4OUQA

Crystal structure of a duf4783 family protein (bf1468) from bacteroides fragilis ych46 at 1.55 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
105
Chain Sequence
b'DIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLAAFFSSNKVSGFNVNHEGKRDSSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF1468) from Bacteroides fragilis YCH46 at 1.55 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 30
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2014-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ouqA00
1JN5A 3EC9A 3OV4A 5AIGA 3DZLA 3MG2A 5CF2A 4HM2B 1OGZA 4X2HA 4J8TA 8CHOA 1Q40A 3VSYA 4HM1B 3EN1B 4XB5A 1ISKA 1GY6A 3MYTA 1OF5A 4R9KA 4H3UA 4L8PA 1SJWA 5CF1A 5IG0A 1W02A 3UNLA 1OHOA 3MG1A 3E99A 4XBXA 1ZX2A 5JPUA 4X2OA 5IENA 1E3VA 3CU3A 2YFJB 3G0KA 1UUWB 3KZTA 3MKIA 3B4PA 3NUVA 3MHEA 1UUVB 4XBTA 2RFRA 2XSOB 3EBYA 2HMNB 2B24B 3F8HA 4XDWA 4L8OA 5KP3A 3EN8A 2BMRB 3NHXA 3FZWA 2R4IA 4XBYA 3G8ZA 4PEJA 5AIHA 2XSHB 3G16A 1O7GB 2XR8B 4FCMA 3IPTA 4R9LA 3JUPA 2INXA 2BMOB 2STDA 3F8XA 5AIFA 5JPPA 5D83A 1K41A 1DMQA 1QJGA 2A15A 2HMLB 5EVHA 1E3RA 4HVNA 3FF0A 1VZZA 1ZO2A 5CK6A 4J9AA 2UX0A 1DMMA 3CPOA 3CNXA 1IDPA 6STDA 3FF2A 2HMOB 5DREA 4LEHA 4HZBB 2GEXA 3CNMA 3EQQB 3B8LA 3JUNA 2BNGA 3F40A 3OXAA 1BUQA 1JB2A 1WQLB 3GRDA 3LZAA 3OX9A 2YFLB 5TGNA 1TUHA 2HMMB 2Z76A 5IERA 2I9WA 3FLJA 5IG5A 2JQ5A 3ECFA 4WWUC 4HZ9B 1OHPA 5CLKA 3F9SA 4OUQA 4HM4B 4L7KA 4WP5A 3SOYA 1TP6A 1ULJB 4HM3B 3LYGA 2QGUA 2GBXB 1NWWA 1W00A 1E97A 3BLZA 1A2KA 4HJLB 3SOAA 1JB4A 1QMAA 5AI1A 1OHSA 3ER7A 3EBTA 1AR0A 5CXOA 1JKGB 5DRVA 3B4OA 3GZBA 1GY5A 1DMNA 4HM6B 3WMDA 3K0ZA 1OH0A 1OPYA 3SEDA 2K54A 5KP4A 3JUQA 2Z7AA 2F99A 3NM2A 4K1VA 3FGYA 1OUNA 3NXJA 4FCJA 3HX8A 5AEWB 5IG4A 1GY7A 3MSOA 4HM7B 4K1UA 3DUKA 5IEOA 5AEUB 4HKVB 3FH1A 4MJDA 4IIAA 4HM0B 2PZVA 4OVMA 1S5AA 3NBRA 2GXFA 1O7HB 4CDLA 4HM5B 3H3HA 4I4KA 3H51A 2RCDA 5BVBA 1OCVA 2HMKB 2QIYA 1EA2A 3RGRA 4XDVA 3RGAA 1Q42A 3BB9A 1CQSA 1GYBA 3A76A 5IG3A 3VGNA 1U5OA 5IF6A 5IEPA 3OWUA 3OWSA 2F86B 3T8NA 4GB5A 4LMIA 2GEYA 3GZRA 3KSPA 1W01A 3I0YA 1JKGA 2W2CA 1JN5B 2OWPA 3MG3A 2B1XB 3Q90A 3T8UA 1O7PB 1ASKA 2XRXB 4XM4A 1ULIB 1Q40B 3FKAA 3STDA 2RGQA 3EJVA 1W6YA 1OF5B 3KE7A 4LGQA 3DXOA 3M8CA 4N3VA 3OWYA 1O7NB 4STDA 3S5CA 5KP1A 3HK4A 3GZYB 1Z1SA 3KKGA 5HGRA 2YFIB 5STDA 1JB5A 2HMJB 1HKXA 4ORLA 3FSDA 3DMCA 3NV0A 3EX9A 2BMQB 5BXQA 1OGXA 2Z77A 4KVHA 4HM8B 3JUOA 5AIIA 3GWRA 4WYKA 1C7HA 1NU3A 1O7WB 3EHCA 4RZMA 7STDA 3F7XA 5G2GA 2F98A 4U13A 3F7SA 3NV0B 5D81A 3K7CA 3UJMA 3B7CA 2CHCA 5D82A 3D9RA 3EF8A 5FW5A 4R1KA 2GBWB 2IMJA 4Q53A 1EG9B 4WYKB 3F14A 3DM8A 2CKFB 1O7MB 1GS3A 3HZPA 3JUMA 1STDA 3GZXB 3ROBA 1NDOB
chains in the Genus database with same CATH superfamily
3NX0A 1IQXA 1JN5A 1T5YA 1G96A 1X1YA 3EC9A 3OV4A 1UI7A 1JJ22 1A2PA 2C11A 1YIJ3 3IMAB 1Q824 1B20A 1DE3A 1BRGA 3CC43 3PGBA 1FUSA 4MMZB 5AIGA 3DZLA 3MG2A 4FMBA 3CCR3 5CF2A 4HM2B 1OGZA 4X2HA 2C4BA 2QEX3 4J8TA 1KQS2 8CHOA 1IT8A 3PCSA 1Q40A 3VSYA 3OW22 1UDII 4HM1B 2WOFA 3AHWA 3EN1B 4XB5A 1GY6A 4H61A 1ISKA 3MYTA 4HAAA 3VF1A 1OF5A 4O2HA 4R9KA 3S29A 3NQZA 4H3UA 1BNJA 3CD63 1WMOA 4L8PA 1BVIA 3L0RA 1SJWA 5CF1A 1TRQA 5ELJA 1RGLA 3WDGB 1RRLA 5IG0A 2CFWA 1W02A 2Y74A 4EC6A 3UNLA 2CX1A 1OHOA 3MG1A 1MWSA 3E99A 3D5IA 5RNTA 2CFGA 4XBXA 2CW9A 1BSAA 1TRPA 1ZX2A 5JPUA 4RBNA 1FGRA 3I563 4X2OA 1RGFA 1RCLA 2BT3A 5IENA 1E3VA 3CU3A 1Q814 3BNBA 3D3LA 2YFJB 3G0KA 1BRKA 1RRHA 1UUWB 3KZTA 1VQ83 3AHSA 1TFOA 3MKIA 2ZL8A 1IYYA 2P05A 4N6TA 3B4PA 3NUVA 3MHEA 1UUVB 2WOHA 1N8R4 6GSPA 1QALA 3ZG5A 4XBTA 3X40A 2RFRA 1BNEA 2XSOB 3EBYA 2HMNB 3WA2X 1PU4A 2B24B 2Z6BA 3F8HA 3K63A 2OQEC 2QA43 4EV2A 1MGRA 4XDWA 3RDEA 2ML6A 4L8OA 5KP3A 4BTYA 3EN8A 2BMRB 4WHAA 2H0IA 3NHXA 3FZWA 1SPUA 2R4IA 1GSPA 2CH9A 1MOLA 1Q7HA 4XBYA 3G8ZA 4PEJA 1RGKA 1V58A 5AIHA 2IYJA 2XSHB 2D1WA 1RNTA 3G16A 2CC3A 1O7GB 2XR8B 4FCMA 1J2BA 4O8SA 3CCJ3 3IPTA 2SARA 1C54A 5EEOA 4R9LA 4AEQA 1U8CB 3X3YA 3SYUA 3JUPA 3PXMA 1RTUA 1UCIA 2INXA 4AKYA 2BMOB 4MMXB 1JBSA 2IY2A 3WOFB 2W04A 2STDA 1WMPA 2KXGA 4N6LA 1L5GB 3D5GA 8RNTA 2OTJ3 1LOYA 5IW9A 3F8XA 3J7Yd 1B2SA 4CCVA 2XGLA 5AIFA 5JPPA 3U1WA 3CCL3 4IPBA 2WGQA 1RGAA 1N5PA 5D83A 1VQN3 4FMCA 1K41A 1YHQ3 2F56A 2FXTA 3UB1A 1DMQA 1BSCA 1FGTA 1X1UA 3MPHA 2GU3A 5ELUA 2ML5A 5LC6A 3S27A 1QJGA 1QVF2 1GOUA 2A15A 1CH0A 2Q07A 3HIGA 2HMLB 1A90A 4GL6A 5EVHA 1V57A 1HYFA 4RNYA 1E3RA 3SX1A 4BU4A 3BIRA 4HVNA 1IVUA 1OACA 3FF0A 4BL2A 3CXC2 1M904 1VZZA 1ZO2A 4JRFA 5CK6A 1RHLA 2XEPA 4J5GA 4J9AA 3TDGA 1VQO3 1HU9A 2UX0A 2XF3A 4I5QA 1TU5A 1DMMA 3G4S3 1EKMA 3LMLA 2BIRA 2P09A 2W0QA 3HI7A 1VQ43 3X41A 3CCS3 4EBGA 3CPOA 3O8YA 3CNXA 1IDPA 1VQ93 6STDA 3N8BA 3FF2A 1IK3A 3DGMA 2HMOB 5DREA 3LTBA 2XFTA 2W9PA 1JRQA 4GSPA 4HZBB 4LEHA 1EQKA 4KFEA 1VQ63 1RGGA 2GEXA 3CNMA 1M1K4 3JVCA 3EQQB 3FG4A 3B8LA 1PFPA 2KF4A 3JUNA 2BNGA 1LOXA 3F40A 1GMRA 3OXAA 1BUQA 2H0HA 1G02A 1JB2A 4BTXA 1WQLB 2PNCA 3GRDA 2ZA4A 1YGWA 1FUTA 2CIUA 2XFSA 3PYJA 1QVG2 2AAEA 4O3VA 3WOEB 3LZAA 1X1XA 2KCDA 1I2FA 3OX9A 2RBIA 1YJN3 3DGOA 2OTL3 1ZS7A 4KFDA 3X42A 4WFOA 2YFLB 3CCU3 1K9M4 1FGQA 5TGNA 1I2EA 5GSPA 1TUHA 3CCM3 1BNFA 2HMMB 2HOHA 5EQLA 2Z76A 5IERA 1BRHA 2I9WA 1NO3A 3FLJA 3KN4A 5IG5A 1I70A 2JQ5A 3ECFA 4WWUC 1JV2B 4HZ9B 1OHPA 5CLKA 5AYRB 3MWZA 1RGCA 3Q2PA 3F9SA 1UUGB 3IJEB 1IU7A 1NNVA 3HIIA 3FCSB 2RNTA 3LT9A 4HM4B 4OUQA 2FNQA 4L7KA 4MMYB 1LRAA 4WP5A 1B2MA 3FG3A 1TP6A 1YNVX 3SOYA 4EV5A 1ULJB 1BUJA 1B2UA 3NM7A 1BRJA 1W6CA 2QGUA 3LYGA 2GBXB 4HM3B 1LNIA 1ROAA 1NWWA 1W00A 1E97A 1UCKA 3BLZA 4N6OB 3FG1A 1W5ZA 3V92A 2KF5A 2IA7A 1A2KA 3KFQC 4HJLB 3SOAA 1JB4A 1QMAA 3CPW2 2JDIH 2GSPA 4IT7A 1MWRA 3G6E3 5AI1A 3X3ZA 1IV7A 1A67A 1OHSA 1ROVA 2F5WA 3ER7A 1RCKA 1AR0A 3EBTA 2KF6A 1VQ53 1JBRA 5CXOA 1BNRA 1JKGB 1B3SA 4FCZA 5DRVA 3LH4A 3B4OA 3GZBA 1GY5A 2YX9A 1DMNA 4HM6B 5FGOA 1LVNA 2FGTA 1BIRA 1IVVA 2P38A 1YVSA 3BNEA 3K0ZA 4N6NB 3S28A 3K9MC 1JZOA 2CG1A 1OH0A 3WR2A 1FA3A 4HBRA 1OPYA 3SEDA 1LOVA 3DY5A 1AV4A 1GD3A 3SLUA 3WMDA 1NB3I 1KWIA 2K54A 2ZHXB 7RNTA 4ZM8A 1VQK3 5KP4A 1I3IA 2W56B 1WMNA 5G1LA 2IUKA 2Z7AA 3JUQA 4NHFA 3WODG 1IVXA 3LT8A 1YIT3 1BU4A 2F99A 3NM2A 1W4NA 1UCJA 3AMOB 3V98A 1D6ZA 2BU4A 4K1VA 3FGYA 4EW5A 2KF3A 1OUNA 3NXJA 3I553 1LXEA 3KCHA 3GSPA 2CFKA 2UUGC 4FCJA 3UL6A 3HX8A 1TJDA 1IT7A 5AEWB 4DKIA 5IG4A 1GY7A 3MSOA 2W9QA 3DGYA 4HM7B 5BU4A 4K1UA 3DUKA 3BNCA 1VQ73 1RNBA 5IEOA 1W6GA 5AEUB 4FMAA 4HKVB 2R41A 3FH1A 3PZWA 4MJDA 1S723 4IIAA 4HM0B 2P0XA 1BRIA 2PZVA 1IV9A 1UGIA 4OVMA 1T2IA 1S5AA 2K3DA 3URPA 1IQYA 1UGHI 2V1LA 3NBRA 3NBJA 2GXFA 3CC73 3CCE3 1K28A 2BHMA 2CK3H 1GMPA 1RLSA 1W2B2 1EUIC 1G0TA 1KSIA 1WNHA 4KT3B 1AVLA 1O7HB 4NREA 4CDLA 3CME3 4HM5B 3DGNA 3H3HA 3PS8A 1I3FA 1VQP3 2CWUA 1N5HA 2MC8A 1RMSA 1BGSA 1TFKA 1DVDA 4QWTA 3LXUX 4I4KA 3AGNA 3H51A 1YI23 1I0XA 1BAOA 4BTWA 2RCDA 1SIIA 2RSXA 5BVBA 2H0GA 3NQYA 5G1KA 2CWTA 2J8XB 3X3XA 1OCVA 2HMKB 2QIYA 1EA2A 1MWTA 3D79A 1T2HA 1BNSA 3BNDA 3PCRA 3RGRA 4XDVA 3WA3A 4CPKA 1RKYA 2SBLA 1Q42A 3BB9A 3RGAA 1DETA 4BIRA 1CQSA 1GYBA 3ZG0A 2WO0A 1PY3A 5M1AA 3A76A 2L1SA 4LYLB 1IVWA 1M9GA 4LZIA 2OOVA 4EYCA 5IG3A 4HYZA 1TIJA 5I97A 1KD14 3GAXA 3VGNA 1U5OA 5IF6A 5IEPA 1GMQA 2MF7A 1CYVA 3OWUA 1KC84 3OWSA 4GHOA 4O02B 2F4YA 1BRNL 2F86B 1N8QA 3T8NA 3CMA3 4GB5A 3LTCA 4NPBA 2KAAA 4AKZA 4LSOA 1JZDA 3LTAA 3S67A 4LMIA 2CX0A 1N9JA 1GOVA 1SARA 1W7CA 1WTHA 2OCTA 2GEYA 5LC7A 3GZRA 1B2ZA 1W01A 1Y4KA 3I0YA 3KSPA 1R4YA 4N6MA 1Q864 1JKGA 2W2CA 4FMDA 1JN5B 4N6UA 1FW7A 1UCLA 6RNTA 2OWPA 3MG3A 1BRSA 2B1XB 3Q90A 3N54B 2CWVA 1VQQA 1B2XA 2K0MA 3T8UA 1B27A 1YVBI 1R4CA 1O7PB 1RN1A 1EEJA 1ASKA 2L4VA 1I0VA 1FGOA 4MEIA 2E2VA 2XRXB 1FYSA 4XM4A 1ULIB 1Q40B 2W56A 1NB5I 1HZ1A 3A5EA 3FKAA 3QRDA 1K734 3STDA 2RGQA 3EJVA 3G713 1CEWI 2CG0A 4K61A 2W03A 4RNTA 1W6YA 1RJOA 3SXXA 1OF5B 2XGNA 3AMOA 3KE7A 3KSED 1I2GA 1MWUA 3T0UA 4LGQA 3DXOA 4EXRA 2E2TA 1ZGXA 1T3BA 3M8CA 3AGOA 1Q9EA 3CC23 4R80A 3ZFZA 4HOHA 1YJW3 3LTDA 2KRTA 4N3VA 2O9UX 3OWYA 1O7NB 1M1XB 1B21A 4STDA 2E2UA 3S5CA 1V74A 5KP1A 1AY7A 3HK4A 1US1A 1AVKA 2O3OA 3GZYB 2LYXA 2OQEA 3WHOA 1RN7A 3RNTA 1Z1SA 3V99A 2WGOA 3KKGA 1MNLA 5HGRA 1VQL3 2YFIB 1BOXA 2CFLA 1LQGC 1UW1A 5STDA 1NJI4 1JB5A 3UL5A 2HMJB 1UI8A 5M19A 1HKXA 4G1MB 4J5KA 3SVAA 1DVCA 2CFDA 3HOHA 5HOHA 4ILFA 4K90B 1VQM3 1AQZA 4KZ1A 4ORLA 4BL3A 5M18A 1BSEA 3FSDA 2GU1A 3K5TA 1RSNA 1SQWA 1FUWA 4KFFA 1Q7Y4 4CJNA 5AYSC 3DMCA 2IUJA 1D6UA 1SIHA 2Y73A 1BSDA 3NV0A 3EX9A 2BMQB 2XH9A 5BXQA 1FGMA 1RDSA 1LNHA 3ALAA 1FZUA 1OGXA 2Z77A 4KVHA 4R4KA 3CCV3 1W2ZA 4FR9A 1YJ93 1MGWA 2ZDJA 1I8VA 1A2VA 4HM8B 7GSPA 9RNTA 3JUOA 3EB8A 1RN4A 1BANA 3GWRA 2M7OA 4WYKA 5AIIA 1JBTA 1GOYA 1QAKA 3U97A 1C7HA 1NU3A 3Q1CA 1BNIA 1O7WB 3EHCA 1N9EA 4RZMA 3F7XA 7STDA 3BU4A 2LQVA 5G2GA 1BNGA 2F98A 5A0OB 1CYUA 4U13A 1JNQA 2D42A 3F7SA 1TTOA 3NV0B 5D81A 3K7CA 3UJMA 3DH2A 1LQMB 1BSBA 1GD4A 3B7CA 2CHCA 3CCQ3 2UGIA 1STFI 5D82A 3D9RA 3LOYA 3EF8A 1RGHA 2BO9B 5FW5A 3N9HA 4R1KA 3EE1A 1LOWA 2P0MA 1RGEA 1X1WA 3D4AA 4RNZA 2GBWB 2IMJA 3KIIA 4Q53A 1EG9B 4WYKB 1K8A4 3Q3FA 3QK9A 3F14A 4JF8A 3DM8A 4N6V0 4TX4A 3DGLA 2F5MA 2CKFB 5JBSA 1O7MB 2AADA 3NBBA 5BIRA 1GS3A 1IQ8A 3HZPA 1D6YA 2W6JH 3JUMA 1PYLA 2C10A 1DYUA 1F8NA 1STDA 2OOVC 3GZXB 3ROBA 4OK0A 1QAFA 1YGEA 1NDOB
chains in the Genus database with same CATH topology
3NX0A 1IQXA 1JN5A 1T5YA 1G96A 3EC9A 3OV4A 1UI7A 1JJ22 2C11A 1YIJ3 1Q824 3IMAB 3CC43 3PGBA 4MMZB 5AIGA 3DZLA 3MG2A 4FMBA 3CCR3 5CF2A 4HM2B 1OGZA 4X2HA 2QEX3 4J8TA 1KQS2 8CHOA 1IT8A 3PCSA 1Q40A 3VSYA 3OW22 4HM1B 2WOFA 3EN1B 4XB5A 1ISKA 1GY6A 4H61A 3MYTA 3VF1A 1OF5A 4O2HA 4R9KA 3S29A 3NQZA 4H3UA 3CD63 1WMOA 4L8PA 3L0RA 1SJWA 5CF1A 5ELJA 3WDGB 1RRLA 5IG0A 2CFWA 1W02A 2Y74A 4EC6A 3UNLA 1OHOA 3MG1A 3E99A 2CFGA 4XBXA 2CW9A 1ZX2A 5JPUA 4RBNA 1FGRA 3I563 4X2OA 2BT3A 5IENA 1E3VA 3CU3A 1Q814 3BNBA 3D3LA 2YFJB 3G0KA 1RRHA 1UUWB 3KZTA 1VQ83 1TFOA 3MKIA 2ZL8A 2P05A 4N6TA 3B4PA 3NUVA 3MHEA 1UUVB 2WOHA 1N8R4 1QALA 4XBTA 3X40A 2RFRA 2XSOB 3EBYA 3WA2X 2HMNB 1PU4A 2B24B 2Z6BA 3F8HA 3K63A 2OQEC 2QA43 4EV2A 4XDWA 3RDEA 2ML6A 4L8OA 5KP3A 4BTYA 3EN8A 2BMRB 4WHAA 3NHXA 3FZWA 1SPUA 2R4IA 2CH9A 1MOLA 4XBYA 3G8ZA 4PEJA 5AIHA 2XSHB 2D1WA 3G16A 2CC3A 1O7GB 2XR8B 4FCMA 1J2BA 4O8SA 3CCJ3 3IPTA 5EEOA 4R9LA 4AEQA 1U8CB 3X3YA 3JUPA 3PXMA 2INXA 4AKYA 2BMOB 4MMXB 3WOFB 2W04A 2STDA 1WMPA 2KXGA 4N6LA 1L5GB 2OTJ3 5IW9A 3F8XA 3J7Yd 4CCVA 2XGLA 5AIFA 5JPPA 3U1WA 3CCL3 4IPBA 2WGQA 1N5PA 5D83A 1VQN3 4FMCA 1K41A 1YHQ3 2FXTA 3UB1A 1DMQA 1FGTA 3MPHA 2GU3A 5ELUA 2ML5A 5LC6A 3S27A 1QJGA 1QVF2 2A15A 2Q07A 3HIGA 2HMLB 1A90A 4GL6A 5EVHA 4RNYA 1E3RA 3SX1A 4HVNA 1IVUA 1OACA 3FF0A 3CXC2 1M904 1VZZA 1ZO2A 4JRFA 5CK6A 2XEPA 4J9AA 3TDGA 1VQO3 1HU9A 2UX0A 2XF3A 1TU5A 1DMMA 3G4S3 1EKMA 3LMLA 2P09A 2W0QA 3HI7A 1VQ43 3X41A 3CCS3 4EBGA 3CPOA 3O8YA 3CNXA 1IDPA 1VQ93 6STDA 3N8BA 3FF2A 1IK3A 3DGMA 2HMOB 5DREA 3LTBA 2XFTA 2W9PA 1JRQA 4HZBB 4LEHA 1EQKA 4KFEA 1VQ63 2GEXA 3CNMA 1M1K4 3JVCA 3EQQB 3FG4A 3B8LA 1PFPA 3JUNA 2BNGA 1LOXA 3F40A 3OXAA 1BUQA 1JB2A 4BTXA 1WQLB 2PNCA 3GRDA 2CIUA 1QVG2 2XFSA 3PYJA 3WOEB 4O3VA 3LZAA 3OX9A 2KCDA 1YJN3 2OTL3 3DGOA 4KFDA 3X42A 4WFOA 2YFLB 3CCU3 1K9M4 1FGQA 5TGNA 1TUHA 3CCM3 2HMMB 5EQLA 2Z76A 5IERA 2I9WA 1NO3A 3FLJA 3KN4A 5IG5A 2JQ5A 3ECFA 4WWUC 1JV2B 4HZ9B 1OHPA 5CLKA 5AYRB 3MWZA 3Q2PA 3F9SA 3IJEB 4OUQA 1IU7A 4HM4B 3HIIA 3FCSB 3LT9A 2FNQA 4L7KA 4MMYB 4WP5A 3FG3A 1TP6A 3SOYA 4EV5A 1ULJB 3NM7A 4HM3B 3LYGA 1W6CA 2QGUA 2GBXB 1ROAA 1NWWA 1W00A 1E97A 3BLZA 4N6OB 3FG1A 1W5ZA 3V92A 2IA7A 1A2KA 3KFQC 4HJLB 3SOAA 1JB4A 1QMAA 3CPW2 2JDIH 4IT7A 3G6E3 5AI1A 3X3ZA 1IV7A 1A67A 1OHSA 1ROVA 3ER7A 1VQ53 3EBTA 1AR0A 5CXOA 1JKGB 4FCZA 5DRVA 3LH4A 3B4OA 3GZBA 1GY5A 2YX9A 1DMNA 4HM6B 5FGOA 1LVNA 2P38A 1IVVA 2FGTA 3BNEA 3K0ZA 3WMDA 3S28A 4N6NB 1FA3A 3K9MC 2CG1A 1OH0A 4HBRA 1OPYA 3SEDA 3DY5A 1AV4A 1GD3A 3SLUA 1NB3I 1KWIA 2K54A 4ZM8A 1VQK3 5KP4A 2W56B 1WMNA 2IUKA 2Z7AA 3JUQA 4NHFA 3WODG 1IVXA 3LT8A 1YIT3 2F99A 3NM2A 1W4NA 3AMOB 3V98A 1D6ZA 4K1VA 3FGYA 1OUNA 3NXJA 3I553 1LXEA 3UL6A 2CFKA 4FCJA 3HX8A 5AEWB 1IT7A 5IG4A 1GY7A 3MSOA 2W9QA 4HM7B 4K1UA 3DUKA 3BNCA 1VQ73 5IEOA 1W6GA 5AEUB 4FMAA 4HKVB 3FH1A 3PZWA 4MJDA 1S723 4IIAA 4HM0B 2P0XA 2PZVA 1IV9A 4OVMA 1S5AA 1IQYA 2V1LA 3NBRA 3NBJA 2GXFA 3CC73 3CCE3 1K28A 2BHMA 2CK3H 1W2B2 1KSIA 1WNHA 1AVLA 1O7HB 4NREA 4CDLA 3CME3 4HM5B 3DGNA 3H3HA 3PS8A 1VQP3 2CWUA 1N5HA 2MC8A 1TFKA 1DVDA 4QWTA 3LXUX 4I4KA 3H51A 1YI23 4BTWA 2RCDA 1SIIA 2RSXA 5BVBA 3NQYA 3X3XA 2CWTA 1OCVA 2HMKB 2QIYA 1EA2A 3BNDA 3PCRA 3RGRA 4XDVA 3WA3A 1RKYA 2SBLA 1Q42A 3BB9A 3RGAA 1CQSA 1GYBA 2WO0A 3A76A 1IVWA 1M9GA 4LZIA 2OOVA 4EYCA 5IG3A 4HYZA 1TIJA 5I97A 1KD14 3GAXA 3VGNA 1U5OA 5IF6A 5IEPA 1KC84 2MF7A 1CYVA 3OWUA 3OWSA 4O02B 2F86B 1N8QA 3T8NA 3CMA3 4GB5A 3LTCA 4AKZA 4LSOA 3LTAA 3S67A 4LMIA 1N9JA 2OCTA 1W7CA 1WTHA 5LC7A 2GEYA 3GZRA 3KSPA 1W01A 1Y4KA 3I0YA 4N6MA 1Q864 1JKGA 2W2CA 4FMDA 1JN5B 4N6UA 2OWPA 3MG3A 2B1XB 3Q90A 3N54B 2CWVA 2K0MA 3T8UA 1YVBI 1R4CA 1O7PB 1ASKA 2L4VA 1FGOA 4MEIA 2E2VA 2XRXB 4XM4A 1ULIB 1Q40B 2W56A 1NB5I 3FKAA 3QRDA 1K734 3STDA 2RGQA 3EJVA 3G713 1CEWI 2CG0A 4K61A 2W03A 3SXXA 1W6YA 1RJOA 1OF5B 2XGNA 3AMOA 3KE7A 3KSED 3T0UA 4LGQA 3DXOA 4EXRA 2E2TA 3M8CA 3CC23 4R80A 1YJW3 3LTDA 2KRTA 4N3VA 2O9UX 3OWYA 1O7NB 1M1XB 4STDA 2E2UA 3S5CA 1V74A 5KP1A 3HK4A 1US1A 2O3OA 1AVKA 3GZYB 2LYXA 2OQEA 1RN7A 1Z1SA 3V99A 2WGOA 3KKGA 1MNLA 5HGRA 1VQL3 2YFIB 1NJI4 2CFLA 1UW1A 5STDA 1JB5A 3UL5A 2HMJB 1UI8A 1HKXA 4G1MB 3SVAA 1DVCA 2CFDA 4K90B 1VQM3 4KZ1A 4ORLA 3FSDA 2GU1A 3K5TA 1SQWA 1FUWA 4KFFA 1Q7Y4 5AYSC 3DMCA 2IUJA 1D6UA 1SIHA 2Y73A 3NV0A 3EX9A 2BMQB 2XH9A 5BXQA 1FGMA 1LNHA 3ALAA 1OGXA 2Z77A 4KVHA 4R4KA 3CCV3 1W2ZA 4FR9A 1YJ93 2ZDJA 4HM8B 1A2VA 3JUOA 3EB8A 3GWRA 5AIIA 2M7OA 4WYKA 1QAKA 3U97A 1C7HA 1NU3A 3Q1CA 1O7WB 3EHCA 1N9EA 4RZMA 3F7XA 7STDA 2LQVA 5G2GA 2F98A 5A0OB 1CYUA 4U13A 1JNQA 2D42A 3F7SA 3NV0B 5D81A 3K7CA 3UJMA 1GD4A 3B7CA 2CHCA 3CCQ3 1STFI 5D82A 3D9RA 3LOYA 3EF8A 2BO9B 5FW5A 3N9HA 4R1KA 3EE1A 2P0MA 4RNZA 2GBWB 2IMJA 3KIIA 4Q53A 1EG9B 4WYKB 1K8A4 3QK9A 3F14A 4JF8A 3DM8A 4N6V0 4TX4A 3DGLA 2CKFB 5JBSA 1O7MB 3NBBA 1GS3A 1IQ8A 3HZPA 1D6YA 2W6JH 3JUMA 2C10A 1DYUA 1F8NA 1STDA 2OOVC 3GZXB 3ROBA 4OK0A 1QAFA 1YGEA 1NDOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN5 A;  3EC9 A;  3OV4 A;  5AIG A;  3DZL A;  3MG2 A;  5CF2 A;  4HM2 B;  1OGZ A;  4X2H A;  4J8T A;  8CHO A;  1Q40 A;  3VSY A;  4HM1 B;  3EN1 B;  4XB5 A;  1ISK A;  1GY6 A;  3MYT A;  1OF5 A;  4R9K A;  4H3U A;  4L8P A;  1SJW A;  5CF1 A;  5IG0 A;  1W02 A;  3UNL A;  1OHO A;  3MG1 A;  3E99 A;  4XBX A;  1ZX2 A;  5JPU A;  4X2O A;  5IEN A;  1E3V A;  3CU3 A;  2YFJ B;  3G0K A;  1UUW B;  3KZT A;  3MKI A;  3B4P A;  3NUV A;  3MHE A;  1UUV B;  4XBT A;  2RFR A;  2XSO B;  3EBY A;  2HMN B;  2B24 B;  3F8H A;  4XDW A;  4L8O A;  5KP3 A;  3EN8 A;  2BMR B;  3NHX A;  3FZW A;  2R4I A;  4XBY A;  3G8Z A;  4PEJ A;  5AIH A;  2XSH B;  3G16 A;  1O7G B;  2XR8 B;  4FCM A;  3IPT A;  4R9L A;  3JUP A;  2INX A;  2BMO B;  2STD A;  3F8X A;  5AIF A;  5JPP A;  5D83 A;  1K41 A;  1DMQ A;  1QJG A;  2A15 A;  2HML B;  5EVH A;  1E3R A;  4HVN A;  3FF0 A;  1VZZ A;  1ZO2 A;  5CK6 A;  4J9A A;  2UX0 A;  1DMM A;  3CPO A;  3CNX A;  1IDP A;  6STD A;  3FF2 A;  2HMO B;  5DRE A;  4LEH A;  4HZB B;  2GEX A;  3CNM A;  3EQQ B;  3B8L A;  3JUN A;  2BNG A;  3F40 A;  3OXA A;  1BUQ A;  1JB2 A;  1WQL B;  3GRD A;  3LZA A;  3OX9 A;  2YFL B;  5TGN A;  1TUH A;  2HMM B;  2Z76 A;  5IER A;  2I9W A;  3FLJ A;  5IG5 A;  2JQ5 A;  3ECF A;  4WWU C;  4HZ9 B;  1OHP A;  5CLK A;  3F9S A;  4OUQ A;  4HM4 B;  4L7K A;  4WP5 A;  3SOY A;  1TP6 A;  1ULJ B;  4HM3 B;  3LYG A;  2QGU A;  2GBX B;  1NWW A;  1W00 A;  1E97 A;  3BLZ A;  1A2K A;  4HJL B;  3SOA A;  1JB4 A;  1QMA A;  5AI1 A;  1OHS A;  3ER7 A;  3EBT A;  1AR0 A;  5CXO A;  1JKG B;  5DRV A;  3B4O A;  3GZB A;  1GY5 A;  1DMN A;  4HM6 B;  3WMD A;  3K0Z A;  1OH0 A;  1OPY A;  3SED A;  2K54 A;  5KP4 A;  3JUQ A;  2Z7A A;  2F99 A;  3NM2 A;  4K1V A;  3FGY A;  1OUN A;  3NXJ A;  4FCJ A;  3HX8 A;  5AEW B;  5IG4 A;  1GY7 A;  3MSO A;  4HM7 B;  4K1U A;  3DUK A;  5IEO A;  5AEU B;  4HKV B;  3FH1 A;  4MJD A;  4IIA A;  4HM0 B;  2PZV A;  4OVM A;  1S5A A;  3NBR A;  2GXF A;  1O7H B;  4CDL A;  4HM5 B;  3H3H A;  4I4K A;  3H51 A;  2RCD A;  5BVB A;  1OCV A;  2HMK B;  2QIY A;  1EA2 A;  3RGR A;  4XDV A;  3RGA A;  1Q42 A;  3BB9 A;  1CQS A;  1GYB A;  3A76 A;  5IG3 A;  3VGN A;  1U5O A;  5IF6 A;  5IEP A;  3OWU A;  3OWS A;  2F86 B;  3T8N A;  4GB5 A;  4LMI A;  2GEY A;  3GZR A;  3KSP A;  1W01 A;  3I0Y A;  1JKG A;  2W2C A;  1JN5 B;  2OWP A;  3MG3 A;  2B1X B;  3Q90 A;  3T8U A;  1O7P B;  1ASK A;  2XRX B;  4XM4 A;  1ULI B;  1Q40 B;  3FKA A;  3STD A;  2RGQ A;  3EJV A;  1W6Y A;  1OF5 B;  3KE7 A;  4LGQ A;  3DXO A;  3M8C A;  4N3V A;  3OWY A;  1O7N B;  4STD A;  3S5C A;  5KP1 A;  3HK4 A;  3GZY B;  1Z1S A;  3KKG A;  5HGR A;  2YFI B;  5STD A;  1JB5 A;  2HMJ B;  1HKX A;  4ORL A;  3FSD A;  3DMC A;  3NV0 A;  3EX9 A;  2BMQ B;  5BXQ A;  1OGX A;  2Z77 A;  4KVH A;  4HM8 B;  3JUO A;  5AII A;  3GWR A;  4WYK A;  1C7H A;  1NU3 A;  1O7W B;  3EHC A;  4RZM A;  7STD A;  3F7X A;  5G2G A;  2F98 A;  4U13 A;  3F7S A;  3NV0 B;  5D81 A;  3K7C A;  3UJM A;  3B7C A;  2CHC A;  5D82 A;  3D9R A;  3EF8 A;  5FW5 A;  4R1K A;  2GBW B;  2IMJ A;  4Q53 A;  1EG9 B;  4WYK B;  3F14 A;  3DM8 A;  2CKF B;  1O7M B;  1GS3 A;  3HZP A;  3JUM A;  1STD A;  3GZX B;  3ROB A;  1NDO B; 
#chains in the Genus database with same CATH topology
 3NX0 A;  1IQX A;  1JN5 A;  1T5Y A;  1G96 A;  1X1Y A;  3EC9 A;  3OV4 A;  1UI7 A;  1JJ2 2;  1A2P A;  2C11 A;  1YIJ 3;  3IMA B;  1Q82 4;  1B20 A;  1DE3 A;  1BRG A;  3CC4 3;  3PGB A;  1FUS A;  4MMZ B;  5AIG A;  3DZL A;  3MG2 A;  4FMB A;  3CCR 3;  5CF2 A;  4HM2 B;  1OGZ A;  4X2H A;  2C4B A;  2QEX 3;  4J8T A;  1KQS 2;  8CHO A;  1IT8 A;  3PCS A;  1Q40 A;  3VSY A;  3OW2 2;  1UDI I;  4HM1 B;  2WOF A;  3AHW A;  3EN1 B;  4XB5 A;  1GY6 A;  4H61 A;  1ISK A;  3MYT A;  4HAA A;  3VF1 A;  1OF5 A;  4O2H A;  4R9K A;  3S29 A;  3NQZ A;  4H3U A;  1BNJ A;  3CD6 3;  1WMO A;  4L8P A;  1BVI A;  3L0R A;  1SJW A;  5CF1 A;  1TRQ A;  5ELJ A;  1RGL A;  3WDG B;  1RRL A;  5IG0 A;  2CFW A;  1W02 A;  2Y74 A;  4EC6 A;  3UNL A;  2CX1 A;  1OHO A;  3MG1 A;  1MWS A;  3E99 A;  3D5I A;  5RNT A;  2CFG A;  4XBX A;  2CW9 A;  1BSA A;  1TRP A;  1ZX2 A;  5JPU A;  4RBN A;  1FGR A;  3I56 3;  4X2O A;  1RGF A;  1RCL A;  2BT3 A;  5IEN A;  1E3V A;  3CU3 A;  1Q81 4;  3BNB A;  3D3L A;  2YFJ B;  3G0K A;  1BRK A;  1RRH A;  1UUW B;  3KZT A;  1VQ8 3;  3AHS A;  1TFO A;  3MKI A;  2ZL8 A;  1IYY A;  2P05 A;  4N6T A;  3B4P A;  3NUV A;  3MHE A;  1UUV B;  2WOH A;  1N8R 4;  6GSP A;  1QAL A;  3ZG5 A;  4XBT A;  3X40 A;  2RFR A;  1BNE A;  2XSO B;  3EBY A;  2HMN B;  3WA2 X;  1PU4 A;  2B24 B;  2Z6B A;  3F8H A;  3K63 A;  2OQE C;  2QA4 3;  4EV2 A;  1MGR A;  4XDW A;  3RDE A;  2ML6 A;  4L8O A;  5KP3 A;  4BTY A;  3EN8 A;  2BMR B;  4WHA A;  2H0I A;  3NHX A;  3FZW A;  1SPU A;  2R4I A;  1GSP A;  2CH9 A;  1MOL A;  1Q7H A;  4XBY A;  3G8Z A;  4PEJ A;  1RGK A;  1V58 A;  5AIH A;  2IYJ A;  2XSH B;  2D1W A;  1RNT A;  3G16 A;  2CC3 A;  1O7G B;  2XR8 B;  4FCM A;  1J2B A;  4O8S A;  3CCJ 3;  3IPT A;  2SAR A;  1C54 A;  5EEO A;  4R9L A;  4AEQ A;  1U8C B;  3X3Y A;  3SYU A;  3JUP A;  3PXM A;  1RTU A;  1UCI A;  2INX A;  4AKY A;  2BMO B;  4MMX B;  1JBS A;  2IY2 A;  3WOF B;  2W04 A;  2STD A;  1WMP A;  2KXG A;  4N6L A;  1L5G B;  3D5G A;  8RNT A;  2OTJ 3;  1LOY A;  5IW9 A;  3F8X A;  3J7Y d;  1B2S A;  4CCV A;  2XGL A;  5AIF A;  5JPP A;  3U1W A;  3CCL 3;  4IPB A;  2WGQ A;  1RGA A;  1N5P A;  5D83 A;  1VQN 3;  4FMC A;  1K41 A;  1YHQ 3;  2F56 A;  2FXT A;  3UB1 A;  1DMQ A;  1BSC A;  1FGT A;  1X1U A;  3MPH A;  2GU3 A;  5ELU A;  2ML5 A;  5LC6 A;  3S27 A;  1QJG A;  1QVF 2;  1GOU A;  2A15 A;  1CH0 A;  2Q07 A;  3HIG A;  2HML B;  1A90 A;  4GL6 A;  5EVH A;  1V57 A;  1HYF A;  4RNY A;  1E3R A;  3SX1 A;  4BU4 A;  3BIR A;  4HVN A;  1IVU A;  1OAC A;  3FF0 A;  4BL2 A;  3CXC 2;  1M90 4;  1VZZ A;  1ZO2 A;  4JRF A;  5CK6 A;  1RHL A;  2XEP A;  4J5G A;  4J9A A;  3TDG A;  1VQO 3;  1HU9 A;  2UX0 A;  2XF3 A;  4I5Q A;  1TU5 A;  1DMM A;  3G4S 3;  1EKM A;  3LML A;  2BIR A;  2P09 A;  2W0Q A;  3HI7 A;  1VQ4 3;  3X41 A;  3CCS 3;  4EBG A;  3CPO A;  3O8Y A;  3CNX A;  1IDP A;  1VQ9 3;  6STD A;  3N8B A;  3FF2 A;  1IK3 A;  3DGM A;  2HMO B;  5DRE A;  3LTB A;  2XFT A;  2W9P A;  1JRQ A;  4GSP A;  4HZB B;  4LEH A;  1EQK A;  4KFE A;  1VQ6 3;  1RGG A;  2GEX A;  3CNM A;  1M1K 4;  3JVC A;  3EQQ B;  3FG4 A;  3B8L A;  1PFP A;  2KF4 A;  3JUN A;  2BNG A;  1LOX A;  3F40 A;  1GMR A;  3OXA A;  1BUQ A;  2H0H A;  1G02 A;  1JB2 A;  4BTX A;  1WQL B;  2PNC A;  3GRD A;  2ZA4 A;  1YGW A;  1FUT A;  2CIU A;  2XFS A;  3PYJ A;  1QVG 2;  2AAE A;  4O3V A;  3WOE B;  3LZA A;  1X1X A;  2KCD A;  1I2F A;  3OX9 A;  2RBI A;  1YJN 3;  3DGO A;  2OTL 3;  1ZS7 A;  4KFD A;  3X42 A;  4WFO A;  2YFL B;  3CCU 3;  1K9M 4;  1FGQ A;  5TGN A;  1I2E A;  5GSP A;  1TUH A;  3CCM 3;  1BNF A;  2HMM B;  2HOH A;  5EQL A;  2Z76 A;  5IER A;  1BRH A;  2I9W A;  1NO3 A;  3FLJ A;  3KN4 A;  5IG5 A;  1I70 A;  2JQ5 A;  3ECF A;  4WWU C;  1JV2 B;  4HZ9 B;  1OHP A;  5CLK A;  5AYR B;  3MWZ A;  1RGC A;  3Q2P A;  3F9S A;  1UUG B;  3IJE B;  1IU7 A;  1NNV A;  3HII A;  3FCS B;  2RNT A;  3LT9 A;  4HM4 B;  4OUQ A;  2FNQ A;  4L7K A;  4MMY B;  1LRA A;  4WP5 A;  1B2M A;  3FG3 A;  1TP6 A;  1YNV X;  3SOY A;  4EV5 A;  1ULJ B;  1BUJ A;  1B2U A;  3NM7 A;  1BRJ A;  1W6C A;  2QGU A;  3LYG A;  2GBX B;  4HM3 B;  1LNI A;  1ROA A;  1NWW A;  1W00 A;  1E97 A;  1UCK A;  3BLZ A;  4N6O B;  3FG1 A;  1W5Z A;  3V92 A;  2KF5 A;  2IA7 A;  1A2K A;  3KFQ C;  4HJL B;  3SOA A;  1JB4 A;  1QMA A;  3CPW 2;  2JDI H;  2GSP A;  4IT7 A;  1MWR A;  3G6E 3;  5AI1 A;  3X3Z A;  1IV7 A;  1A67 A;  1OHS A;  1ROV A;  2F5W A;  3ER7 A;  1RCK A;  1AR0 A;  3EBT A;  2KF6 A;  1VQ5 3;  1JBR A;  5CXO A;  1BNR A;  1JKG B;  1B3S A;  4FCZ A;  5DRV A;  3LH4 A;  3B4O A;  3GZB A;  1GY5 A;  2YX9 A;  1DMN A;  4HM6 B;  5FGO A;  1LVN A;  2FGT A;  1BIR A;  1IVV A;  2P38 A;  1YVS A;  3BNE A;  3K0Z A;  4N6N B;  3S28 A;  3K9M C;  1JZO A;  2CG1 A;  1OH0 A;  3WR2 A;  1FA3 A;  4HBR A;  1OPY A;  3SED A;  1LOV A;  3DY5 A;  1AV4 A;  1GD3 A;  3SLU A;  3WMD A;  1NB3 I;  1KWI A;  2K54 A;  2ZHX B;  7RNT A;  4ZM8 A;  1VQK 3;  5KP4 A;  1I3I A;  2W56 B;  1WMN A;  5G1L A;  2IUK A;  2Z7A A;  3JUQ A;  4NHF A;  3WOD G;  1IVX A;  3LT8 A;  1YIT 3;  1BU4 A;  2F99 A;  3NM2 A;  1W4N A;  1UCJ A;  3AMO B;  3V98 A;  1D6Z A;  2BU4 A;  4K1V A;  3FGY A;  4EW5 A;  2KF3 A;  1OUN A;  3NXJ A;  3I55 3;  1LXE A;  3KCH A;  3GSP A;  2CFK A;  2UUG C;  4FCJ A;  3UL6 A;  3HX8 A;  1TJD A;  1IT7 A;  5AEW B;  4DKI A;  5IG4 A;  1GY7 A;  3MSO A;  2W9Q A;  3DGY A;  4HM7 B;  5BU4 A;  4K1U A;  3DUK A;  3BNC A;  1VQ7 3;  1RNB A;  5IEO A;  1W6G A;  5AEU B;  4FMA A;  4HKV B;  2R41 A;  3FH1 A;  3PZW A;  4MJD A;  1S72 3;  4IIA A;  4HM0 B;  2P0X A;  1BRI A;  2PZV A;  1IV9 A;  1UGI A;  4OVM A;  1T2I A;  1S5A A;  2K3D A;  3URP A;  1IQY A;  1UGH I;  2V1L A;  3NBR A;  3NBJ A;  2GXF A;  3CC7 3;  3CCE 3;  1K28 A;  2BHM A;  2CK3 H;  1GMP A;  1RLS A;  1W2B 2;  1EUI C;  1G0T A;  1KSI A;  1WNH A;  4KT3 B;  1AVL A;  1O7H B;  4NRE A;  4CDL A;  3CME 3;  4HM5 B;  3DGN A;  3H3H A;  3PS8 A;  1I3F A;  1VQP 3;  2CWU A;  1N5H A;  2MC8 A;  1RMS A;  1BGS A;  1TFK A;  1DVD A;  4QWT A;  3LXU X;  4I4K A;  3AGN A;  3H51 A;  1YI2 3;  1I0X A;  1BAO A;  4BTW A;  2RCD A;  1SII A;  2RSX A;  5BVB A;  2H0G A;  3NQY A;  5G1K A;  2CWT A;  2J8X B;  3X3X A;  1OCV A;  2HMK B;  2QIY A;  1EA2 A;  1MWT A;  3D79 A;  1T2H A;  1BNS A;  3BND A;  3PCR A;  3RGR A;  4XDV A;  3WA3 A;  4CPK A;  1RKY A;  2SBL A;  1Q42 A;  3BB9 A;  3RGA A;  1DET A;  4BIR A;  1CQS A;  1GYB A;  3ZG0 A;  2WO0 A;  1PY3 A;  5M1A A;  3A76 A;  2L1S A;  4LYL B;  1IVW A;  1M9G A;  4LZI A;  2OOV A;  4EYC A;  5IG3 A;  4HYZ A;  1TIJ A;  5I97 A;  1KD1 4;  3GAX A;  3VGN A;  1U5O A;  5IF6 A;  5IEP A;  1GMQ A;  2MF7 A;  1CYV A;  3OWU A;  1KC8 4;  3OWS A;  4GHO A;  4O02 B;  2F4Y A;  1BRN L;  2F86 B;  1N8Q A;  3T8N A;  3CMA 3;  4GB5 A;  3LTC A;  4NPB A;  2KAA A;  4AKZ A;  4LSO A;  1JZD A;  3LTA A;  3S67 A;  4LMI A;  2CX0 A;  1N9J A;  1GOV A;  1SAR A;  1W7C A;  1WTH A;  2OCT A;  2GEY A;  5LC7 A;  3GZR A;  1B2Z A;  1W01 A;  1Y4K A;  3I0Y A;  3KSP A;  1R4Y A;  4N6M A;  1Q86 4;  1JKG A;  2W2C A;  4FMD A;  1JN5 B;  4N6U A;  1FW7 A;  1UCL A;  6RNT A;  2OWP A;  3MG3 A;  1BRS A;  2B1X B;  3Q90 A;  3N54 B;  2CWV A;  1VQQ A;  1B2X A;  2K0M A;  3T8U A;  1B27 A;  1YVB I;  1R4C A;  1O7P B;  1RN1 A;  1EEJ A;  1ASK A;  2L4V A;  1I0V A;  1FGO A;  4MEI A;  2E2V A;  2XRX B;  1FYS A;  4XM4 A;  1ULI B;  1Q40 B;  2W56 A;  1NB5 I;  1HZ1 A;  3A5E A;  3FKA A;  3QRD A;  1K73 4;  3STD A;  2RGQ A;  3EJV A;  3G71 3;  1CEW I;  2CG0 A;  4K61 A;  2W03 A;  4RNT A;  1W6Y A;  1RJO A;  3SXX A;  1OF5 B;  2XGN A;  3AMO A;  3KE7 A;  3KSE D;  1I2G A;  1MWU A;  3T0U A;  4LGQ A;  3DXO A;  4EXR A;  2E2T A;  1ZGX A;  1T3B A;  3M8C A;  3AGO A;  1Q9E A;  3CC2 3;  4R80 A;  3ZFZ A;  4HOH A;  1YJW 3;  3LTD A;  2KRT A;  4N3V A;  2O9U X;  3OWY A;  1O7N B;  1M1X B;  1B21 A;  4STD A;  2E2U A;  3S5C A;  1V74 A;  5KP1 A;  1AY7 A;  3HK4 A;  1US1 A;  1AVK A;  2O3O A;  3GZY B;  2LYX A;  2OQE A;  3WHO A;  1RN7 A;  3RNT A;  1Z1S A;  3V99 A;  2WGO A;  3KKG A;  1MNL A;  5HGR A;  1VQL 3;  2YFI B;  1BOX A;  2CFL A;  1LQG C;  1UW1 A;  5STD A;  1NJI 4;  1JB5 A;  3UL5 A;  2HMJ B;  1UI8 A;  5M19 A;  1HKX A;  4G1M B;  4J5K A;  3SVA A;  1DVC A;  2CFD A;  3HOH A;  5HOH A;  4ILF A;  4K90 B;  1VQM 3;  1AQZ A;  4KZ1 A;  4ORL A;  4BL3 A;  5M18 A;  1BSE A;  3FSD A;  2GU1 A;  3K5T A;  1RSN A;  1SQW A;  1FUW A;  4KFF A;  1Q7Y 4;  4CJN A;  5AYS C;  3DMC A;  2IUJ A;  1D6U A;  1SIH A;  2Y73 A;  1BSD A;  3NV0 A;  3EX9 A;  2BMQ B;  2XH9 A;  5BXQ A;  1FGM A;  1RDS A;  1LNH A;  3ALA A;  1FZU A;  1OGX A;  2Z77 A;  4KVH A;  4R4K A;  3CCV 3;  1W2Z A;  4FR9 A;  1YJ9 3;  1MGW A;  2ZDJ A;  1I8V A;  1A2V A;  4HM8 B;  7GSP A;  9RNT A;  3JUO A;  3EB8 A;  1RN4 A;  1BAN A;  3GWR A;  2M7O A;  4WYK A;  5AII A;  1JBT A;  1GOY A;  1QAK A;  3U97 A;  1C7H A;  1NU3 A;  3Q1C A;  1BNI A;  1O7W B;  3EHC A;  1N9E A;  4RZM A;  3F7X A;  7STD A;  3BU4 A;  2LQV A;  5G2G A;  1BNG A;  2F98 A;  5A0O B;  1CYU A;  4U13 A;  1JNQ A;  2D42 A;  3F7S A;  1TTO A;  3NV0 B;  5D81 A;  3K7C A;  3UJM A;  3DH2 A;  1LQM B;  1BSB A;  1GD4 A;  3B7C A;  2CHC A;  3CCQ 3;  2UGI A;  1STF I;  5D82 A;  3D9R A;  3LOY A;  3EF8 A;  1RGH A;  2BO9 B;  5FW5 A;  3N9H A;  4R1K A;  3EE1 A;  1LOW A;  2P0M A;  1RGE A;  1X1W A;  3D4A A;  4RNZ A;  2GBW B;  2IMJ A;  3KII A;  4Q53 A;  1EG9 B;  4WYK B;  1K8A 4;  3Q3F A;  3QK9 A;  3F14 A;  4JF8 A;  3DM8 A;  4N6V 0;  4TX4 A;  3DGL A;  2F5M A;  2CKF B;  5JBS A;  1O7M B;  2AAD A;  3NBB A;  5BIR A;  1GS3 A;  1IQ8 A;  3HZP A;  1D6Y A;  2W6J H;  3JUM A;  1PYL A;  2C10 A;  1DYU A;  1F8N A;  1STD A;  2OOV C;  3GZX B;  3ROB A;  4OK0 A;  1QAF A;  1YGE A;  1NDO B; 
#chains in the Genus database with same CATH homology
 3NX0 A;  1IQX A;  1JN5 A;  1T5Y A;  1G96 A;  3EC9 A;  3OV4 A;  1UI7 A;  1JJ2 2;  2C11 A;  1YIJ 3;  1Q82 4;  3IMA B;  3CC4 3;  3PGB A;  4MMZ B;  5AIG A;  3DZL A;  3MG2 A;  4FMB A;  3CCR 3;  5CF2 A;  4HM2 B;  1OGZ A;  4X2H A;  2QEX 3;  4J8T A;  1KQS 2;  8CHO A;  1IT8 A;  3PCS A;  1Q40 A;  3VSY A;  3OW2 2;  4HM1 B;  2WOF A;  3EN1 B;  4XB5 A;  1ISK A;  1GY6 A;  4H61 A;  3MYT A;  3VF1 A;  1OF5 A;  4O2H A;  4R9K A;  3S29 A;  3NQZ A;  4H3U A;  3CD6 3;  1WMO A;  4L8P A;  3L0R A;  1SJW A;  5CF1 A;  5ELJ A;  3WDG B;  1RRL A;  5IG0 A;  2CFW A;  1W02 A;  2Y74 A;  4EC6 A;  3UNL A;  1OHO A;  3MG1 A;  3E99 A;  2CFG A;  4XBX A;  2CW9 A;  1ZX2 A;  5JPU A;  4RBN A;  1FGR A;  3I56 3;  4X2O A;  2BT3 A;  5IEN A;  1E3V A;  3CU3 A;  1Q81 4;  3BNB A;  3D3L A;  2YFJ B;  3G0K A;  1RRH A;  1UUW B;  3KZT A;  1VQ8 3;  1TFO A;  3MKI A;  2ZL8 A;  2P05 A;  4N6T A;  3B4P A;  3NUV A;  3MHE A;  1UUV B;  2WOH A;  1N8R 4;  1QAL A;  4XBT A;  3X40 A;  2RFR A;  2XSO B;  3EBY A;  3WA2 X;  2HMN B;  1PU4 A;  2B24 B;  2Z6B A;  3F8H A;  3K63 A;  2OQE C;  2QA4 3;  4EV2 A;  4XDW A;  3RDE A;  2ML6 A;  4L8O A;  5KP3 A;  4BTY A;  3EN8 A;  2BMR B;  4WHA A;  3NHX A;  3FZW A;  1SPU A;  2R4I A;  2CH9 A;  1MOL A;  4XBY A;  3G8Z A;  4PEJ A;  5AIH A;  2XSH B;  2D1W A;  3G16 A;  2CC3 A;  1O7G B;  2XR8 B;  4FCM A;  1J2B A;  4O8S A;  3CCJ 3;  3IPT A;  5EEO A;  4R9L A;  4AEQ A;  1U8C B;  3X3Y A;  3JUP A;  3PXM A;  2INX A;  4AKY A;  2BMO B;  4MMX B;  3WOF B;  2W04 A;  2STD A;  1WMP A;  2KXG A;  4N6L A;  1L5G B;  2OTJ 3;  5IW9 A;  3F8X A;  3J7Y d;  4CCV A;  2XGL A;  5AIF A;  5JPP A;  3U1W A;  3CCL 3;  4IPB A;  2WGQ A;  1N5P A;  5D83 A;  1VQN 3;  4FMC A;  1K41 A;  1YHQ 3;  2FXT A;  3UB1 A;  1DMQ A;  1FGT A;  3MPH A;  2GU3 A;  5ELU A;  2ML5 A;  5LC6 A;  3S27 A;  1QJG A;  1QVF 2;  2A15 A;  2Q07 A;  3HIG A;  2HML B;  1A90 A;  4GL6 A;  5EVH A;  4RNY A;  1E3R A;  3SX1 A;  4HVN A;  1IVU A;  1OAC A;  3FF0 A;  3CXC 2;  1M90 4;  1VZZ A;  1ZO2 A;  4JRF A;  5CK6 A;  2XEP A;  4J9A A;  3TDG A;  1VQO 3;  1HU9 A;  2UX0 A;  2XF3 A;  1TU5 A;  1DMM A;  3G4S 3;  1EKM A;  3LML A;  2P09 A;  2W0Q A;  3HI7 A;  1VQ4 3;  3X41 A;  3CCS 3;  4EBG A;  3CPO A;  3O8Y A;  3CNX A;  1IDP A;  1VQ9 3;  6STD A;  3N8B A;  3FF2 A;  1IK3 A;  3DGM A;  2HMO B;  5DRE A;  3LTB A;  2XFT A;  2W9P A;  1JRQ A;  4HZB B;  4LEH A;  1EQK A;  4KFE A;  1VQ6 3;  2GEX A;  3CNM A;  1M1K 4;  3JVC A;  3EQQ B;  3FG4 A;  3B8L A;  1PFP A;  3JUN A;  2BNG A;  1LOX A;  3F40 A;  3OXA A;  1BUQ A;  1JB2 A;  4BTX A;  1WQL B;  2PNC A;  3GRD A;  2CIU A;  1QVG 2;  2XFS A;  3PYJ A;  3WOE B;  4O3V A;  3LZA A;  3OX9 A;  2KCD A;  1YJN 3;  2OTL 3;  3DGO A;  4KFD A;  3X42 A;  4WFO A;  2YFL B;  3CCU 3;  1K9M 4;  1FGQ A;  5TGN A;  1TUH A;  3CCM 3;  2HMM B;  5EQL A;  2Z76 A;  5IER A;  2I9W A;  1NO3 A;  3FLJ A;  3KN4 A;  5IG5 A;  2JQ5 A;  3ECF A;  4WWU C;  1JV2 B;  4HZ9 B;  1OHP A;  5CLK A;  5AYR B;  3MWZ A;  3Q2P A;  3F9S A;  3IJE B;  4OUQ A;  1IU7 A;  4HM4 B;  3HII A;  3FCS B;  3LT9 A;  2FNQ A;  4L7K A;  4MMY B;  4WP5 A;  3FG3 A;  1TP6 A;  3SOY A;  4EV5 A;  1ULJ B;  3NM7 A;  4HM3 B;  3LYG A;  1W6C A;  2QGU A;  2GBX B;  1ROA A;  1NWW A;  1W00 A;  1E97 A;  3BLZ A;  4N6O B;  3FG1 A;  1W5Z A;  3V92 A;  2IA7 A;  1A2K A;  3KFQ C;  4HJL B;  3SOA A;  1JB4 A;  1QMA A;  3CPW 2;  2JDI H;  4IT7 A;  3G6E 3;  5AI1 A;  3X3Z A;  1IV7 A;  1A67 A;  1OHS A;  1ROV A;  3ER7 A;  1VQ5 3;  3EBT A;  1AR0 A;  5CXO A;  1JKG B;  4FCZ A;  5DRV A;  3LH4 A;  3B4O A;  3GZB A;  1GY5 A;  2YX9 A;  1DMN A;  4HM6 B;  5FGO A;  1LVN A;  2P38 A;  1IVV A;  2FGT A;  3BNE A;  3K0Z A;  3WMD A;  3S28 A;  4N6N B;  1FA3 A;  3K9M C;  2CG1 A;  1OH0 A;  4HBR A;  1OPY A;  3SED A;  3DY5 A;  1AV4 A;  1GD3 A;  3SLU A;  1NB3 I;  1KWI A;  2K54 A;  4ZM8 A;  1VQK 3;  5KP4 A;  2W56 B;  1WMN A;  2IUK A;  2Z7A A;  3JUQ A;  4NHF A;  3WOD G;  1IVX A;  3LT8 A;  1YIT 3;  2F99 A;  3NM2 A;  1W4N A;  3AMO B;  3V98 A;  1D6Z A;  4K1V A;  3FGY A;  1OUN A;  3NXJ A;  3I55 3;  1LXE A;  3UL6 A;  2CFK A;  4FCJ A;  3HX8 A;  5AEW B;  1IT7 A;  5IG4 A;  1GY7 A;  3MSO A;  2W9Q A;  4HM7 B;  4K1U A;  3DUK A;  3BNC A;  1VQ7 3;  5IEO A;  1W6G A;  5AEU B;  4FMA A;  4HKV B;  3FH1 A;  3PZW A;  4MJD A;  1S72 3;  4IIA A;  4HM0 B;  2P0X A;  2PZV A;  1IV9 A;  4OVM A;  1S5A A;  1IQY A;  2V1L A;  3NBR A;  3NBJ A;  2GXF A;  3CC7 3;  3CCE 3;  1K28 A;  2BHM A;  2CK3 H;  1W2B 2;  1KSI A;  1WNH A;  1AVL A;  1O7H B;  4NRE A;  4CDL A;  3CME 3;  4HM5 B;  3DGN A;  3H3H A;  3PS8 A;  1VQP 3;  2CWU A;  1N5H A;  2MC8 A;  1TFK A;  1DVD A;  4QWT A;  3LXU X;  4I4K A;  3H51 A;  1YI2 3;  4BTW A;  2RCD A;  1SII A;  2RSX A;  5BVB A;  3NQY A;  3X3X A;  2CWT A;  1OCV A;  2HMK B;  2QIY A;  1EA2 A;  3BND A;  3PCR A;  3RGR A;  4XDV A;  3WA3 A;  1RKY A;  2SBL A;  1Q42 A;  3BB9 A;  3RGA A;  1CQS A;  1GYB A;  2WO0 A;  3A76 A;  1IVW A;  1M9G A;  4LZI A;  2OOV A;  4EYC A;  5IG3 A;  4HYZ A;  1TIJ A;  5I97 A;  1KD1 4;  3GAX A;  3VGN A;  1U5O A;  5IF6 A;  5IEP A;  1KC8 4;  2MF7 A;  1CYV A;  3OWU A;  3OWS A;  4O02 B;  2F86 B;  1N8Q A;  3T8N A;  3CMA 3;  4GB5 A;  3LTC A;  4AKZ A;  4LSO A;  3LTA A;  3S67 A;  4LMI A;  1N9J A;  2OCT A;  1W7C A;  1WTH A;  5LC7 A;  2GEY A;  3GZR A;  3KSP A;  1W01 A;  1Y4K A;  3I0Y A;  4N6M A;  1Q86 4;  1JKG A;  2W2C A;  4FMD A;  1JN5 B;  4N6U A;  2OWP A;  3MG3 A;  2B1X B;  3Q90 A;  3N54 B;  2CWV A;  2K0M A;  3T8U A;  1YVB I;  1R4C A;  1O7P B;  1ASK A;  2L4V A;  1FGO A;  4MEI A;  2E2V A;  2XRX B;  4XM4 A;  1ULI B;  1Q40 B;  2W56 A;  1NB5 I;  3FKA A;  3QRD A;  1K73 4;  3STD A;  2RGQ A;  3EJV A;  3G71 3;  1CEW I;  2CG0 A;  4K61 A;  2W03 A;  3SXX A;  1W6Y A;  1RJO A;  1OF5 B;  2XGN A;  3AMO A;  3KE7 A;  3KSE D;  3T0U A;  4LGQ A;  3DXO A;  4EXR A;  2E2T A;  3M8C A;  3CC2 3;  4R80 A;  1YJW 3;  3LTD A;  2KRT A;  4N3V A;  2O9U X;  3OWY A;  1O7N B;  1M1X B;  4STD A;  2E2U A;  3S5C A;  1V74 A;  5KP1 A;  3HK4 A;  1US1 A;  2O3O A;  1AVK A;  3GZY B;  2LYX A;  2OQE A;  1RN7 A;  1Z1S A;  3V99 A;  2WGO A;  3KKG A;  1MNL A;  5HGR A;  1VQL 3;  2YFI B;  1NJI 4;  2CFL A;  1UW1 A;  5STD A;  1JB5 A;  3UL5 A;  2HMJ B;  1UI8 A;  1HKX A;  4G1M B;  3SVA A;  1DVC A;  2CFD A;  4K90 B;  1VQM 3;  4KZ1 A;  4ORL A;  3FSD A;  2GU1 A;  3K5T A;  1SQW A;  1FUW A;  4KFF A;  1Q7Y 4;  5AYS C;  3DMC A;  2IUJ A;  1D6U A;  1SIH A;  2Y73 A;  3NV0 A;  3EX9 A;  2BMQ B;  2XH9 A;  5BXQ A;  1FGM A;  1LNH A;  3ALA A;  1OGX A;  2Z77 A;  4KVH A;  4R4K A;  3CCV 3;  1W2Z A;  4FR9 A;  1YJ9 3;  2ZDJ A;  4HM8 B;  1A2V A;  3JUO A;  3EB8 A;  3GWR A;  5AII A;  2M7O A;  4WYK A;  1QAK A;  3U97 A;  1C7H A;  1NU3 A;  3Q1C A;  1O7W B;  3EHC A;  1N9E A;  4RZM A;  3F7X A;  7STD A;  2LQV A;  5G2G A;  2F98 A;  5A0O B;  1CYU A;  4U13 A;  1JNQ A;  2D42 A;  3F7S A;  3NV0 B;  5D81 A;  3K7C A;  3UJM A;  1GD4 A;  3B7C A;  2CHC A;  3CCQ 3;  1STF I;  5D82 A;  3D9R A;  3LOY A;  3EF8 A;  2BO9 B;  5FW5 A;  3N9H A;  4R1K A;  3EE1 A;  2P0M A;  4RNZ A;  2GBW B;  2IMJ A;  3KII A;  4Q53 A;  1EG9 B;  4WYK B;  1K8A 4;  3QK9 A;  3F14 A;  4JF8 A;  3DM8 A;  4N6V 0;  4TX4 A;  3DGL A;  2CKF B;  5JBS A;  1O7M B;  3NBB A;  1GS3 A;  1IQ8 A;  3HZP A;  1D6Y A;  2W6J H;  3JUM A;  2C10 A;  1DYU A;  1F8N A;  1STD A;  2OOV C;  3GZX B;  3ROB A;  4OK0 A;  1QAF A;  1YGE A;  1NDO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...