4OUQA

Crystal structure of a duf4783 family protein (bf1468) from bacteroides fragilis ych46 at 1.55 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
105
Chain Sequence
DIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLAAFFSSNKVSGFNVNHEGKRDSSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF1468) from Bacteroides fragilis YCH46 at 1.55 A resolution
rcsb
source organism Bacteroides fragilis
total genus 30
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2014-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ouqA00
3DZLA 4K1VA 3F8HA 3STDA 1JN5A 4HM4B 1TP6A 5STDA 2CHCA 5AEUB 3SOAA 3CNXA 8CHOA 4ORLA 3GWRA 5BVBA 3DXOA 5HGRA 5KP1A 3GZRA 1OCVA 1U5OA 2I9WA 4HJLB 3G8ZA 3Q90A 3SEDA 2HMMB 4LEHA 1C7HA 1Q42A 3B4OA 4HVNA 1EA2A 2STDA 4XDWA 2HMJB 3FF0A 3G0KA 3ECFA 1OGXA 3NXJA 4I4KA 4HM2B 5CF1A 1WQLB 2QIYA 4L8OA 4XM4A 4MJDA 3GZYB 4WWUC 1JKGB 3OWUA 3ER7A 1JB2A 4HZ9B 3FGYA 1Z1SA 3JUQA 5CF2A 3FKAA 1K41A 2HMKB 4WP5A 5KP4A 1Q40A 3MKIA 5TGNA 3B8LA 3OWSA 5AIFA 3CNMA 2BNGA 3VSYA 1GY5A 1GY7A 4OVMA 4CDLA 1SJWA 5IG5A 4Q53A 1QJGA 1GY6A 3VGNA 4K1UA 4LMIA 5CK6A 5EVHA 4PEJA 3KSPA 2R4IA 3MG3A 1O7PB 3LYGA 1GS3A 3K7CA 1OH0A 3JUOA 4XBTA 1E3RA 5FW5A 4HZBB 2BMQB 2BMOB 1DMNA 3EN8A 3WMDA 5IENA 3T8NA 7STDA 5D81A 3H3HA 3EBTA 3HZPA 2YFJB 3LZAA 5IG0A 3B4PA 3HX8A 4R1KA 3FH1A 1AR0A 1W01A 4XDVA 3EHCA 1IDPA 4HKVB 3IPTA 5AIGA 2GBXB 4U13A 1JKGA 5KP3A 2XRXB 2W2CA 2Z77A 1ISKA 3OXAA 3BB9A 3GRDA 3EN1B 2B24B 2A15A 3EJVA 1W00A 3JUNA 3H51A 1ULJB 4XB5A 4L8PA 2K54A 1ULIB 4HM0B 4N3VA 3RGAA 3D9RA 2JQ5A 4XBYA 5IEPA 3F14A 1O7HB 1O7WB 5D82A 1A2KA 3HK4A 3EC9A 3NM2A 5IG3A 3DUKA 1JB5A 2IMJA 1DMMA 4IIAA 4STDA 1OHSA 4XBXA 1BUQA 1OHOA 2F98A 3UJMA 1HKXA 5AIHA 1QMAA 3I0YA 4J8TA 1NDOB 3CPOA 1JB4A 4J9AA 2RGQA 3GZXB 1EG9B 4HM5B 2UX0A 3ROBA 3KE7A 1OF5B 3UNLA 1E3VA 5AI1A 3BLZA 2XR8B 2YFIB 2HMOB 3NUVA 3NV0B 2GEXA 5D83A 2HMLB 2RFRA 4X2OA 1OGZA 2BMRB 1UUWB 4WYKA 3EX9A 1TUHA 4HM3B 3EQQB 5JPUA 5IEOA 2GEYA 4OUQA 1ASKA 3NBRA 3FF2A 1O7GB 4HM6B 1S5AA 4FCJA 1W02A 3MSOA 1ZO2A 4WYKB 2GBWB 2B1XB 3MHEA 5AIIA 1OPYA 1O7NB 1JN5B 1ZX2A 2QGUA 4FCMA 3K0ZA 5IF6A 3E99A 4R9LA 5IERA 5IG4A 3CU3A 4KVHA 3EBYA 1E97A 2F99A 3RGRA 3GZBA 5CLKA 3G16A 3KZTA 1GYBA 5CXOA 2Z76A 3M8CA 1OHPA 2INXA 1STDA 5DRVA 3B7CA 1O7MB 2F86B 3F8XA 3DMCA 2GXFA 6STDA 3F7XA 4X2HA 3OWYA 5AEWB 3NHXA 3FLJA 1DMQA 4HM7B 4RZMA 3MYTA 1OF5A 3A76A 2PZVA 1UUVB 2XSOB 5G2GA 3MG2A 3FSDA 4HM1B 1OUNA 3OX9A 3NV0A 1NU3A 3MG1A 3KKGA 3SOYA 3T8UA 3EF8A 2YFLB 4LGQA 1CQSA 1W6YA 4L7KA 4R9KA 5BXQA 1Q40B 2RCDA 3S5CA 5DREA 2CKFB 2Z7AA 3F40A 3F9SA 3FZWA 3DM8A 4HM8B 1VZZA 4GB5A 2XSHB 2HMNB 2OWPA 4H3UA 3OV4A 3JUMA 5JPPA 3F7SA 3JUPA 1NWWA
chains in the Genus database with same CATH superfamily
3DZLA 2OTL3 4K1VA 3F8HA 1BRSA 1I2FA 3STDA 1JN5A 4HM4B 1YHQ3 1TP6A 5STDA 2CHCA 5AEUB 4LYLB 2MF7A 1M904 3SOAA 2F56A 3CNXA 3NM7A 4K61A 1KC84 8CHOA 4FR9A 2W03A 4ORLA 1FUWA 3DH2A 3GWRA 5BVBA 1VQK3 3WHOA 3X3XA 1EEJA 3DXOA 5HGRA 5A0OB 1I3FA 5KP1A 1GOVA 2IUKA 2RNTA 3IMAB 1TFKA 3GZRA 4J5KA 5EEOA 1JJ22 2IA7A 3RDEA 3LOYA 3WOFB 4EV2A 3CC23 1OCVA 1VQ53 3WA3A 3FG1A 3WODG 1U5OA 2I9WA 2C11A 2ML6A 5M18A 4HJLB 3G8ZA 2KCDA 3Q90A 3SEDA 2HMMB 1VQL3 1IK3A 4LEHA 2C10A 1BNIA 1W2ZA 2CFWA 1C7HA 1Q42A 1TFOA 1BU4A 2XF3A 3B4OA 4G1MB 1VQ73 1RGCA 4HVNA 1EA2A 2STDA 4XDWA 2HMJB 3FF0A 3T0UA 4BTXA 3G0KA 3ECFA 1PFPA 1OGXA 2KF5A 3NXJA 4I4KA 2QEX3 1QVG2 4HM2B 5CF1A 2H0GA 1WQLB 4DKIA 4ZM8A 1FZUA 2Z6BA 3PGBA 2Q07A 2QIYA 1IV7A 3LT9A 1FUSA 4L8OA 2CG0A 2L1SA 4HYZA 1Q7Y4 4XM4A 4MJDA 1LRAA 1T3BA 3K9MC 4N6LA 1GSPA 3GZYB 2XGNA 2C4BA 1JKGB 4WWUC 3OWUA 3I563 1B20A 2W56B 2CW9A 3ER7A 4MMZB 1J2BA 1JNQA 1JB2A 2IYJA 4HZ9B 1T2HA 3FGYA 1Z1SA 1X1WA 2ZL8A 1ZGXA 3N54B 4N6UA 2RBIA 1A2PA 1RGKA 2KF6A 3GAXA 4J5GA 5JBSA 3WOEB 3JUQA 1Q814 1N9EA 3A5EA 1TRPA 3X3ZA 5CF2A 2P05A 1US1A 3FKAA 1K41A 3BNEA 1LQGC 1RCLA 2HMKB 2L4VA 1KWIA 1ROAA 4N6V0 2CWTA 4AKYA 1IQ8A 1TRQA 2YX9A 2CFGA 4WP5A 5KP4A 1Q40A 3K5TA 1RGFA 3MKIA 3OWSA 3B8LA 5TGNA 1I70A 5AIFA 1GMPA 1BRIA 1UGIA 2WOHA 3CNMA 3SXXA 1BNJA 4AEQA 1QAKA 1X1XA 2BNGA 4BU4A 3LTAA 1GY5A 3VSYA 4N6MA 1GY7A 3CCS3 1UUGB 4N6TA 3V92A 2W04A 1VQN3 1RSNA 2E2VA 4OVMA 3O8YA 4CDLA 1SJWA 5IG5A 4MMXB 3J7Yd 3BU4A 1IQYA 1CEWI 3N9HA 4Q53A 2CG1A 1NNVA 1GY6A 1QJGA 3VGNA 3CXC2 1EKMA 1RN1A 4K1UA 4LMIA 5CK6A 5EVHA 3NBJA 1FGRA 4PEJA 3KSPA 3X40A 1FW7A 4AKZA 2R4IA 1D6UA 3S67A 3AMOB 1LNHA 3MG3A 1YI23 1O7PB 3LYGA 1GS3A 1BRHA 1RJOA 1KD14 2ZHXB 1MWUA 3K7CA 1OH0A 4KFFA 4LSOA 1IT8A 3JUOA 1IVWA 2OCTA 2PNCA 4XBTA 3URPA 4O8SA 1E3RA 5FW5A 1VQ83 2P0MA 4HZBB 2BMQB 2BMOB 1DMNA 2FXTA 2UGIA 3EN8A 4EW5A 3DGLA 3WMDA 1LOWA 1Q864 3HOHA 5IENA 3T8NA 7STDA 4MEIA 5D81A 3H3HA 3X3YA 3AHSA 3EBTA 3HZPA 2YFJB 3LZAA 2J8XB 1FYSA 2XFTA 5IG0A 3CC43 3GSPA 3ALAA 1KQS2 1IVUA 1B2ZA 3D4AA 1RMSA 3B4PA 4WFOA 1IYYA 1A2VA 1HU9A 3Q3FA 4RNYA 3EB8A 3HX8A 4KFEA 1F8NA 3PCSA 4R1KA 3FH1A 1T2IA 4LZIA 1AR0A 1GD3A 1RGHA 1MWRA 1W01A 4WHAA 3OW22 1X1UA 1B2UA 4XDVA 1WTHA 1S723 1LVNA 1LOVA 3ZFZA 3S28A 2KXGA 2CH9A 3IJEB 1PY3A 3EHCA 4EC6A 1EUIC 1IDPA 4HKVB 3ZG5A 1I0XA 3IPTA 2XEPA 3UL5A 5AIGA 1A67A 2GBXB 2CWUA 1I2EA 2CFKA 3WDGB 4U13A 3LT8A 3V99A 1RRHA 1JKGA 3QRDA 5BIRA 2WO0A 1N5PA 1AQZA 3G6E3 1HYFA 1RNTA 2W56A 3L0RA 4EV5A 1SPUA 5KP3A 1LNIA 2HOHA 1FUTA 2W2CA 2XRXB 2Z77A 2SARA 3K63A 3LXUX 4N6OB 1ISKA 3OXAA 1HZ1A 3BB9A 3GRDA 5LC7A 3U1WA 7GSPA 4H61A 3PCRA 1N9JA 3EN1B 1I8VA 1FA3A 3NBBA 1N5HA 2B24B 2CWVA 1BVIA 1JBSA 1Y4KA 3WA2X 3AGNA 1DE3A 2A15A 3EJVA 1DETA 1B2XA 3KCHA 1W00A 3JUNA 1RRLA 3H51A 4IPBA 3D5GA 4CPKA 1QALA 2E2TA 3KFQC 1ULJB 2CX1A 2IY2A 4XB5A 3CCM3 4L8PA 2K54A 1Q7HA 1ULIB 1RN4A 1T5YA 4HM0B 1MGWA 4NREA 2BIRA 4N3VA 3RGAA 1A90A 1GD4A 1LOXA 3D9RA 1W6GA 2LQVA 2JQ5A 1WMNA 1G96A 4XBYA 5GSPA 5IEPA 1RKYA 3F14A 1UGHI 5AYRB 1O7HB 1V74A 4TX4A 3MPHA 1O7WB 2CFLA 5D82A 4BTYA 1AVLA 2SBLA 1A2KA 2XGLA 3DGMA 3HK4A 3EC9A 3NM2A 3SVAA 1OACA 5IG3A 1LXEA 1B3SA 1G02A 2H0HA 4EXRA 1CH0A 1C54A 3NX0A 3DUKA 1X1YA 3AMOA 3SLUA 1RDSA 1VQP3 1I0VA 1JB5A 9RNTA 1NB5I 1KSIA 1B2MA 4ILFA 2IMJA 1YVBI 1DMMA 3ZG0A 2CIUA 4IIAA 4STDA 1OHSA 4EBGA 1PYLA 4XBXA 4MMYB 1BUQA 1VQ93 1OHOA 1GOUA 1W6CA 2WOFA 3AHWA 3BNDA 3CMA3 5BU4A 1WMOA 2F98A 4FMDA 1BUJA 1SIIA 1DVCA 1AVKA 3D79A 3DGOA 3UJMA 2OQEA 4FMBA 1BIRA 1W7CA 1GMQA 1HKXA 2H0IA 1ROVA 5AIHA 1QMAA 4O3VA 4GL6A 1I2GA 1K8A4 1BSCA 4BL2A 1GOYA 4NHFA 1IU7A 3I0YA 4J8TA 3SX1A 3JVCA 2OQEC 1NDOB 1MNLA 1K28A 1JB4A 2XFSA 3CPOA 1BAOA 1R4YA 3CME3 1NB3I 1W5ZA 4J9AA 1VQ63 2RGQA 5RNTA 1YIT3 1K734 3GZXB 1YJW3 1BSBA 2V1LA 1EG9B 4R4KA 1B21A 4HM5B 3CCU3 2UX0A 3ROBA 3Q1CA 2JDIH 4RNZA 3Q2PA 4N6NB 1UCJA 3KE7A 3LMLA 1OF5B 3UNLA 3I553 1M9GA 1E3VA 3NQYA 5AI1A 3HI7A 2P09A 4OK0A 1QAFA 1FGMA 4I5QA 1RGEA 2W9PA 4GSPA 3BLZA 5EQLA 4KFDA 1FGTA 2XR8B 4JF8A 2E2UA 2YFIB 3EE1A 1R4CA 2HMOB 1YJN3 3NUVA 3NV0B 1QVF2 2GEXA 5D83A 5ELJA 1YNVX 2UUGC 2OOVC 3X41A 4HAAA 3KN4A 1UCIA 2HMLB 1IQXA 2RFRA 4X2OA 1STFI 1W4NA 3MWZA 1N8R4 3BIRA 1OGZA 1YVSA 2BMRB 1UUWB 2GU1A 4WYKA 3EX9A 4FMCA 1TUHA 3QK9A 4HM3B 3V98A 3S29A 3EQQB 2AAEA 3BNBA 5JPUA 2XH9A 1BSDA 4KT3B 3CCQ3 2O3OA 5M19A 1D6ZA 5IEOA 2GEYA 1RTUA 4OUQA 4FCZA 1ASKA 3NBRA 1BNEA 3PS8A 1JRQA 1AY7A 1FGQA 3D5IA 2F4YA 1GMRA 8RNTA 1M1XB 3FF2A 3LTDA 1WNHA 2KF3A 1O7GB 4HM6B 3TDGA 1BRNL 1S5AA 4FCJA 3G4S3 3S27A 1W02A 1MOLA 1UW1A 3MSOA 1UI7A 1ZO2A 4IT7A 4WYKB 2GBWB 2B1XB 3DGNA 1BRJA 3MHEA 5G1KA 5AIIA 1MGRA 1BGSA 3CCJ3 2Y74A 1BANA 1OPYA 4R80A 1O7NB 4HBRA 2QA43 2CK3H 1JN5B 1FGOA 1ZX2A 2QGUA 4FCMA 1YIJ3 2P0XA 1MWTA 3K0ZA 5IF6A 3DGYA 3E99A 4R9LA 1RNBA 1JBRA 4BIRA 1WMPA 1NJI4 5IERA 5IG4A 2K3DA 3CU3A 1W2B2 4KVHA 3EBYA 2WGQA 1RGAA 1BOXA 1SARA 1E97A 4RBNA 1BNGA 4NPBA 2F99A 1V58A 2CFDA 1N8QA 5FGOA 3PYJA 4BTWA 3BNCA 4QWTA 2BO9B 3RGRA 3GZBA 5CLKA 3HIIA 3G16A 4BL3A 2MC8A 1UCLA 3KZTA 3HIGA 3PZWA 3RNTA 1GYBA 3CC73 3CCE3 1YJ93 1YGWA 5CXOA 1L5GB 2FNQA 3U97A 2CX0A 3FG3A 2Z76A 2GSPA 1RCKA 3LH4A 1I3IA 1OHPA 2Y73A 3M8CA 1DVDA 2INXA 1STDA 5DRVA 1BRGA 5M1AA 1UCKA 3B7CA 1BNSA 1O7MB 2F86B 2W9QA 3F8XA 3DMCA 2GXFA 2F5WA 6STDA 3F7XA 4FMAA 3CD63 1V57A 2BT3A 2WGOA 4X2HA 3OWYA 3SYUA 1JBTA 5AEWB 3NHXA 1YGEA 1LQMB 3FLJA 5HOHA 1UDII 1TJDA 1SIHA 1B27A 1DMQA 2FGTA 1SQWA 2M7OA 2RSXA 4HM7B 4KZ1A 4RNTA 3MYTA 4RZMA 5G1LA 7RNTA 1B2SA 1MWSA 1OF5A 2D1WA 3WR2A 5IW9A 2KRTA 3A76A 3LTCA 1BNFA 2PZVA 2IUJA 1JV2B 1UUVB 3AGOA 3FCSB 2XSOB 5G2GA 3MG2A 3D3LA 4O2HA 2D42A 1G0TA 1VQ43 2LYXA 1RGGA 3FSDA 4HM1B 1OUNA 2W6JH 3OX9A 2K0MA 3KSED 3CCR3 3NV0A 1AV4A 1NU3A 3UL6A 3VF1A 4CJNA 1RN7A 2KAAA 5I97A 1ZS7A 3MG1A 2F5MA 3G713 3NQZA 3KKGA 2O9UX 4HOHA 3SOYA 2BHMA 4GHOA 1IT7A 2BU4A 3T8UA 2W0QA 3N8BA 3CPW2 1Q9EA 2GU3A 1U8CB 1IVVA 1LOYA 3EF8A 1IV9A 1TTOA 2R41A 1BRKA 2CC3A 2YFLB 3DY5A 1BNRA 2KF4A 1TU5A 4LGQA 1CQSA 1DYUA 1W6YA 3KIIA 1JZOA 3PXMA 4L7KA 4R9KA 5BXQA 3CCL3 1Q40B 1TIJA 1M1K4 1UI8A 1EQKA 1BSEA 2ZA4A 2ML5A 2OOVA 2RCDA 4O02B 3S5CA 1CYVA 1RLSA 1PU4A 2OTJ3 5DREA 2CKFB 3X42A 2Z7AA 3UB1A 3F40A 3F9SA 4CCVA 5LC6A 3FZWA 5ELUA 1IVXA 3LTBA 3DM8A 4HM8B 1VQQA 1VZZA 4GB5A 1RGLA 2XSHB 4JRFA 5AYSC 6GSPA 1BSAA 2HMNB 2OWPA 3CCV3 2P38A 1K9M4 4H3UA 1D6YA 1Q824 2ZDJA 1VQM3 1JZDA 3FG4A 4EYCA 1NO3A 4K90B 6RNTA 3OV4A 3JUMA 2AADA 5JPPA 3F7SA 1VQO3 3JUPA 1NWWA 1RHLA 1CYUA
chains in the Genus database with same CATH topology
3DZLA 2OTL3 4K1VA 3F8HA 3STDA 1JN5A 4HM4B 1YHQ3 1TP6A 5STDA 2CHCA 5AEUB 2MF7A 1M904 3SOAA 3CNXA 3NM7A 4K61A 1KC84 1FUWA 8CHOA 4FR9A 2W03A 4ORLA 3GWRA 5BVBA 1VQK3 3X3XA 3DXOA 5HGRA 5A0OB 5KP1A 2IUKA 3IMAB 1TFKA 3GZRA 5EEOA 1JJ22 2IA7A 3RDEA 3LOYA 3WOFB 4EV2A 3CC23 1OCVA 1VQ53 3WA3A 3FG1A 3WODG 1U5OA 2I9WA 2C11A 2ML6A 4HJLB 3G8ZA 2KCDA 3Q90A 3SEDA 2HMMB 1VQL3 1IK3A 4LEHA 2C10A 1W2ZA 2CFWA 1C7HA 1Q42A 1TFOA 2XF3A 3B4OA 4G1MB 1VQ73 4HVNA 1EA2A 2STDA 4XDWA 2HMJB 3FF0A 3T0UA 4BTXA 3G0KA 3ECFA 1PFPA 1OGXA 3NXJA 4I4KA 2QEX3 1QVG2 4HM2B 5CF1A 1WQLB 4ZM8A 2Z6BA 3PGBA 2Q07A 2QIYA 1IV7A 3LT9A 4L8OA 2CG0A 4HYZA 1Q7Y4 4XM4A 4MJDA 4N6LA 3K9MC 3GZYB 2XGNA 4WWUC 1JKGB 3OWUA 3I563 2W56B 2CW9A 3ER7A 4MMZB 1J2BA 1JNQA 1JB2A 4HZ9B 3FGYA 1Z1SA 2ZL8A 3N54B 4N6UA 5JBSA 3GAXA 3WOEB 3JUQA 1Q814 1N9EA 3X3ZA 5CF2A 2P05A 1US1A 3FKAA 1K41A 3BNEA 2HMKB 2L4VA 1KWIA 1ROAA 4N6V0 2CWTA 4AKYA 1IQ8A 2YX9A 2CFGA 4WP5A 5KP4A 1Q40A 3K5TA 3MKIA 3OWSA 3B8LA 5TGNA 5AIFA 3SXXA 2WOHA 3CNMA 4AEQA 1QAKA 2BNGA 3LTAA 1GY5A 3VSYA 4N6MA 1GY7A 3CCS3 4N6TA 3V92A 2W04A 1VQN3 2E2VA 4OVMA 3O8YA 4CDLA 1SJWA 5IG5A 4MMXB 3J7Yd 1IQYA 1CEWI 3N9HA 4Q53A 2CG1A 1QJGA 1GY6A 3VGNA 3CXC2 1EKMA 4K1UA 4LMIA 5CK6A 5EVHA 3NBJA 1FGRA 4PEJA 3KSPA 3X40A 4AKZA 2R4IA 1D6UA 3S67A 3AMOB 1LNHA 3MG3A 1YI23 1O7PB 3LYGA 1GS3A 1RJOA 1KD14 3K7CA 4KFFA 1OH0A 4LSOA 1IT8A 3JUOA 1IVWA 2OCTA 2PNCA 4XBTA 4O8SA 1E3RA 5FW5A 1VQ83 2P0MA 4HZBB 2BMQB 2BMOB 1DMNA 2FXTA 3EN8A 3DGLA 3WMDA 1Q864 5IENA 3T8NA 7STDA 4MEIA 5D81A 3H3HA 3X3YA 3EBTA 3HZPA 2YFJB 3LZAA 2XFTA 5IG0A 3CC43 3ALAA 1KQS2 1IVUA 3B4PA 4WFOA 1A2VA 1HU9A 4RNYA 3EB8A 3HX8A 4KFEA 1F8NA 3PCSA 4R1KA 3FH1A 4LZIA 1AR0A 1GD3A 1W01A 4WHAA 3OW22 4XDVA 1WTHA 1S723 1LVNA 3S28A 2KXGA 2CH9A 3IJEB 3EHCA 4EC6A 1IDPA 4HKVB 3IPTA 2XEPA 3UL5A 5AIGA 1A67A 2GBXB 2CWUA 2CFKA 3WDGB 4U13A 3LT8A 3V99A 1RRHA 1JKGA 3QRDA 2WO0A 1N5PA 3G6E3 3L0RA 2W56A 4EV5A 1SPUA 5KP3A 2XRXB 2W2CA 2Z77A 3K63A 3LXUX 4N6OB 1ISKA 3OXAA 3BB9A 3GRDA 5LC7A 3U1WA 4H61A 3PCRA 1N9JA 3EN1B 1FA3A 3NBBA 1N5HA 2B24B 2CWVA 1Y4KA 3WA2X 2A15A 3EJVA 1W00A 3JUNA 1RRLA 3H51A 4IPBA 1QALA 2E2TA 3KFQC 1ULJB 4XB5A 3CCM3 4L8PA 2K54A 1ULIB 1T5YA 4HM0B 4NREA 4N3VA 3RGAA 1A90A 1GD4A 1LOXA 3D9RA 1W6GA 2LQVA 2JQ5A 1WMNA 1G96A 4XBYA 5IEPA 1RKYA 3F14A 5AYRB 1O7HB 1V74A 4TX4A 3MPHA 1O7WB 2CFLA 5D82A 4BTYA 1AVLA 2SBLA 1A2KA 2XGLA 3DGMA 3HK4A 3EC9A 3NM2A 3SVAA 1OACA 5IG3A 1LXEA 4EXRA 3NX0A 3DUKA 3AMOA 3SLUA 1VQP3 1NB5I 1JB5A 1KSIA 2IMJA 1YVBI 1DMMA 2CIUA 4IIAA 4STDA 1OHSA 4EBGA 4XBXA 4MMYB 1BUQA 1VQ93 1OHOA 1W6CA 2WOFA 3BNDA 3CMA3 1WMOA 2F98A 4FMDA 1SIIA 1DVCA 1AVKA 3DGOA 3UJMA 2OQEA 4FMBA 1W7CA 1HKXA 1ROVA 5AIHA 1QMAA 4O3VA 4GL6A 1K8A4 4NHFA 1IU7A 3I0YA 4J8TA 3SX1A 3JVCA 2OQEC 2XFSA 1MNLA 1K28A 1JB4A 1NDOB 3CPOA 3CME3 1NB3I 1W5ZA 4J9AA 1VQ63 2RGQA 1YIT3 1K734 3GZXB 1YJW3 2V1LA 1EG9B 4R4KA 4HM5B 3CCU3 2UX0A 3ROBA 3Q1CA 2JDIH 4RNZA 3Q2PA 4N6NB 3KE7A 3LMLA 3I553 1OF5B 3UNLA 1M9GA 1E3VA 3NQYA 5AI1A 3HI7A 2P09A 4OK0A 1QAFA 1FGMA 2W9PA 5EQLA 3BLZA 4KFDA 1FGTA 2XR8B 4JF8A 2E2UA 2YFIB 3EE1A 1R4CA 2HMOB 1YJN3 3NUVA 3NV0B 1QVF2 2GEXA 5D83A 5ELJA 2OOVC 3X41A 3KN4A 2HMLB 1IQXA 2RFRA 4X2OA 1STFI 1W4NA 3MWZA 1N8R4 1OGZA 2BMRB 1UUWB 2GU1A 4WYKA 3EX9A 4FMCA 1TUHA 3QK9A 4HM3B 3V98A 3S29A 3EQQB 3BNBA 5JPUA 2XH9A 3CCQ3 2O3OA 1D6ZA 5IEOA 2GEYA 4OUQA 4FCZA 1ASKA 3NBRA 3PS8A 1JRQA 1FGQA 1M1XB 3FF2A 3LTDA 1WNHA 1O7GB 4HM6B 3TDGA 1S5AA 4FCJA 3G4S3 3S27A 1W02A 1MOLA 1UW1A 3MSOA 1UI7A 1ZO2A 4IT7A 4WYKB 2GBWB 2B1XB 3DGNA 3MHEA 5AIIA 3CCJ3 2Y74A 1OPYA 4R80A 1O7NB 4HBRA 2QA43 2CK3H 1JN5B 1FGOA 1ZX2A 2QGUA 4FCMA 1YIJ3 2P0XA 3K0ZA 5IF6A 3E99A 4R9LA 1WMPA 1NJI4 5IERA 5IG4A 1W2B2 3CU3A 4KVHA 3EBYA 2WGQA 1E97A 4RBNA 5FGOA 2F99A 2CFDA 4BTWA 1N8QA 3PYJA 3BNCA 4QWTA 2BO9B 3RGRA 3GZBA 5CLKA 3HIIA 3G16A 2MC8A 3KZTA 3HIGA 3PZWA 1GYBA 3CC73 3CCE3 1YJ93 5CXOA 1L5GB 2FNQA 3U97A 3FG3A 2Z76A 3LH4A 3M8CA 1OHPA 2Y73A 1DVDA 2INXA 1STDA 5DRVA 3B7CA 2W9QA 1O7MB 2F86B 3F8XA 3DMCA 2GXFA 6STDA 3F7XA 4FMAA 3CD63 2WGOA 2BT3A 4X2HA 3OWYA 5AEWB 3NHXA 1YGEA 3FLJA 1SIHA 1DMQA 2FGTA 2M7OA 1SQWA 2RSXA 4HM7B 4KZ1A 4RZMA 3MYTA 1OF5A 2D1WA 5IW9A 2KRTA 3A76A 3LTCA 2PZVA 2IUJA 1JV2B 1UUVB 3FCSB 2XSOB 5G2GA 3MG2A 3D3LA 4O2HA 2D42A 1VQ43 2LYXA 3FSDA 4HM1B 1OUNA 2W6JH 3OX9A 2K0MA 3KSED 3CCR3 3NV0A 1AV4A 1NU3A 3UL6A 3VF1A 1RN7A 5I97A 3MG1A 3G713 3NQZA 3KKGA 2O9UX 3SOYA 2BHMA 1IT7A 3T8UA 2W0QA 3N8BA 3CPW2 2GU3A 1U8CB 1IVVA 3EF8A 1IV9A 2CC3A 2YFLB 3DY5A 1TU5A 4LGQA 1CQSA 1DYUA 1W6YA 3KIIA 3PXMA 4L7KA 4R9KA 5BXQA 3CCL3 1Q40B 1TIJA 1M1K4 1UI8A 1EQKA 2ML5A 2OOVA 2RCDA 4O02B 3S5CA 1CYVA 1PU4A 2OTJ3 5DREA 2CKFB 3X42A 2Z7AA 3UB1A 3F40A 3F9SA 4CCVA 5LC6A 3FZWA 5ELUA 1IVXA 3LTBA 3DM8A 4HM8B 1VZZA 4GB5A 2XSHB 4JRFA 5AYSC 2HMNB 2OWPA 3CCV3 2P38A 1K9M4 4H3UA 1D6YA 1Q824 2ZDJA 1VQM3 3FG4A 4EYCA 1NO3A 4K90B 3OV4A 3JUMA 5JPPA 3F7SA 1VQO3 3JUPA 1NWWA 1CYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZL A;  4K1V A;  3F8H A;  3STD A;  1JN5 A;  4HM4 B;  1TP6 A;  5STD A;  2CHC A;  5AEU B;  3SOA A;  3CNX A;  8CHO A;  4ORL A;  3GWR A;  5BVB A;  3DXO A;  5HGR A;  5KP1 A;  3GZR A;  1OCV A;  1U5O A;  2I9W A;  4HJL B;  3G8Z A;  3Q90 A;  3SED A;  2HMM B;  4LEH A;  1C7H A;  1Q42 A;  3B4O A;  4HVN A;  1EA2 A;  2STD A;  4XDW A;  2HMJ B;  3FF0 A;  3G0K A;  3ECF A;  1OGX A;  3NXJ A;  4I4K A;  4HM2 B;  5CF1 A;  1WQL B;  2QIY A;  4L8O A;  4XM4 A;  4MJD A;  3GZY B;  4WWU C;  1JKG B;  3OWU A;  3ER7 A;  1JB2 A;  4HZ9 B;  3FGY A;  1Z1S A;  3JUQ A;  5CF2 A;  3FKA A;  1K41 A;  2HMK B;  4WP5 A;  5KP4 A;  1Q40 A;  3MKI A;  5TGN A;  3B8L A;  3OWS A;  5AIF A;  3CNM A;  2BNG A;  3VSY A;  1GY5 A;  1GY7 A;  4OVM A;  4CDL A;  1SJW A;  5IG5 A;  4Q53 A;  1QJG A;  1GY6 A;  3VGN A;  4K1U A;  4LMI A;  5CK6 A;  5EVH A;  4PEJ A;  3KSP A;  2R4I A;  3MG3 A;  1O7P B;  3LYG A;  1GS3 A;  3K7C A;  1OH0 A;  3JUO A;  4XBT A;  1E3R A;  5FW5 A;  4HZB B;  2BMQ B;  2BMO B;  1DMN A;  3EN8 A;  3WMD A;  5IEN A;  3T8N A;  7STD A;  5D81 A;  3H3H A;  3EBT A;  3HZP A;  2YFJ B;  3LZA A;  5IG0 A;  3B4P A;  3HX8 A;  4R1K A;  3FH1 A;  1AR0 A;  1W01 A;  4XDV A;  3EHC A;  1IDP A;  4HKV B;  3IPT A;  5AIG A;  2GBX B;  4U13 A;  1JKG A;  5KP3 A;  2XRX B;  2W2C A;  2Z77 A;  1ISK A;  3OXA A;  3BB9 A;  3GRD A;  3EN1 B;  2B24 B;  2A15 A;  3EJV A;  1W00 A;  3JUN A;  3H51 A;  1ULJ B;  4XB5 A;  4L8P A;  2K54 A;  1ULI B;  4HM0 B;  4N3V A;  3RGA A;  3D9R A;  2JQ5 A;  4XBY A;  5IEP A;  3F14 A;  1O7H B;  1O7W B;  5D82 A;  1A2K A;  3HK4 A;  3EC9 A;  3NM2 A;  5IG3 A;  3DUK A;  1JB5 A;  2IMJ A;  1DMM A;  4IIA A;  4STD A;  1OHS A;  4XBX A;  1BUQ A;  1OHO A;  2F98 A;  3UJM A;  1HKX A;  5AIH A;  1QMA A;  3I0Y A;  4J8T A;  1NDO B;  3CPO A;  1JB4 A;  4J9A A;  2RGQ A;  3GZX B;  1EG9 B;  4HM5 B;  2UX0 A;  3ROB A;  3KE7 A;  1OF5 B;  3UNL A;  1E3V A;  5AI1 A;  3BLZ A;  2XR8 B;  2YFI B;  2HMO B;  3NUV A;  3NV0 B;  2GEX A;  5D83 A;  2HML B;  2RFR A;  4X2O A;  1OGZ A;  2BMR B;  1UUW B;  4WYK A;  3EX9 A;  1TUH A;  4HM3 B;  3EQQ B;  5JPU A;  5IEO A;  2GEY A;  4OUQ A;  1ASK A;  3NBR A;  3FF2 A;  1O7G B;  4HM6 B;  1S5A A;  4FCJ A;  1W02 A;  3MSO A;  1ZO2 A;  4WYK B;  2GBW B;  2B1X B;  3MHE A;  5AII A;  1OPY A;  1O7N B;  1JN5 B;  1ZX2 A;  2QGU A;  4FCM A;  3K0Z A;  5IF6 A;  3E99 A;  4R9L A;  5IER A;  5IG4 A;  3CU3 A;  4KVH A;  3EBY A;  1E97 A;  2F99 A;  3RGR A;  3GZB A;  5CLK A;  3G16 A;  3KZT A;  1GYB A;  5CXO A;  2Z76 A;  3M8C A;  1OHP A;  2INX A;  1STD A;  5DRV A;  3B7C A;  1O7M B;  2F86 B;  3F8X A;  3DMC A;  2GXF A;  6STD A;  3F7X A;  4X2H A;  3OWY A;  5AEW B;  3NHX A;  3FLJ A;  1DMQ A;  4HM7 B;  4RZM A;  3MYT A;  1OF5 A;  3A76 A;  2PZV A;  1UUV B;  2XSO B;  5G2G A;  3MG2 A;  3FSD A;  4HM1 B;  1OUN A;  3OX9 A;  3NV0 A;  1NU3 A;  3MG1 A;  3KKG A;  3SOY A;  3T8U A;  3EF8 A;  2YFL B;  4LGQ A;  1CQS A;  1W6Y A;  4L7K A;  4R9K A;  5BXQ A;  1Q40 B;  2RCD A;  3S5C A;  5DRE A;  2CKF B;  2Z7A A;  3F40 A;  3F9S A;  3FZW A;  3DM8 A;  4HM8 B;  1VZZ A;  4GB5 A;  2XSH B;  2HMN B;  2OWP A;  4H3U A;  3OV4 A;  3JUM A;  5JPP A;  3F7S A;  3JUP A;  1NWW A; 
#chains in the Genus database with same CATH topology
 3DZL A;  2OTL 3;  4K1V A;  3F8H A;  1BRS A;  1I2F A;  3STD A;  1JN5 A;  4HM4 B;  1YHQ 3;  1TP6 A;  5STD A;  2CHC A;  5AEU B;  4LYL B;  2MF7 A;  1M90 4;  3SOA A;  2F56 A;  3CNX A;  3NM7 A;  4K61 A;  1KC8 4;  8CHO A;  4FR9 A;  2W03 A;  4ORL A;  1FUW A;  3DH2 A;  3GWR A;  5BVB A;  1VQK 3;  3WHO A;  3X3X A;  1EEJ A;  3DXO A;  5HGR A;  5A0O B;  1I3F A;  5KP1 A;  1GOV A;  2IUK A;  2RNT A;  3IMA B;  1TFK A;  3GZR A;  4J5K A;  5EEO A;  1JJ2 2;  2IA7 A;  3RDE A;  3LOY A;  3WOF B;  4EV2 A;  3CC2 3;  1OCV A;  1VQ5 3;  3WA3 A;  3FG1 A;  3WOD G;  1U5O A;  2I9W A;  2C11 A;  2ML6 A;  5M18 A;  4HJL B;  3G8Z A;  2KCD A;  3Q90 A;  3SED A;  2HMM B;  1VQL 3;  1IK3 A;  4LEH A;  2C10 A;  1BNI A;  1W2Z A;  2CFW A;  1C7H A;  1Q42 A;  1TFO A;  1BU4 A;  2XF3 A;  3B4O A;  4G1M B;  1VQ7 3;  1RGC A;  4HVN A;  1EA2 A;  2STD A;  4XDW A;  2HMJ B;  3FF0 A;  3T0U A;  4BTX A;  3G0K A;  3ECF A;  1PFP A;  1OGX A;  2KF5 A;  3NXJ A;  4I4K A;  2QEX 3;  1QVG 2;  4HM2 B;  5CF1 A;  2H0G A;  1WQL B;  4DKI A;  4ZM8 A;  1FZU A;  2Z6B A;  3PGB A;  2Q07 A;  2QIY A;  1IV7 A;  3LT9 A;  1FUS A;  4L8O A;  2CG0 A;  2L1S A;  4HYZ A;  1Q7Y 4;  4XM4 A;  4MJD A;  1LRA A;  1T3B A;  3K9M C;  4N6L A;  1GSP A;  3GZY B;  2XGN A;  2C4B A;  1JKG B;  4WWU C;  3OWU A;  3I56 3;  1B20 A;  2W56 B;  2CW9 A;  3ER7 A;  4MMZ B;  1J2B A;  1JNQ A;  1JB2 A;  2IYJ A;  4HZ9 B;  1T2H A;  3FGY A;  1Z1S A;  1X1W A;  2ZL8 A;  1ZGX A;  3N54 B;  4N6U A;  2RBI A;  1A2P A;  1RGK A;  2KF6 A;  3GAX A;  4J5G A;  5JBS A;  3WOE B;  3JUQ A;  1Q81 4;  1N9E A;  3A5E A;  1TRP A;  3X3Z A;  5CF2 A;  2P05 A;  1US1 A;  3FKA A;  1K41 A;  3BNE A;  1LQG C;  1RCL A;  2HMK B;  2L4V A;  1KWI A;  1ROA A;  4N6V 0;  2CWT A;  4AKY A;  1IQ8 A;  1TRQ A;  2YX9 A;  2CFG A;  4WP5 A;  5KP4 A;  1Q40 A;  3K5T A;  1RGF A;  3MKI A;  3OWS A;  3B8L A;  5TGN A;  1I70 A;  5AIF A;  1GMP A;  1BRI A;  1UGI A;  2WOH A;  3CNM A;  3SXX A;  1BNJ A;  4AEQ A;  1QAK A;  1X1X A;  2BNG A;  4BU4 A;  3LTA A;  1GY5 A;  3VSY A;  4N6M A;  1GY7 A;  3CCS 3;  1UUG B;  4N6T A;  3V92 A;  2W04 A;  1VQN 3;  1RSN A;  2E2V A;  4OVM A;  3O8Y A;  4CDL A;  1SJW A;  5IG5 A;  4MMX B;  3J7Y d;  3BU4 A;  1IQY A;  1CEW I;  3N9H A;  4Q53 A;  2CG1 A;  1NNV A;  1GY6 A;  1QJG A;  3VGN A;  3CXC 2;  1EKM A;  1RN1 A;  4K1U A;  4LMI A;  5CK6 A;  5EVH A;  3NBJ A;  1FGR A;  4PEJ A;  3KSP A;  3X40 A;  1FW7 A;  4AKZ A;  2R4I A;  1D6U A;  3S67 A;  3AMO B;  1LNH A;  3MG3 A;  1YI2 3;  1O7P B;  3LYG A;  1GS3 A;  1BRH A;  1RJO A;  1KD1 4;  2ZHX B;  1MWU A;  3K7C A;  1OH0 A;  4KFF A;  4LSO A;  1IT8 A;  3JUO A;  1IVW A;  2OCT A;  2PNC A;  4XBT A;  3URP A;  4O8S A;  1E3R A;  5FW5 A;  1VQ8 3;  2P0M A;  4HZB B;  2BMQ B;  2BMO B;  1DMN A;  2FXT A;  2UGI A;  3EN8 A;  4EW5 A;  3DGL A;  3WMD A;  1LOW A;  1Q86 4;  3HOH A;  5IEN A;  3T8N A;  7STD A;  4MEI A;  5D81 A;  3H3H A;  3X3Y A;  3AHS A;  3EBT A;  3HZP A;  2YFJ B;  3LZA A;  2J8X B;  1FYS A;  2XFT A;  5IG0 A;  3CC4 3;  3GSP A;  3ALA A;  1KQS 2;  1IVU A;  1B2Z A;  3D4A A;  1RMS A;  3B4P A;  4WFO A;  1IYY A;  1A2V A;  1HU9 A;  3Q3F A;  4RNY A;  3EB8 A;  3HX8 A;  4KFE A;  1F8N A;  3PCS A;  4R1K A;  3FH1 A;  1T2I A;  4LZI A;  1AR0 A;  1GD3 A;  1RGH A;  1MWR A;  1W01 A;  4WHA A;  3OW2 2;  1X1U A;  1B2U A;  4XDV A;  1WTH A;  1S72 3;  1LVN A;  1LOV A;  3ZFZ A;  3S28 A;  2KXG A;  2CH9 A;  3IJE B;  1PY3 A;  3EHC A;  4EC6 A;  1EUI C;  1IDP A;  4HKV B;  3ZG5 A;  1I0X A;  3IPT A;  2XEP A;  3UL5 A;  5AIG A;  1A67 A;  2GBX B;  2CWU A;  1I2E A;  2CFK A;  3WDG B;  4U13 A;  3LT8 A;  3V99 A;  1RRH A;  1JKG A;  3QRD A;  5BIR A;  2WO0 A;  1N5P A;  1AQZ A;  3G6E 3;  1HYF A;  1RNT A;  2W56 A;  3L0R A;  4EV5 A;  1SPU A;  5KP3 A;  1LNI A;  2HOH A;  1FUT A;  2W2C A;  2XRX B;  2Z77 A;  2SAR A;  3K63 A;  3LXU X;  4N6O B;  1ISK A;  3OXA A;  1HZ1 A;  3BB9 A;  3GRD A;  5LC7 A;  3U1W A;  7GSP A;  4H61 A;  3PCR A;  1N9J A;  3EN1 B;  1I8V A;  1FA3 A;  3NBB A;  1N5H A;  2B24 B;  2CWV A;  1BVI A;  1JBS A;  1Y4K A;  3WA2 X;  3AGN A;  1DE3 A;  2A15 A;  3EJV A;  1DET A;  1B2X A;  3KCH A;  1W00 A;  3JUN A;  1RRL A;  3H51 A;  4IPB A;  3D5G A;  4CPK A;  1QAL A;  2E2T A;  3KFQ C;  1ULJ B;  2CX1 A;  2IY2 A;  4XB5 A;  3CCM 3;  4L8P A;  2K54 A;  1Q7H A;  1ULI B;  1RN4 A;  1T5Y A;  4HM0 B;  1MGW A;  4NRE A;  2BIR A;  4N3V A;  3RGA A;  1A90 A;  1GD4 A;  1LOX A;  3D9R A;  1W6G A;  2LQV A;  2JQ5 A;  1WMN A;  1G96 A;  4XBY A;  5GSP A;  5IEP A;  1RKY A;  3F14 A;  1UGH I;  5AYR B;  1O7H B;  1V74 A;  4TX4 A;  3MPH A;  1O7W B;  2CFL A;  5D82 A;  4BTY A;  1AVL A;  2SBL A;  1A2K A;  2XGL A;  3DGM A;  3HK4 A;  3EC9 A;  3NM2 A;  3SVA A;  1OAC A;  5IG3 A;  1LXE A;  1B3S A;  1G02 A;  2H0H A;  4EXR A;  1CH0 A;  1C54 A;  3NX0 A;  3DUK A;  1X1Y A;  3AMO A;  3SLU A;  1RDS A;  1VQP 3;  1I0V A;  1JB5 A;  9RNT A;  1NB5 I;  1KSI A;  1B2M A;  4ILF A;  2IMJ A;  1YVB I;  1DMM A;  3ZG0 A;  2CIU A;  4IIA A;  4STD A;  1OHS A;  4EBG A;  1PYL A;  4XBX A;  4MMY B;  1BUQ A;  1VQ9 3;  1OHO A;  1GOU A;  1W6C A;  2WOF A;  3AHW A;  3BND A;  3CMA 3;  5BU4 A;  1WMO A;  2F98 A;  4FMD A;  1BUJ A;  1SII A;  1DVC A;  1AVK A;  3D79 A;  3DGO A;  3UJM A;  2OQE A;  4FMB A;  1BIR A;  1W7C A;  1GMQ A;  1HKX A;  2H0I A;  1ROV A;  5AIH A;  1QMA A;  4O3V A;  4GL6 A;  1I2G A;  1K8A 4;  1BSC A;  4BL2 A;  1GOY A;  4NHF A;  1IU7 A;  3I0Y A;  4J8T A;  3SX1 A;  3JVC A;  2OQE C;  1NDO B;  1MNL A;  1K28 A;  1JB4 A;  2XFS A;  3CPO A;  1BAO A;  1R4Y A;  3CME 3;  1NB3 I;  1W5Z A;  4J9A A;  1VQ6 3;  2RGQ A;  5RNT A;  1YIT 3;  1K73 4;  3GZX B;  1YJW 3;  1BSB A;  2V1L A;  1EG9 B;  4R4K A;  1B21 A;  4HM5 B;  3CCU 3;  2UX0 A;  3ROB A;  3Q1C A;  2JDI H;  4RNZ A;  3Q2P A;  4N6N B;  1UCJ A;  3KE7 A;  3LML A;  1OF5 B;  3UNL A;  3I55 3;  1M9G A;  1E3V A;  3NQY A;  5AI1 A;  3HI7 A;  2P09 A;  4OK0 A;  1QAF A;  1FGM A;  4I5Q A;  1RGE A;  2W9P A;  4GSP A;  3BLZ A;  5EQL A;  4KFD A;  1FGT A;  2XR8 B;  4JF8 A;  2E2U A;  2YFI B;  3EE1 A;  1R4C A;  2HMO B;  1YJN 3;  3NUV A;  3NV0 B;  1QVF 2;  2GEX A;  5D83 A;  5ELJ A;  1YNV X;  2UUG C;  2OOV C;  3X41 A;  4HAA A;  3KN4 A;  1UCI A;  2HML B;  1IQX A;  2RFR A;  4X2O A;  1STF I;  1W4N A;  3MWZ A;  1N8R 4;  3BIR A;  1OGZ A;  1YVS A;  2BMR B;  1UUW B;  2GU1 A;  4WYK A;  3EX9 A;  4FMC A;  1TUH A;  3QK9 A;  4HM3 B;  3V98 A;  3S29 A;  3EQQ B;  2AAE A;  3BNB A;  5JPU A;  2XH9 A;  1BSD A;  4KT3 B;  3CCQ 3;  2O3O A;  5M19 A;  1D6Z A;  5IEO A;  2GEY A;  1RTU A;  4OUQ A;  4FCZ A;  1ASK A;  3NBR A;  1BNE A;  3PS8 A;  1JRQ A;  1AY7 A;  1FGQ A;  3D5I A;  2F4Y A;  1GMR A;  8RNT A;  1M1X B;  3FF2 A;  3LTD A;  1WNH A;  2KF3 A;  1O7G B;  4HM6 B;  3TDG A;  1BRN L;  1S5A A;  4FCJ A;  3G4S 3;  3S27 A;  1W02 A;  1MOL A;  1UW1 A;  3MSO A;  1UI7 A;  1ZO2 A;  4IT7 A;  4WYK B;  2GBW B;  2B1X B;  3DGN A;  1BRJ A;  3MHE A;  5G1K A;  5AII A;  1MGR A;  1BGS A;  3CCJ 3;  2Y74 A;  1BAN A;  1OPY A;  4R80 A;  1O7N B;  4HBR A;  2QA4 3;  2CK3 H;  1JN5 B;  1FGO A;  1ZX2 A;  2QGU A;  4FCM A;  1YIJ 3;  2P0X A;  1MWT A;  3K0Z A;  5IF6 A;  3DGY A;  3E99 A;  4R9L A;  1RNB A;  1JBR A;  4BIR A;  1WMP A;  1NJI 4;  5IER A;  5IG4 A;  2K3D A;  3CU3 A;  1W2B 2;  4KVH A;  3EBY A;  2WGQ A;  1RGA A;  1BOX A;  1SAR A;  1E97 A;  4RBN A;  1BNG A;  4NPB A;  2F99 A;  1V58 A;  2CFD A;  1N8Q A;  5FGO A;  3PYJ A;  4BTW A;  3BNC A;  4QWT A;  2BO9 B;  3RGR A;  3GZB A;  5CLK A;  3HII A;  3G16 A;  4BL3 A;  2MC8 A;  1UCL A;  3KZT A;  3HIG A;  3PZW A;  3RNT A;  1GYB A;  3CC7 3;  3CCE 3;  1YJ9 3;  1YGW A;  5CXO A;  1L5G B;  2FNQ A;  3U97 A;  2CX0 A;  3FG3 A;  2Z76 A;  2GSP A;  1RCK A;  3LH4 A;  1I3I A;  1OHP A;  2Y73 A;  3M8C A;  1DVD A;  2INX A;  1STD A;  5DRV A;  1BRG A;  5M1A A;  1UCK A;  3B7C A;  1BNS A;  1O7M B;  2F86 B;  2W9Q A;  3F8X A;  3DMC A;  2GXF A;  2F5W A;  6STD A;  3F7X A;  4FMA A;  3CD6 3;  1V57 A;  2BT3 A;  2WGO A;  4X2H A;  3OWY A;  3SYU A;  1JBT A;  5AEW B;  3NHX A;  1YGE A;  1LQM B;  3FLJ A;  5HOH A;  1UDI I;  1TJD A;  1SIH A;  1B27 A;  1DMQ A;  2FGT A;  1SQW A;  2M7O A;  2RSX A;  4HM7 B;  4KZ1 A;  4RNT A;  3MYT A;  4RZM A;  5G1L A;  7RNT A;  1B2S A;  1MWS A;  1OF5 A;  2D1W A;  3WR2 A;  5IW9 A;  2KRT A;  3A76 A;  3LTC A;  1BNF A;  2PZV A;  2IUJ A;  1JV2 B;  1UUV B;  3AGO A;  3FCS B;  2XSO B;  5G2G A;  3MG2 A;  3D3L A;  4O2H A;  2D42 A;  1G0T A;  1VQ4 3;  2LYX A;  1RGG A;  3FSD A;  4HM1 B;  1OUN A;  2W6J H;  3OX9 A;  2K0M A;  3KSE D;  3CCR 3;  3NV0 A;  1AV4 A;  1NU3 A;  3UL6 A;  3VF1 A;  4CJN A;  1RN7 A;  2KAA A;  5I97 A;  1ZS7 A;  3MG1 A;  2F5M A;  3G71 3;  3NQZ A;  3KKG A;  2O9U X;  4HOH A;  3SOY A;  2BHM A;  4GHO A;  1IT7 A;  2BU4 A;  3T8U A;  2W0Q A;  3N8B A;  3CPW 2;  1Q9E A;  2GU3 A;  1U8C B;  1IVV A;  1LOY A;  3EF8 A;  1IV9 A;  1TTO A;  2R41 A;  1BRK A;  2CC3 A;  2YFL B;  3DY5 A;  1BNR A;  2KF4 A;  1TU5 A;  4LGQ A;  1CQS A;  1DYU A;  1W6Y A;  3KII A;  1JZO A;  3PXM A;  4L7K A;  4R9K A;  5BXQ A;  3CCL 3;  1Q40 B;  1TIJ A;  1M1K 4;  1UI8 A;  1EQK A;  1BSE A;  2ZA4 A;  2ML5 A;  2OOV A;  2RCD A;  4O02 B;  3S5C A;  1CYV A;  1RLS A;  1PU4 A;  2OTJ 3;  5DRE A;  2CKF B;  3X42 A;  2Z7A A;  3UB1 A;  3F40 A;  3F9S A;  4CCV A;  5LC6 A;  3FZW A;  5ELU A;  1IVX A;  3LTB A;  3DM8 A;  4HM8 B;  1VQQ A;  1VZZ A;  4GB5 A;  1RGL A;  2XSH B;  4JRF A;  5AYS C;  6GSP A;  1BSA A;  2HMN B;  2OWP A;  3CCV 3;  2P38 A;  1K9M 4;  4H3U A;  1D6Y A;  1Q82 4;  2ZDJ A;  1VQM 3;  1JZD A;  3FG4 A;  4EYC A;  1NO3 A;  4K90 B;  6RNT A;  3OV4 A;  3JUM A;  2AAD A;  5JPP A;  3F7S A;  1VQO 3;  3JUP A;  1NWW A;  1RHL A;  1CYU A; 
#chains in the Genus database with same CATH homology
 3DZL A;  2OTL 3;  4K1V A;  3F8H A;  3STD A;  1JN5 A;  4HM4 B;  1YHQ 3;  1TP6 A;  5STD A;  2CHC A;  5AEU B;  2MF7 A;  1M90 4;  3SOA A;  3CNX A;  3NM7 A;  4K61 A;  1KC8 4;  1FUW A;  8CHO A;  4FR9 A;  2W03 A;  4ORL A;  3GWR A;  5BVB A;  1VQK 3;  3X3X A;  3DXO A;  5HGR A;  5A0O B;  5KP1 A;  2IUK A;  3IMA B;  1TFK A;  3GZR A;  5EEO A;  1JJ2 2;  2IA7 A;  3RDE A;  3LOY A;  3WOF B;  4EV2 A;  3CC2 3;  1OCV A;  1VQ5 3;  3WA3 A;  3FG1 A;  3WOD G;  1U5O A;  2I9W A;  2C11 A;  2ML6 A;  4HJL B;  3G8Z A;  2KCD A;  3Q90 A;  3SED A;  2HMM B;  1VQL 3;  1IK3 A;  4LEH A;  2C10 A;  1W2Z A;  2CFW A;  1C7H A;  1Q42 A;  1TFO A;  2XF3 A;  3B4O A;  4G1M B;  1VQ7 3;  4HVN A;  1EA2 A;  2STD A;  4XDW A;  2HMJ B;  3FF0 A;  3T0U A;  4BTX A;  3G0K A;  3ECF A;  1PFP A;  1OGX A;  3NXJ A;  4I4K A;  2QEX 3;  1QVG 2;  4HM2 B;  5CF1 A;  1WQL B;  4ZM8 A;  2Z6B A;  3PGB A;  2Q07 A;  2QIY A;  1IV7 A;  3LT9 A;  4L8O A;  2CG0 A;  4HYZ A;  1Q7Y 4;  4XM4 A;  4MJD A;  4N6L A;  3K9M C;  3GZY B;  2XGN A;  4WWU C;  1JKG B;  3OWU A;  3I56 3;  2W56 B;  2CW9 A;  3ER7 A;  4MMZ B;  1J2B A;  1JNQ A;  1JB2 A;  4HZ9 B;  3FGY A;  1Z1S A;  2ZL8 A;  3N54 B;  4N6U A;  5JBS A;  3GAX A;  3WOE B;  3JUQ A;  1Q81 4;  1N9E A;  3X3Z A;  5CF2 A;  2P05 A;  1US1 A;  3FKA A;  1K41 A;  3BNE A;  2HMK B;  2L4V A;  1KWI A;  1ROA A;  4N6V 0;  2CWT A;  4AKY A;  1IQ8 A;  2YX9 A;  2CFG A;  4WP5 A;  5KP4 A;  1Q40 A;  3K5T A;  3MKI A;  3OWS A;  3B8L A;  5TGN A;  5AIF A;  3SXX A;  2WOH A;  3CNM A;  4AEQ A;  1QAK A;  2BNG A;  3LTA A;  1GY5 A;  3VSY A;  4N6M A;  1GY7 A;  3CCS 3;  4N6T A;  3V92 A;  2W04 A;  1VQN 3;  2E2V A;  4OVM A;  3O8Y A;  4CDL A;  1SJW A;  5IG5 A;  4MMX B;  3J7Y d;  1IQY A;  1CEW I;  3N9H A;  4Q53 A;  2CG1 A;  1QJG A;  1GY6 A;  3VGN A;  3CXC 2;  1EKM A;  4K1U A;  4LMI A;  5CK6 A;  5EVH A;  3NBJ A;  1FGR A;  4PEJ A;  3KSP A;  3X40 A;  4AKZ A;  2R4I A;  1D6U A;  3S67 A;  3AMO B;  1LNH A;  3MG3 A;  1YI2 3;  1O7P B;  3LYG A;  1GS3 A;  1RJO A;  1KD1 4;  3K7C A;  4KFF A;  1OH0 A;  4LSO A;  1IT8 A;  3JUO A;  1IVW A;  2OCT A;  2PNC A;  4XBT A;  4O8S A;  1E3R A;  5FW5 A;  1VQ8 3;  2P0M A;  4HZB B;  2BMQ B;  2BMO B;  1DMN A;  2FXT A;  3EN8 A;  3DGL A;  3WMD A;  1Q86 4;  5IEN A;  3T8N A;  7STD A;  4MEI A;  5D81 A;  3H3H A;  3X3Y A;  3EBT A;  3HZP A;  2YFJ B;  3LZA A;  2XFT A;  5IG0 A;  3CC4 3;  3ALA A;  1KQS 2;  1IVU A;  3B4P A;  4WFO A;  1A2V A;  1HU9 A;  4RNY A;  3EB8 A;  3HX8 A;  4KFE A;  1F8N A;  3PCS A;  4R1K A;  3FH1 A;  4LZI A;  1AR0 A;  1GD3 A;  1W01 A;  4WHA A;  3OW2 2;  4XDV A;  1WTH A;  1S72 3;  1LVN A;  3S28 A;  2KXG A;  2CH9 A;  3IJE B;  3EHC A;  4EC6 A;  1IDP A;  4HKV B;  3IPT A;  2XEP A;  3UL5 A;  5AIG A;  1A67 A;  2GBX B;  2CWU A;  2CFK A;  3WDG B;  4U13 A;  3LT8 A;  3V99 A;  1RRH A;  1JKG A;  3QRD A;  2WO0 A;  1N5P A;  3G6E 3;  3L0R A;  2W56 A;  4EV5 A;  1SPU A;  5KP3 A;  2XRX B;  2W2C A;  2Z77 A;  3K63 A;  3LXU X;  4N6O B;  1ISK A;  3OXA A;  3BB9 A;  3GRD A;  5LC7 A;  3U1W A;  4H61 A;  3PCR A;  1N9J A;  3EN1 B;  1FA3 A;  3NBB A;  1N5H A;  2B24 B;  2CWV A;  1Y4K A;  3WA2 X;  2A15 A;  3EJV A;  1W00 A;  3JUN A;  1RRL A;  3H51 A;  4IPB A;  1QAL A;  2E2T A;  3KFQ C;  1ULJ B;  4XB5 A;  3CCM 3;  4L8P A;  2K54 A;  1ULI B;  1T5Y A;  4HM0 B;  4NRE A;  4N3V A;  3RGA A;  1A90 A;  1GD4 A;  1LOX A;  3D9R A;  1W6G A;  2LQV A;  2JQ5 A;  1WMN A;  1G96 A;  4XBY A;  5IEP A;  1RKY A;  3F14 A;  5AYR B;  1O7H B;  1V74 A;  4TX4 A;  3MPH A;  1O7W B;  2CFL A;  5D82 A;  4BTY A;  1AVL A;  2SBL A;  1A2K A;  2XGL A;  3DGM A;  3HK4 A;  3EC9 A;  3NM2 A;  3SVA A;  1OAC A;  5IG3 A;  1LXE A;  4EXR A;  3NX0 A;  3DUK A;  3AMO A;  3SLU A;  1VQP 3;  1NB5 I;  1JB5 A;  1KSI A;  2IMJ A;  1YVB I;  1DMM A;  2CIU A;  4IIA A;  4STD A;  1OHS A;  4EBG A;  4XBX A;  4MMY B;  1BUQ A;  1VQ9 3;  1OHO A;  1W6C A;  2WOF A;  3BND A;  3CMA 3;  1WMO A;  2F98 A;  4FMD A;  1SII A;  1DVC A;  1AVK A;  3DGO A;  3UJM A;  2OQE A;  4FMB A;  1W7C A;  1HKX A;  1ROV A;  5AIH A;  1QMA A;  4O3V A;  4GL6 A;  1K8A 4;  4NHF A;  1IU7 A;  3I0Y A;  4J8T A;  3SX1 A;  3JVC A;  2OQE C;  2XFS A;  1MNL A;  1K28 A;  1JB4 A;  1NDO B;  3CPO A;  3CME 3;  1NB3 I;  1W5Z A;  4J9A A;  1VQ6 3;  2RGQ A;  1YIT 3;  1K73 4;  3GZX B;  1YJW 3;  2V1L A;  1EG9 B;  4R4K A;  4HM5 B;  3CCU 3;  2UX0 A;  3ROB A;  3Q1C A;  2JDI H;  4RNZ A;  3Q2P A;  4N6N B;  3KE7 A;  3LML A;  3I55 3;  1OF5 B;  3UNL A;  1M9G A;  1E3V A;  3NQY A;  5AI1 A;  3HI7 A;  2P09 A;  4OK0 A;  1QAF A;  1FGM A;  2W9P A;  5EQL A;  3BLZ A;  4KFD A;  1FGT A;  2XR8 B;  4JF8 A;  2E2U A;  2YFI B;  3EE1 A;  1R4C A;  2HMO B;  1YJN 3;  3NUV A;  3NV0 B;  1QVF 2;  2GEX A;  5D83 A;  5ELJ A;  2OOV C;  3X41 A;  3KN4 A;  2HML B;  1IQX A;  2RFR A;  4X2O A;  1STF I;  1W4N A;  3MWZ A;  1N8R 4;  1OGZ A;  2BMR B;  1UUW B;  2GU1 A;  4WYK A;  3EX9 A;  4FMC A;  1TUH A;  3QK9 A;  4HM3 B;  3V98 A;  3S29 A;  3EQQ B;  3BNB A;  5JPU A;  2XH9 A;  3CCQ 3;  2O3O A;  1D6Z A;  5IEO A;  2GEY A;  4OUQ A;  4FCZ A;  1ASK A;  3NBR A;  3PS8 A;  1JRQ A;  1FGQ A;  1M1X B;  3FF2 A;  3LTD A;  1WNH A;  1O7G B;  4HM6 B;  3TDG A;  1S5A A;  4FCJ A;  3G4S 3;  3S27 A;  1W02 A;  1MOL A;  1UW1 A;  3MSO A;  1UI7 A;  1ZO2 A;  4IT7 A;  4WYK B;  2GBW B;  2B1X B;  3DGN A;  3MHE A;  5AII A;  3CCJ 3;  2Y74 A;  1OPY A;  4R80 A;  1O7N B;  4HBR A;  2QA4 3;  2CK3 H;  1JN5 B;  1FGO A;  1ZX2 A;  2QGU A;  4FCM A;  1YIJ 3;  2P0X A;  3K0Z A;  5IF6 A;  3E99 A;  4R9L A;  1WMP A;  1NJI 4;  5IER A;  5IG4 A;  1W2B 2;  3CU3 A;  4KVH A;  3EBY A;  2WGQ A;  1E97 A;  4RBN A;  5FGO A;  2F99 A;  2CFD A;  4BTW A;  1N8Q A;  3PYJ A;  3BNC A;  4QWT A;  2BO9 B;  3RGR A;  3GZB A;  5CLK A;  3HII A;  3G16 A;  2MC8 A;  3KZT A;  3HIG A;  3PZW A;  1GYB A;  3CC7 3;  3CCE 3;  1YJ9 3;  5CXO A;  1L5G B;  2FNQ A;  3U97 A;  3FG3 A;  2Z76 A;  3LH4 A;  3M8C A;  1OHP A;  2Y73 A;  1DVD A;  2INX A;  1STD A;  5DRV A;  3B7C A;  2W9Q A;  1O7M B;  2F86 B;  3F8X A;  3DMC A;  2GXF A;  6STD A;  3F7X A;  4FMA A;  3CD6 3;  2WGO A;  2BT3 A;  4X2H A;  3OWY A;  5AEW B;  3NHX A;  1YGE A;  3FLJ A;  1SIH A;  1DMQ A;  2FGT A;  2M7O A;  1SQW A;  2RSX A;  4HM7 B;  4KZ1 A;  4RZM A;  3MYT A;  1OF5 A;  2D1W A;  5IW9 A;  2KRT A;  3A76 A;  3LTC A;  2PZV A;  2IUJ A;  1JV2 B;  1UUV B;  3FCS B;  2XSO B;  5G2G A;  3MG2 A;  3D3L A;  4O2H A;  2D42 A;  1VQ4 3;  2LYX A;  3FSD A;  4HM1 B;  1OUN A;  2W6J H;  3OX9 A;  2K0M A;  3KSE D;  3CCR 3;  3NV0 A;  1AV4 A;  1NU3 A;  3UL6 A;  3VF1 A;  1RN7 A;  5I97 A;  3MG1 A;  3G71 3;  3NQZ A;  3KKG A;  2O9U X;  3SOY A;  2BHM A;  1IT7 A;  3T8U A;  2W0Q A;  3N8B A;  3CPW 2;  2GU3 A;  1U8C B;  1IVV A;  3EF8 A;  1IV9 A;  2CC3 A;  2YFL B;  3DY5 A;  1TU5 A;  4LGQ A;  1CQS A;  1DYU A;  1W6Y A;  3KII A;  3PXM A;  4L7K A;  4R9K A;  5BXQ A;  3CCL 3;  1Q40 B;  1TIJ A;  1M1K 4;  1UI8 A;  1EQK A;  2ML5 A;  2OOV A;  2RCD A;  4O02 B;  3S5C A;  1CYV A;  1PU4 A;  2OTJ 3;  5DRE A;  2CKF B;  3X42 A;  2Z7A A;  3UB1 A;  3F40 A;  3F9S A;  4CCV A;  5LC6 A;  3FZW A;  5ELU A;  1IVX A;  3LTB A;  3DM8 A;  4HM8 B;  1VZZ A;  4GB5 A;  2XSH B;  4JRF A;  5AYS C;  2HMN B;  2OWP A;  3CCV 3;  2P38 A;  1K9M 4;  4H3U A;  1D6Y A;  1Q82 4;  2ZDJ A;  1VQM 3;  3FG4 A;  4EYC A;  1NO3 A;  4K90 B;  3OV4 A;  3JUM A;  5JPP A;  3F7S A;  1VQO 3;  3JUP A;  1NWW A;  1CYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...