 1CQSA 3D9RA 1D6YA 1ZGXA 3GZYB 4OVMA 4EXRA 1Q824 4OK0A 3MSOA 1WMNA 2OCTA 1AY7A 1YHQ3 1Q814 3QK9A 3FG1A 2WGOA 1PFPA 3S27A 2C11A 1FUWA 2JDIH 1MWTA 1YGEA 3NXJA 2KF4A 1B2ZA 1FYSA 3LZAA 5LC7A 1OHOA 1RLSA 1MWRA 2GU1A 1UI8A 2GU3A 1KSIA 4HBRA 3CCE3 1GOYA 1M904 4WWUC 4X2OA 1B2XA 4KZ1A 2ZHXB 3WOEB 3NV0B 1MWUA 3FG3A 1TU5A 4IT7A 1YJN3 1KD14 3PYJA 1JJ22 1BNIA 1PU4A 5EVHA 3J7Yd 4KT3B 2M7OA 1VQ53 2Y74A 4L8PA 1Q42A 1AQZA 1TRPA 3GZBA 5BXQA 2F99A 2W03A 4HM5B 1T2IA 3ER7A 3RNTA 1RN7A 1ROVA 1KWIA 3DGNA 3UB1A 3X41A 1ISKA 5TGNA 1I0XA 1JB4A 2K54A 1OF5B 3HZPA 3S28A 1BRSA 3V98A 4RNZA 1MWSA 4HM8B 3WA3A 2B24B 3JUQA 4J9AA 4U13A 1TP6A 2F4YA 1W2B2 3N54B 4JF8A 2ZDJA 1JZDA 1B3SA 1I2EA 4J8TA 9RNTA 5IF6A 2CFGA 1YGWA 2IY2A 1HKXA 1DMNA 4HOHA 3NQYA 1Q7HA 2ZA4A 4N6V0 2OTL3 1NU3A 1ULJB 3KKGA 3NQZA 1NWWA 1FGOA 3PZWA 3O8YA 4R4KA 3SOAA 2CWVA 2Z76A 3GWRA 1VQM3 1Q7Y4 4XBTA 1FA3A 1LOWA 1IVWA 1CEWI 4HM3B 1LOVA 2L4VA 3IPTA 5JPPA 1LNIA 3CCM3 4OUQA 1AVLA 1TFOA 2INXA 5G1KA 5M19A 1DMMA 2ML6A 1IYYA 3D79A 3BNDA
chains in the Genus database with same CATH topology
1D6ZA 3NV0A 4R80A 3EHCA 4WHAA 3CCV3 4MMYB 4KFFA 1EG9B 4LGQA 2LYXA 2FNQA 2P38A 2QA43 1Q40B 3HI7A 3CCR3 3CNXA 4O02B 2CFDA 3MG3A 1UUWB 1OGZA 5AIHA 1VQ63 3B4PA 3VGNA 1C7HA 1ROAA 4H3UA 3T0UA 4NHFA 1HU9A 4ZM8A 5D81A 4WYKA 3GZRA 7STDA 4G1MB 5KP1A 1GY6A 3F8HA 1W6GA 4N6TA 1O7PB 1N9EA 4L8OA 2HMOB 3N8BA 2D42A 4AEQA 3NM7A 2ML5A 5I97A 4HM4B 5IG3A 3PCRA 3DMCA 2P09A 1IU7A 1GD3A 1QJGA 5CK6A 4ORLA 3UL6A 2IUKA 3NUVA 3CXC2 1VQ43 3NBJA 3MHEA 4EC6A 1A90A 4XB5A 3X42A 3EX9A 4KFEA 3IMAB 1E3RA 3LH4A 3OWYA 2BNGA 2BHMA 1Z1SA 5IW9A 3KE7A 3DM8A 3FF2A 3CMA3 4BTWA 1T5YA 3NX0A 3F7SA 1RRLA 4XBXA 1OPYA 5IENA 2LQVA 3E99A 1W00A 3MWZA 4O3VA 2K0MA 1JN5B 1DVDA 3JUOA 4EV2A 2HMNB 3LXUX 4R9KA 1OGXA 4QWTA 1YJW3 2CW9A 1NDOB 1W4NA 2BMQB 2E2UA 3V99A 1K8A4 3QRDA 5CLKA 5D82A 2I9WA 1OH0A 1M1XB 2GEXA 1QVF2 3DXOA 3UNLA 1K41A 2KRTA 1WTHA 1WQLB 4FCJA 3K0ZA 3CU3A 5IEOA 3FLJA 2BMOB 2FGTA 1IVXA 4BTYA 2CG0A 4GL6A 3RGAA 3CCQ3 5AIFA 4HM7B 2D1WA 3G0KA 4K1VA 4N6MA 1NJI4 3G4S3 2XRXB 3CPOA 4AKZA 1KQS2 1IK3A 2KCDA 5DREA 1G96A 4HKVB 3NBRA 5DRVA 2XFSA 3CME3 3BNEA 1UI7A 4HZ9B 1NB5I 2MC8A 1J2BA 2BMRB 2HMLB 3B4OA 3RGRA 3T8UA 4HM2B 2F86B 1W2ZA 3BNCA 3EQQB 1GY5A 1O7GB 2IMJA 4MMZB 2R4IA 5EEOA 2PNCA 3MG1A 1JN5A 2BO9B 3N9HA 1VQ73 2XH9A 5G2GA 3BB9A 4N6LA 3KN4A 4HJLB 4HM0B 4EYCA 1O7HB 3OWUA 4STDA 1F8NA 3FKAA 3KSED 1IV7A 4GB5A 3KFQC 4RBNA 4KVHA 2RCDA 4CDLA 1JKGB 1WMPA 3MYTA 3OXAA 1IQXA 1JB5A 1VQL3 1EQKA 3LT9A 3F9SA 3F8XA 1YIT3 2CH9A 2QEX3 1IQ8A 5IG0A 4RNYA 2CC3A 5AYSC 4XM4A 5CF2A 2XFTA 1GYBA 1JRQA 2WOFA 4N6UA 2O9UX 4HYZA 1LXEA 3LT8A 3FSDA 5HGRA 5IEPA 1FGMA 3X3ZA 2CWUA 3K5TA 4HM6B 2FXTA 5AEWB 1MOLA 1YIJ3 4JRFA 1JB2A 3MPHA 1E97A 3HIGA 3LTBA 3GRDA 2SBLA 2XEPA 2OOVA 1E3VA 3DGLA 1W5ZA 3VSYA 2GBXB 1TUHA 3JUMA 2CK3H 3Q1CA 4FCMA 1UW1A 1OF5A 3G6E3 3S67A 2QIYA 1A2VA 2CFWA 1AR0A 2P0XA 3X40A 4N3VA 2IA7A 2Z7AA 3SXXA 1IVUA 2WOHA 1OCVA 1JKGA 4NREA 2W56B 4K90B 3T8NA 1RRHA 3LTAA 4I4KA 1UUVB 3LTCA 3KZTA 3LYGA 1VQ83 5AI1A 3OWSA 3FGYA 3X3YA 3FH1A 3B8LA 2GEYA 4LSOA 2CFLA 4LEHA 5FW5A 4R9LA 4LMIA 1W7CA 5AEUB 2UX0A 1N5HA 4N6OB 3G8ZA 3WA2X 1VQP3 2Q07A 4HVNA 1W6CA 1IVVA 5CXOA 4FMDA 2XR8B 4FMAA 1IT7A 1FGRA 1Y4KA 3K63A 3UL5A 4KFDA 3HX8A 3Q90A 2A15A 3EBYA 5AYRB 3LMLA 4WFOA 5IG5A 1Q40A 3D3LA 1O7WB 5ELUA 3OX9A 3JUNA 1YVBI 2P0MA 1RKYA 2OOVC 1WMOA 3Q2PA 1N8R4 2HMKB 2YFJB 3U1WA 2IUJA 3CC43 1N5PA 3F7XA 4PEJA 2W56A 1Q864 1W6YA 2HMJB 2XGLA 3EN1B 1DYUA 1LOXA 1K734 2W0QA 2CG1A 6STDA 3L0RA 1SJWA 2WO0A 4K61A 3F14A 2YFIB 4R1KA 5D83A 3LTDA 3RDEA 4MEIA 1CYVA 5EQLA 4XDVA 3TDGA 5CF1A 4IIAA 3GZXB 3K9MC 3PGBA 4WP5A 1BUQA 1V74A 1SQWA 3ROBA 5IERA 3EN8A 1OHPA 4O2HA 1YJ93 3SVAA 2GXFA 3CD63 2BT3A 2CHCA 1AV4A 3A76A 2C10A 1VQN3 3NM2A 2MF7A 1M1K4 1KC84 2JQ5A 4H61A 3CNMA 4XDWA 1US1A 1W01A 1S723 3ALAA 2W9QA 3U97A 1VQO3 1SIHA 1SPUA 1EA2A 1EKMA 4IPBA 5A0OB 1NB3I 2KXGA 3NBBA 3NHXA 2Z77A 5AIIA 3CC73 2W2CA 2V1LA 3V92A 1ZO2A 3WOFB 2RSXA 3K7CA 1GY7A 5STDA 1VZZA 3H51A 1LVNA 3I0YA 3DZLA 1IT8A 1LNHA 1A2KA 5IG4A 3DY5A 2QGUA 3CCJ3 2CKFB 3X3XA 3I563 1JNQA 2Y73A 3DUKA 2GBWB 4MJDA 3OW22 1U8CB 2E2VA 3M8CA 3CPW2 2ZL8A 1OACA 2CWTA 3LOYA 3EC9A 1L5GB 1R4CA 3AMOB 3CCS3 1ASKA 5JPUA 4O8SA 1RJOA 4FR9A 4X2HA 1QAFA 1VQ93 3PCSA 3S29A 4EV5A 2RGQA 1SIIA 3WDGB 4Q53A 2P05A 4WYKB 1DVCA 3SOYA 1QVG2 2E2TA 3UJMA 1VQK3 3S5CA 4HZBB 3PXMA 3FG4A 3G16A 3FCSB 2W6JH 3EE1A 1S5AA 4EBGA 1OUNA 1CYUA 1U5OA 1QMAA 3SX1A 3WODG 3EB8A 3B7CA 1FGQA 2CIUA 1STDA 1QAKA 4AKYA 1IDPA 1D6UA 3FZWA 3HIIA 2HMMB 2OQEA 5ELJA 1O7NB 4N6NB 1K9M4 4FMBA 2PZVA 1STFI 3CC23 4LZIA 3DGMA 3EBTA 3BNBA 3AMOA 3SEDA 5KP3A 3CCU3 2O3OA 3EF8A 1IV9A 4L7KA 1GD4A 3STDA 1IQYA 4MMXB 1TFKA 3WMDA 4BTXA 2RFRA 1WNHA 4TX4A 1OHSA 1N9JA 1K28A 2XSHB 3OV4A 4XBYA 1N8QA 3MKIA 2XF3A 1W02A 2XSOB 3JUPA 1FGTA 1TIJA 8CHOA 1ULIB 2Z6BA 2W04A 2WGQA 2OWPA 5KP4A 3BLZA 2W9PA 1AVKA 3H3HA 3HK4A 3DGOA 3JVCA 4HM1B 5LC6A 3SLUA 1JV2B 2CFKA 2YX9A 1MNLA 1ZX2A 1M9GA 3F40A 3G713 3EJVA 4FCZA 3KIIA 4FMCA 1YI23 3GAXA 1QALA 1O7MB 1A67A 3IJEB 3ECFA 3I553 4CCVA 2B1XB 2OQEC 3FF0A 4K1UA 2F98A 5JBSA 2OTJ3 3KSPA 2XGNA 3MG2A 4RZMA 5BVBA 3CCL3 2STDA 1GS3A 1NO3A 5FGOA 1DMQA 2YFLB 3PS8A 3VF1A 5AIGA 1CQSA 3D9RA 1D6YA 3GZYB 4OVMA 4EXRA 1Q824 4OK0A 3MSOA 1WMNA 2OCTA 1YHQ3 1Q814 3QK9A 3FG1A 2WGOA 1PFPA 3S27A 2C11A 1FUWA 2JDIH 1YGEA 3NXJA 5LC7A 3LZAA 1OHOA 2GU1A 1UI8A 2GU3A 1KSIA 4HBRA 3CCE3 1M904 4WWUC 4X2OA 4KZ1A 3WOEB 3NV0B 3FG3A 1TU5A 4IT7A 1YJN3 1KD14 3PYJA 1JJ22 1PU4A 5EVHA 3J7Yd 2M7OA 1VQ53 2Y74A 4L8PA 1Q42A 3GZBA 5BXQA 2F99A 2W03A 4HM5B 3ER7A 1RN7A 1ROVA 1KWIA 3DGNA 3UB1A 3X41A 1ISKA 5TGNA 2K54A 1JB4A 3HZPA 1OF5B 3S28A 3V98A 3WA3A 4RNZA 4HM8B 2B24B 3JUQA 4J9AA 4U13A 1TP6A 1W2B2 3N54B 4JF8A 2ZDJA 4J8TA 5IF6A 2CFGA 1HKXA 1DMNA 3NQYA 4N6V0 2OTL3 1NU3A 1ULJB 3KKGA 3NQZA 1NWWA 1FGOA 3PZWA 3O8YA 4R4KA 3SOAA 2CWVA 2Z76A 3GWRA 1VQM3 1Q7Y4 4XBTA 1FA3A 1IVWA 1CEWI 4HM3B 2L4VA 3IPTA 5JPPA 3CCM3 4OUQA 1AVLA 1TFOA 2INXA 1DMMA 2ML6A 3BNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2H A; 
#chains in the Genus database with same CATH topology
 1I3F A;  1D6Z A;  3NV0 A;  4R80 A;  3EHC A;  4J5K A;  4WHA A;  2H0G A;  3CCV 3;  4MMY B;  4KFF A;  1EG9 B;  4LGQ A;  2LYX A;  2FNQ A;  2P38 A;  2QA4 3;  1Q40 B;  3HI7 A;  3CCR 3;  3CNX A;  4O02 B;  2CFD A;  3MG3 A;  1RGE A;  1UUW B;  1OGZ A;  5AIH A;  1VQ6 3;  3B4P A;  3VGN A;  2KF6 A;  1C7H A;  1ROA A;  4H3U A;  3T0U A;  4NHF A;  1HU9 A;  4ZM8 A;  2J8X B;  5D81 A;  4WYK A;  3GZR A;  7STD A;  1X1U A;  4G1M B;  5KP1 A;  3KCH A;  1GY6 A;  1MGR A;  1W6G A;  3F8H A;  4N6T A;  1O7P B;  1N9E A;  3AGN A;  2HMO B;  3N8B A;  2D42 A;  4L8O A;  4AEQ A;  3NM7 A;  2ML5 A;  1JZO A;  5I97 A;  4HM4 B;  5IG3 A;  3PCR A;  3DMC A;  2P09 A;  1IU7 A;  1GD3 A;  1QJG A;  1BIR A;  4ORL A;  5CK6 A;  2IUK A;  3NUV A;  3CXC 2;  1VQ4 3;  3NBJ A;  3MHE A;  4EC6 A;  1A90 A;  3HOH A;  1RGC A;  3AGO A;  4XB5 A;  3X42 A;  3EX9 A;  4KFE A;  3IMA B;  3SYU A;  1TRQ A;  4GSP A;  1E3R A;  1FUS A;  3LH4 A;  3OWY A;  2BNG A;  2F56 A;  2BHM A;  1Z1S A;  2BU4 A;  5IW9 A;  3KE7 A;  2BIR A;  3DM8 A;  3FF2 A;  3CMA 3;  4BTW A;  1T5Y A;  2CX0 A;  3Q3F A;  2AAD A;  3NX0 A;  3F7S A;  1RRL A;  4XBX A;  1OPY A;  5IEN A;  1B20 A;  2LQV A;  3E99 A;  1W00 A;  3MWZ A;  4O3V A;  2K0M A;  1Q9E A;  1JN5 B;  1DVD A;  3JUO A;  4EV2 A;  2IYJ A;  1I0V A;  2HMN B;  3LXU X;  4R9K A;  1OGX A;  2GSP A;  4QWT A;  2CW9 A;  1YJW 3;  1NDO B;  1W4N A;  2BMQ B;  2E2U A;  3V99 A;  1K8A 4;  3A5E A;  3QRD A;  5CLK A;  1RCK A;  5D82 A;  2I9W A;  1I2G A;  1OH0 A;  1M1X B;  1GOV A;  2GEX A;  1QVF 2;  5HOH A;  3DXO A;  3UNL A;  1K41 A;  3WHO A;  5M18 A;  2KRT A;  1WTH A;  2RBI A;  1WQL B;  4FCJ A;  1BSE A;  3CU3 A;  3K0Z A;  5IEO A;  3FLJ A;  2BMO B;  2FGT A;  5G1L A;  1IVX A;  4BTY A;  2CG0 A;  4GL6 A;  3RGA A;  3CCQ 3;  1BNF A;  5AIF A;  1BNJ A;  4HM7 B;  2D1W A;  3G0K A;  4K1V A;  4N6M A;  1JBR A;  1NJI 4;  3G4S 3;  2XRX B;  3CPO A;  4AKZ A;  1KQS 2;  4CJN A;  1IK3 A;  2KCD A;  5DRE A;  1G96 A;  4HKV B;  3NBR A;  5DRV A;  2XFS A;  3CME 3;  3BNE A;  1UI7 A;  4HZ9 B;  1NB5 I;  1BRJ A;  2MC8 A;  1J2B A;  2BMR B;  2HML B;  3B4O A;  1GMP A;  1G0T A;  3RGR A;  3T8U A;  4HM2 B;  2F86 B;  1W2Z A;  3BNC A;  3EQQ B;  1GY5 A;  2CX1 A;  1O7G B;  2IMJ A;  2KF3 A;  4MMZ B;  2R4I A;  5GSP A;  5EEO A;  1BAO A;  1RDS A;  2PNC A;  3MG1 A;  1JN5 A;  2BO9 B;  3N9H A;  1VQ7 3;  1RGK A;  2XH9 A;  5G2G A;  3BB9 A;  4N6L A;  3KN4 A;  4HJL B;  4HM0 B;  4EYC A;  1O7H B;  3OWU A;  4STD A;  1F8N A;  3FKA A;  3KSE D;  1IV7 A;  4GB5 A;  3KFQ C;  1PY3 A;  4RBN A;  1BVI A;  4KVH A;  1UCL A;  2KAA A;  2KF5 A;  2RCD A;  4CDL A;  1JKG B;  1RCL A;  1WMP A;  3MYT A;  3OXA A;  1IQX A;  1JB5 A;  1VQL 3;  1EQK A;  3LT9 A;  2F5M A;  3F9S A;  3F8X A;  1YIT 3;  2CH9 A;  2QEX 3;  1BGS A;  1IQ8 A;  2H0H A;  3BIR A;  1GOU A;  4RNY A;  5IG0 A;  6RNT A;  2CC3 A;  5AYS C;  4XM4 A;  5CF2 A;  2XFT A;  1GYB A;  1JRQ A;  2WOF A;  4N6U A;  2O9U X;  4HYZ A;  1LXE A;  3LT8 A;  3FSD A;  5HGR A;  5IEP A;  1FGM A;  1BOX A;  1UCJ A;  1JBS A;  3X3Z A;  2CWU A;  3K5T A;  4HM6 B;  1BUJ A;  4BL2 A;  5BU4 A;  2FXT A;  5AEW B;  1MOL A;  3BU4 A;  1YIJ 3;  4JRF A;  1BNR A;  2UUG C;  1JB2 A;  3MPH A;  1E97 A;  1I2F A;  3HIG A;  7GSP A;  3LTB A;  3GRD A;  4EW5 A;  4HAA A;  4CPK A;  7RNT A;  2SBL A;  2XEP A;  2OOV A;  1UCI A;  1BRG A;  1E3V A;  3DGL A;  1W5Z A;  3VSY A;  1I70 A;  1JBT A;  2GBX B;  1RNB A;  1TUH A;  1FZU A;  3JUM A;  2CK3 H;  1HYF A;  3Q1C A;  4FCM A;  1UW1 A;  1OF5 A;  3G6E 3;  3S67 A;  2QIY A;  1A2V A;  2CFW A;  1AR0 A;  2P0X A;  3X40 A;  4N3V A;  2IA7 A;  2Z7A A;  3SXX A;  1RGG A;  1IVU A;  2WOH A;  1OCV A;  1I8V A;  1JKG A;  2W56 B;  4NRE A;  1HZ1 A;  4K90 B;  3T8N A;  2L1S A;  1RRH A;  3LTA A;  4I4K A;  1UUV B;  3D4A A;  3LTC A;  3KZT A;  3LYG A;  2UGI A;  5AI1 A;  3OWS A;  1VQ8 3;  1C54 A;  3FGY A;  2H0I A;  3X3Y A;  3FH1 A;  2HOH A;  3B8L A;  1V58 A;  2GEY A;  4LSO A;  2CFL A;  4LEH A;  1RTU A;  5FW5 A;  4R9L A;  1RGF A;  4LMI A;  1W7C A;  5AEU B;  2UX0 A;  3WR2 A;  1B2U A;  1N5H A;  4N6O B;  3G8Z A;  1X1W A;  5RNT A;  3WA2 X;  1VQP 3;  2Q07 A;  4HVN A;  1W6C A;  3AHS A;  1IVV A;  5CXO A;  4FMD A;  1R4Y A;  2XR8 B;  4FMA A;  1IT7 A;  1BRN L;  1Y4K A;  1FGR A;  3K63 A;  1LQM B;  3UL5 A;  4KFD A;  3HX8 A;  1B2S A;  1MGW A;  3Q90 A;  2A15 A;  3EBY A;  5AYR B;  3LML A;  4WFO A;  5IG5 A;  1Q40 A;  1RGA A;  3D3L A;  1O7W B;  1LRA A;  3OX9 A;  3JUN A;  1YVB I;  5ELU A;  1SAR A;  2P0M A;  1RKY A;  2OOV C;  1WMO A;  3Q2P A;  1N8R 4;  2HMK B;  2YFJ B;  3U1W A;  2IUJ A;  3CC4 3;  1BSB A;  1N5P A;  3F7X A;  4PEJ A;  1RMS A;  2W56 A;  1Q86 4;  1W6Y A;  2HMJ B;  2XGL A;  2SAR A;  1RN4 A;  3EN1 B;  1UCK A;  1DYU A;  1LOX A;  3DH2 A;  1K73 4;  2W0Q A;  2CG1 A;  3D5G A;  6STD A;  3L0R A;  1SJW A;  2WO0 A;  1T3B A;  4K61 A;  3F14 A;  2YFI B;  4R1K A;  5D83 A;  1X1X A;  3LTD A;  3RDE A;  4MEI A;  1CYV A;  5EQL A;  4XDV A;  2RNT A;  3TDG A;  5CF1 A;  4IIA A;  3GZX B;  3K9M C;  3PGB A;  1UUG B;  4WP5 A;  1BUQ A;  1V74 A;  1SQW A;  1GMR A;  1YVS A;  1BRI A;  1RN1 A;  3ROB A;  5IER A;  3EN8 A;  1OHP A;  4O2H A;  1YJ9 3;  6GSP A;  1B27 A;  4I5Q A;  3SVA A;  4RNT A;  1BSD A;  2GXF A;  3CD6 3;  2BT3 A;  2CHC A;  1AV4 A;  3UL6 A;  1T2H A;  1BSA A;  3A76 A;  2C4B A;  2C10 A;  1VQN 3;  3NM2 A;  8RNT A;  1BNE A;  1RGH A;  2MF7 A;  1RHL A;  1KC8 4;  2JQ5 A;  4H61 A;  1M1K 4;  1A2P A;  3CNM A;  4XDW A;  1US1 A;  1W01 A;  1S72 3;  3URP A;  3ALA A;  2W9Q A;  1GMQ A;  3U97 A;  1SIH A;  1VQO 3;  2AAE A;  1SPU A;  1EA2 A;  1EKM A;  1FUT A;  4IPB A;  5A0O B;  1CH0 A;  1NB3 I;  2KXG A;  3NBB A;  3NHX A;  2Z77 A;  5AII A;  3CC7 3;  2W2C A;  2V1L A;  1LOY A;  1V57 A;  1ZO2 A;  3V92 A;  3WOF B;  1RGL A;  2RSX A;  1YNV X;  4J5G A;  3K7C A;  1GY7 A;  5STD A;  1LQG C;  1VZZ A;  3H51 A;  1LVN A;  1BAN A;  3I0Y A;  3DZL A;  1IT8 A;  4BIR A;  1UDI I;  1LNH A;  1A2K A;  5IG4 A;  1UGH I;  3DY5 A;  2QGU A;  1EEJ A;  3CCJ 3;  2CKF B;  3X3X A;  3I56 3;  1JNQ A;  2Y73 A;  3D5I A;  3DUK A;  2GBW B;  4MJD A;  3OW2 2;  3ZG5 A;  1U8C B;  4DKI A;  2E2V A;  3M8C A;  3CPW 2;  2ZL8 A;  1OAC A;  2CWT A;  3GSP A;  3LOY A;  3EC9 A;  1L5G B;  1R4C A;  3AMO B;  3CCS 3;  1ASK A;  5JPU A;  4O8S A;  1EUI C;  1RJO A;  4FR9 A;  1TJD A;  4X2H A;  1QAF A;  1VQ9 3;  1G02 A;  3PCS A;  3S29 A;  4EV5 A;  2RGQ A;  1SII A;  3WDG B;  1RSN A;  4Q53 A;  2P05 A;  4WYK B;  4BL3 A;  1B2M A;  1NNV A;  1DVC A;  1B21 A;  3SOY A;  1X1Y A;  1QVG 2;  2E2T A;  3UJM A;  1VQK 3;  3S5C A;  4HZB B;  3PXM A;  1DE3 A;  3FG4 A;  3G16 A;  3FCS B;  2W6J H;  3EE1 A;  1S5A A;  4EBG A;  1OUN A;  1CYU A;  1U5O A;  1QMA A;  3SX1 A;  3WOD G;  3EB8 A;  1BSC A;  3B7C A;  3ZG0 A;  1FGQ A;  2CIU A;  1STD A;  1QAK A;  4AKY A;  1D6U A;  1IDP A;  3FZW A;  3HII A;  5BIR A;  1FW7 A;  2HMM B;  2R41 A;  2OQE A;  3AHW A;  5ELJ A;  1O7N B;  4N6N B;  1K9M 4;  4FMB A;  2PZV A;  1BRH A;  3ZFZ A;  1STF I;  1DET A;  3CC2 3;  4LZI A;  2K3D A;  3DGM A;  3EBT A;  3BNB A;  1PYL A;  3AMO A;  3SED A;  5KP3 A;  3CCU 3;  2O3O A;  3EF8 A;  1IV9 A;  4L7K A;  1GD4 A;  3STD A;  1IQY A;  4MMX B;  1TFK A;  3WMD A;  4BTX A;  2RFR A;  1WNH A;  1BNG A;  1VQQ A;  4TX4 A;  1OHS A;  1N9J A;  4NPB A;  1BRK A;  1K28 A;  1ZS7 A;  2XSH B;  3OV4 A;  4XBY A;  4ILF A;  1N8Q A;  1GSP A;  3MKI A;  2XF3 A;  1W02 A;  2XSO B;  1BNS A;  3JUP A;  1FGT A;  1TTO A;  2F5W A;  1TIJ A;  8CHO A;  1ULI B;  2Z6B A;  3DGY A;  1BU4 A;  2W04 A;  2OWP A;  2WGQ A;  5M1A A;  5KP4 A;  3BLZ A;  2W9P A;  1AVK A;  3H3H A;  3HK4 A;  3DGO A;  3JVC A;  4HM1 B;  5LC6 A;  3SLU A;  4BU4 A;  1UGI A;  1JV2 B;  2CFK A;  4GHO A;  1I3I A;  2YX9 A;  1MNL A;  1ZX2 A;  1M9G A;  3F40 A;  3G71 3;  3EJV A;  4FCZ A;  3KII A;  4FMC A;  1YI2 3;  3GAX A;  1QAL A;  1O7M B;  1A67 A;  3IJE B;  3ECF A;  3I55 3;  4CCV A;  2B1X B;  2OQE C;  3FF0 A;  4K1U A;  2F98 A;  5JBS A;  2OTJ 3;  3KSP A;  2XGN A;  3MG2 A;  4RZM A;  5BVB A;  3CCL 3;  2STD A;  1RNT A;  1GS3 A;  1NO3 A;  4LYL B;  5FGO A;  1DMQ A;  2YFL B;  3PS8 A;  3VF1 A;  5AIG A;  1CQS A;  3D9R A;  1D6Y A;  1ZGX A;  3GZY B;  4OVM A;  4EXR A;  1Q82 4;  4OK0 A;  3MSO A;  1WMN A;  2OCT A;  1AY7 A;  1YHQ 3;  1Q81 4;  3QK9 A;  3FG1 A;  2WGO A;  1PFP A;  3S27 A;  2C11 A;  1FUW A;  2JDI H;  1MWT A;  1YGE A;  3NXJ A;  2KF4 A;  1B2Z A;  1FYS A;  3LZA A;  5LC7 A;  1OHO A;  1RLS A;  1MWR A;  2GU1 A;  1UI8 A;  2GU3 A;  1KSI A;  4HBR A;  3CCE 3;  1GOY A;  1M90 4;  4WWU C;  4X2O A;  1B2X A;  4KZ1 A;  2ZHX B;  3WOE B;  3NV0 B;  1MWU A;  3FG3 A;  1TU5 A;  4IT7 A;  1YJN 3;  1KD1 4;  3PYJ A;  1JJ2 2;  1BNI A;  1PU4 A;  5EVH A;  3J7Y d;  4KT3 B;  2M7O A;  1VQ5 3;  2Y74 A;  4L8P A;  1Q42 A;  1AQZ A;  1TRP A;  3GZB A;  5BXQ A;  2F99 A;  2W03 A;  4HM5 B;  1T2I A;  3ER7 A;  3RNT A;  1RN7 A;  1ROV A;  1KWI A;  3DGN A;  3UB1 A;  3X41 A;  1ISK A;  5TGN A;  1I0X A;  1JB4 A;  2K54 A;  1OF5 B;  3HZP A;  3S28 A;  1BRS A;  3V98 A;  4RNZ A;  1MWS A;  4HM8 B;  3WA3 A;  2B24 B;  3JUQ A;  4J9A A;  4U13 A;  1TP6 A;  2F4Y A;  1W2B 2;  3N54 B;  4JF8 A;  2ZDJ A;  1JZD A;  1B3S A;  1I2E A;  4J8T A;  9RNT A;  5IF6 A;  2CFG A;  1YGW A;  2IY2 A;  1HKX A;  1DMN A;  4HOH A;  3NQY A;  1Q7H A;  2ZA4 A;  4N6V 0;  2OTL 3;  1NU3 A;  1ULJ B;  3KKG A;  3NQZ A;  1NWW A;  1FGO A;  3PZW A;  3O8Y A;  4R4K A;  3SOA A;  2CWV A;  2Z76 A;  3GWR A;  1VQM 3;  1Q7Y 4;  4XBT A;  1FA3 A;  1LOW A;  1IVW A;  1CEW I;  4HM3 B;  1LOV A;  2L4V A;  3IPT A;  5JPP A;  1LNI A;  3CCM 3;  4OUQ A;  1AVL A;  1TFO A;  2INX A;  5G1K A;  5M19 A;  1DMM A;  2ML6 A;  1IYY A;  3D79 A;  3BND A; 
#chains in the Genus database with same CATH homology
 1D6Z A;  3NV0 A;  4R80 A;  3EHC A;  4WHA A;  3CCV 3;  4MMY B;  4KFF A;  1EG9 B;  4LGQ A;  2LYX A;  2FNQ A;  2P38 A;  2QA4 3;  1Q40 B;  3HI7 A;  3CCR 3;  3CNX A;  4O02 B;  2CFD A;  3MG3 A;  1UUW B;  1OGZ A;  5AIH A;  1VQ6 3;  3B4P A;  3VGN A;  1C7H A;  1ROA A;  4H3U A;  3T0U A;  4NHF A;  1HU9 A;  4ZM8 A;  5D81 A;  4WYK A;  3GZR A;  7STD A;  4G1M B;  5KP1 A;  1GY6 A;  3F8H A;  1W6G A;  4N6T A;  1O7P B;  1N9E A;  4L8O A;  2HMO B;  3N8B A;  2D42 A;  4AEQ A;  3NM7 A;  2ML5 A;  5I97 A;  4HM4 B;  5IG3 A;  3PCR A;  3DMC A;  2P09 A;  1IU7 A;  1GD3 A;  1QJG A;  5CK6 A;  4ORL A;  3UL6 A;  2IUK A;  3NUV A;  3CXC 2;  1VQ4 3;  3NBJ A;  3MHE A;  4EC6 A;  1A90 A;  4XB5 A;  3X42 A;  3EX9 A;  4KFE A;  3IMA B;  1E3R A;  3LH4 A;  3OWY A;  2BNG A;  2BHM A;  1Z1S A;  5IW9 A;  3KE7 A;  3DM8 A;  3FF2 A;  3CMA 3;  4BTW A;  1T5Y A;  3NX0 A;  3F7S A;  1RRL A;  4XBX A;  1OPY A;  5IEN A;  2LQV A;  3E99 A;  1W00 A;  3MWZ A;  4O3V A;  2K0M A;  1JN5 B;  1DVD A;  3JUO A;  4EV2 A;  2HMN B;  3LXU X;  4R9K A;  1OGX A;  4QWT A;  1YJW 3;  2CW9 A;  1NDO B;  1W4N A;  2BMQ B;  2E2U A;  3V99 A;  1K8A 4;  3QRD A;  5CLK A;  5D82 A;  2I9W A;  1OH0 A;  1M1X B;  2GEX A;  1QVF 2;  3DXO A;  3UNL A;  1K41 A;  2KRT A;  1WTH A;  1WQL B;  4FCJ A;  3K0Z A;  3CU3 A;  5IEO A;  3FLJ A;  2BMO B;  2FGT A;  1IVX A;  4BTY A;  2CG0 A;  4GL6 A;  3RGA A;  3CCQ 3;  5AIF A;  4HM7 B;  2D1W A;  3G0K A;  4K1V A;  4N6M A;  1NJI 4;  3G4S 3;  2XRX B;  3CPO A;  4AKZ A;  1KQS 2;  1IK3 A;  2KCD A;  5DRE A;  1G96 A;  4HKV B;  3NBR A;  5DRV A;  2XFS A;  3CME 3;  3BNE A;  1UI7 A;  4HZ9 B;  1NB5 I;  2MC8 A;  1J2B A;  2BMR B;  2HML B;  3B4O A;  3RGR A;  3T8U A;  4HM2 B;  2F86 B;  1W2Z A;  3BNC A;  3EQQ B;  1GY5 A;  1O7G B;  2IMJ A;  4MMZ B;  2R4I A;  5EEO A;  2PNC A;  3MG1 A;  1JN5 A;  2BO9 B;  3N9H A;  1VQ7 3;  2XH9 A;  5G2G A;  3BB9 A;  4N6L A;  3KN4 A;  4HJL B;  4HM0 B;  4EYC A;  1O7H B;  3OWU A;  4STD A;  1F8N A;  3FKA A;  3KSE D;  1IV7 A;  4GB5 A;  3KFQ C;  4RBN A;  4KVH A;  2RCD A;  4CDL A;  1JKG B;  1WMP A;  3MYT A;  3OXA A;  1IQX A;  1JB5 A;  1VQL 3;  1EQK A;  3LT9 A;  3F9S A;  3F8X A;  1YIT 3;  2CH9 A;  2QEX 3;  1IQ8 A;  5IG0 A;  4RNY A;  2CC3 A;  5AYS C;  4XM4 A;  5CF2 A;  2XFT A;  1GYB A;  1JRQ A;  2WOF A;  4N6U A;  2O9U X;  4HYZ A;  1LXE A;  3LT8 A;  3FSD A;  5HGR A;  5IEP A;  1FGM A;  3X3Z A;  2CWU A;  3K5T A;  4HM6 B;  2FXT A;  5AEW B;  1MOL A;  1YIJ 3;  4JRF A;  1JB2 A;  3MPH A;  1E97 A;  3HIG A;  3LTB A;  3GRD A;  2SBL A;  2XEP A;  2OOV A;  1E3V A;  3DGL A;  1W5Z A;  3VSY A;  2GBX B;  1TUH A;  3JUM A;  2CK3 H;  3Q1C A;  4FCM A;  1UW1 A;  1OF5 A;  3G6E 3;  3S67 A;  2QIY A;  1A2V A;  2CFW A;  1AR0 A;  2P0X A;  3X40 A;  4N3V A;  2IA7 A;  2Z7A A;  3SXX A;  1IVU A;  2WOH A;  1OCV A;  1JKG A;  4NRE A;  2W56 B;  4K90 B;  3T8N A;  1RRH A;  3LTA A;  4I4K A;  1UUV B;  3LTC A;  3KZT A;  3LYG A;  1VQ8 3;  5AI1 A;  3OWS A;  3FGY A;  3X3Y A;  3FH1 A;  3B8L A;  2GEY A;  4LSO A;  2CFL A;  4LEH A;  5FW5 A;  4R9L A;  4LMI A;  1W7C A;  5AEU B;  2UX0 A;  1N5H A;  4N6O B;  3G8Z A;  3WA2 X;  1VQP 3;  2Q07 A;  4HVN A;  1W6C A;  1IVV A;  5CXO A;  4FMD A;  2XR8 B;  4FMA A;  1IT7 A;  1FGR A;  1Y4K A;  3K63 A;  3UL5 A;  4KFD A;  3HX8 A;  3Q90 A;  2A15 A;  3EBY A;  5AYR B;  3LML A;  4WFO A;  5IG5 A;  1Q40 A;  3D3L A;  1O7W B;  5ELU A;  3OX9 A;  3JUN A;  1YVB I;  2P0M A;  1RKY A;  2OOV C;  1WMO A;  3Q2P A;  1N8R 4;  2HMK B;  2YFJ B;  3U1W A;  2IUJ A;  3CC4 3;  1N5P A;  3F7X A;  4PEJ A;  2W56 A;  1Q86 4;  1W6Y A;  2HMJ B;  2XGL A;  3EN1 B;  1DYU A;  1LOX A;  1K73 4;  2W0Q A;  2CG1 A;  6STD A;  3L0R A;  1SJW A;  2WO0 A;  4K61 A;  3F14 A;  2YFI B;  4R1K A;  5D83 A;  3LTD A;  3RDE A;  4MEI A;  1CYV A;  5EQL A;  4XDV A;  3TDG A;  5CF1 A;  4IIA A;  3GZX B;  3K9M C;  3PGB A;  4WP5 A;  1BUQ A;  1V74 A;  1SQW A;  3ROB A;  5IER A;  3EN8 A;  1OHP A;  4O2H A;  1YJ9 3;  3SVA A;  2GXF A;  3CD6 3;  2BT3 A;  2CHC A;  1AV4 A;  3A76 A;  2C10 A;  1VQN 3;  3NM2 A;  2MF7 A;  1M1K 4;  1KC8 4;  2JQ5 A;  4H61 A;  3CNM A;  4XDW A;  1US1 A;  1W01 A;  1S72 3;  3ALA A;  2W9Q A;  3U97 A;  1VQO 3;  1SIH A;  1SPU A;  1EA2 A;  1EKM A;  4IPB A;  5A0O B;  1NB3 I;  2KXG A;  3NBB A;  3NHX A;  2Z77 A;  5AII A;  3CC7 3;  2W2C A;  2V1L A;  3V92 A;  1ZO2 A;  3WOF B;  2RSX A;  3K7C A;  1GY7 A;  5STD A;  1VZZ A;  3H51 A;  1LVN A;  3I0Y A;  3DZL A;  1IT8 A;  1LNH A;  1A2K A;  5IG4 A;  3DY5 A;  2QGU A;  3CCJ 3;  2CKF B;  3X3X A;  3I56 3;  1JNQ A;  2Y73 A;  3DUK A;  2GBW B;  4MJD A;  3OW2 2;  1U8C B;  2E2V A;  3M8C A;  3CPW 2;  2ZL8 A;  1OAC A;  2CWT A;  3LOY A;  3EC9 A;  1L5G B;  1R4C A;  3AMO B;  3CCS 3;  1ASK A;  5JPU A;  4O8S A;  1RJO A;  4FR9 A;  4X2H A;  1QAF A;  1VQ9 3;  3PCS A;  3S29 A;  4EV5 A;  2RGQ A;  1SII A;  3WDG B;  4Q53 A;  2P05 A;  4WYK B;  1DVC A;  3SOY A;  1QVG 2;  2E2T A;  3UJM A;  1VQK 3;  3S5C A;  4HZB B;  3PXM A;  3FG4 A;  3G16 A;  3FCS B;  2W6J H;  3EE1 A;  1S5A A;  4EBG A;  1OUN A;  1CYU A;  1U5O A;  1QMA A;  3SX1 A;  3WOD G;  3EB8 A;  3B7C A;  1FGQ A;  2CIU A;  1STD A;  1QAK A;  4AKY A;  1IDP A;  1D6U A;  3FZW A;  3HII A;  2HMM B;  2OQE A;  5ELJ A;  1O7N B;  4N6N B;  1K9M 4;  4FMB A;  2PZV A;  1STF I;  3CC2 3;  4LZI A;  3DGM A;  3EBT A;  3BNB A;  3AMO A;  3SED A;  5KP3 A;  3CCU 3;  2O3O A;  3EF8 A;  1IV9 A;  4L7K A;  1GD4 A;  3STD A;  1IQY A;  4MMX B;  1TFK A;  3WMD A;  4BTX A;  2RFR A;  1WNH A;  4TX4 A;  1OHS A;  1N9J A;  1K28 A;  2XSH B;  3OV4 A;  4XBY A;  1N8Q A;  3MKI A;  2XF3 A;  1W02 A;  2XSO B;  3JUP A;  1FGT A;  1TIJ A;  8CHO A;  1ULI B;  2Z6B A;  2W04 A;  2WGQ A;  2OWP A;  5KP4 A;  3BLZ A;  2W9P A;  1AVK A;  3H3H A;  3HK4 A;  3DGO A;  3JVC A;  4HM1 B;  5LC6 A;  3SLU A;  1JV2 B;  2CFK A;  2YX9 A;  1MNL A;  1ZX2 A;  1M9G A;  3F40 A;  3G71 3;  3EJV A;  4FCZ A;  3KII A;  4FMC A;  1YI2 3;  3GAX A;  1QAL A;  1O7M B;  1A67 A;  3IJE B;  3ECF A;  3I55 3;  4CCV A;  2B1X B;  2OQE C;  3FF0 A;  4K1U A;  2F98 A;  5JBS A;  2OTJ 3;  3KSP A;  2XGN A;  3MG2 A;  4RZM A;  5BVB A;  3CCL 3;  2STD A;  1GS3 A;  1NO3 A;  5FGO A;  1DMQ A;  2YFL B;  3PS8 A;  3VF1 A;  5AIG A;  1CQS A;  3D9R A;  1D6Y A;  3GZY B;  4OVM A;  4EXR A;  1Q82 4;  4OK0 A;  3MSO A;  1WMN A;  2OCT A;  1YHQ 3;  1Q81 4;  3QK9 A;  3FG1 A;  2WGO A;  1PFP A;  3S27 A;  2C11 A;  1FUW A;  2JDI H;  1YGE A;  3NXJ A;  5LC7 A;  3LZA A;  1OHO A;  2GU1 A;  1UI8 A;  2GU3 A;  1KSI A;  4HBR A;  3CCE 3;  1M90 4;  4WWU C;  4X2O A;  4KZ1 A;  3WOE B;  3NV0 B;  3FG3 A;  1TU5 A;  4IT7 A;  1YJN 3;  1KD1 4;  3PYJ A;  1JJ2 2;  1PU4 A;  5EVH A;  3J7Y d;  2M7O A;  1VQ5 3;  2Y74 A;  4L8P A;  1Q42 A;  3GZB A;  5BXQ A;  2F99 A;  2W03 A;  4HM5 B;  3ER7 A;  1RN7 A;  1ROV A;  1KWI A;  3DGN A;  3UB1 A;  3X41 A;  1ISK A;  5TGN A;  2K54 A;  1JB4 A;  3HZP A;  1OF5 B;  3S28 A;  3V98 A;  3WA3 A;  4RNZ A;  4HM8 B;  2B24 B;  3JUQ A;  4J9A A;  4U13 A;  1TP6 A;  1W2B 2;  3N54 B;  4JF8 A;  2ZDJ A;  4J8T A;  5IF6 A;  2CFG A;  1HKX A;  1DMN A;  3NQY A;  4N6V 0;  2OTL 3;  1NU3 A;  1ULJ B;  3KKG A;  3NQZ A;  1NWW A;  1FGO A;  3PZW A;  3O8Y A;  4R4K A;  3SOA A;  2CWV A;  2Z76 A;  3GWR A;  1VQM 3;  1Q7Y 4;  4XBT A;  1FA3 A;  1IVW A;  1CEW I;  4HM3 B;  2L4V A;  3IPT A;  5JPP A;  3CCM 3;  4OUQ A;  1AVL A;  1TFO A;  2INX A;  1DMM A;  2ML6 A;  3BND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...