4OUQA

Crystal structure of a duf4783 family protein (bf1468) from bacteroides fragilis ych46 at 1.55 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
105
Chain Sequence
DIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLAAFFSSNKVSGFNVNHEGKRDSSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF1468) from Bacteroides fragilis YCH46 at 1.55 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 30
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2014-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16022 DUF4783 Domain of unknown function (DUF4783)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ouqA00
3EBYA 3D9RA 1U5OA 4XM4A 2F99A 3SOYA 2GBXB 1E3RA 4XDVA 3M8CA 2GBWB 3T8NA 4RZMA 1JB4A 3UJMA 1OPYA 3ROBA 3FLJA 2UX0A 2HMNB 4X2OA 1OGZA 4L7KA 1C7HA 2XR8B 3BLZA 3E99A 3EQQB 3K0ZA 1GY5A 1E97A 3CNXA 1JN5A 1OHSA 3GZXB 3EJVA 1ZO2A 2HMOB 3F7XA 3OXAA 3LYGA 3NV0A 3OWSA 4R9LA 3HK4A 4N3VA 1JB5A 3FH1A 5AIGA 4L8PA 1TP6A 1HKXA 1ZX2A 3GWRA 3NUVA 4LMIA 4K1VA 4FCMA 1QJGA 1W02A 3GZRA 4HJLB 2Z76A 3CNMA 3B4PA 4J8TA 1O7WB 1DMNA 3B8LA 2XRXB 5HGRA 4J9AA 3G16A 5AIHA 3EN8A 5STDA 1CQSA 1Z1SA 4STDA 2STDA 5IG4A 1NWWA 1OUNA 1DMQA 1O7HB 4HM0B 4HKVB 4HM1B 3KZTA 2OWPA 1JKGB 5G2GA 1STDA 2YFJB 3KE7A 2HMJB 1ASKA 4R1KA 1A2KA 5DRVA 3I0YA 5CF1A 5IF6A 1AR0A 3DUKA 3FF2A 4U13A 1UUVB 3DMCA 3HX8A 5D81A 2YFIB 1GY6A 2JQ5A 2HMLB 2HMMB 4Q53A 5AI1A 3UNLA 5IEPA 3ECFA 5CF2A 1EA2A 3H51A 5FW5A 2YFLB 3STDA 4FCJA 1BUQA 3CPOA 2CHCA 3FF0A 3FSDA 3MG1A 3NV0B 3NBRA 2Z77A 3EC9A 4WYKA 4X2HA 5BVBA 3H3HA 4WWUC 6STDA 3K7CA 5AEWB 3FGYA 3DM8A 3MHEA 1S5AA 5JPPA 1JB2A 5CK6A 7STDA 1Q40B 5D82A 5IERA 1DMMA 1ULIB 1OGXA 1NDOB 1OCVA 3SOAA 1UUWB 2BNGA 3F8XA 4MJDA 3F40A 5IEOA 3EBTA 1O7GB 4GB5A 5AEUB 3MYTA 4XBYA 3WMDA 1GYBA 5KP3A 1NU3A 4HM2B 3NHXA 5KP1A 5IENA 3JUPA 2QGUA 3F7SA 3EHCA 1SJWA 3OWUA 4R9KA 3DZLA 5AIFA 2CKFB 4IIAA 3T8UA 3JUOA 2INXA 2B1XB 1OH0A 3ER7A 1W01A 4KVHA 4HZ9B 3S5CA 2A15A 3MSOA 4XBXA 1OHOA 1GS3A 3KKGA 4ORLA 3MG3A 4HM3B 1TUHA 2BMOB 3KSPA 3FZWA 4OVMA 1OF5A 1IDPA 5EVHA 3A76A 1K41A 2GEXA 4WYKB 3IPTA 3JUQA 1GY7A 5AIIA 1JN5B 3OX9A 1O7PB 2B24B 3OV4A 3LZAA 1O7NB 4WP5A 3RGAA 2Z7AA 3MKIA 3BB9A 5IG0A 5KP4A 4L8OA 3HZPA 3FKAA 2I9WA 3GZBA 4HM4B 3Q90A 1W6YA 2IMJA 1VZZA 5D83A 3GRDA 4CDLA 5BXQA 1E3VA 5IG5A 2F86B 1EG9B 2GEYA 2PZVA 3F8HA 5IG3A 1OHPA 2W2CA 2RCDA 4XDWA 3RGRA 2GXFA 4LEHA 8CHOA 1QMAA 2R4IA 3CU3A 3EX9A 4HM5B 3G8ZA 2XSOB 4H3UA 4I4KA 4HVNA 4PEJA 3B7CA 4XB5A 3DXOA 1Q40A 3JUMA 1Q42A 3EN1B 4HM8B 1ISKA 2BMRB 3F14A 2RFRA 4HZBB 5TGNA 2F98A 1W00A 2QIYA 3JUNA 3VGNA 5JPUA 1OF5B 3NM2A 5CLKA 3OWYA 3SEDA 2RGQA 1ULJB 3G0KA 4OUQA 5CXOA 4XBTA 3VSYA 3GZYB 3EF8A 4K1UA 1O7MB 3NXJA 4HM6B 3F9SA 5DREA 4HM7B 2XSHB 3MG2A 4LGQA 2K54A 2HMKB 2BMQB 3B4OA 1JKGA 1WQLB
chains in the Genus database with same CATH superfamily
4KZ1A 3X41A 3EBYA 1HU9A 1RN7A 1GD3A 3MPHA 2UGIA 3D9RA 1FUSA 1FGRA 4IT7A 1U5OA 4QWTA 2BO9B 4XM4A 1OACA 4R4KA 2KXGA 2ML5A 4N6LA 3ALAA 3N8BA 1R4CA 2F99A 1LOYA 3PCRA 3NX0A 3LOYA 3SOYA 1FA3A 2GBXB 2M7OA 1E3RA 4XDVA 4HYZA 4N6V0 3M8CA 1V58A 2W9QA 3TDGA 2GBWB 4K90B 1AY7A 2Y73A 3S28A 3T8NA 4RZMA 3X42A 1JB4A 1IK3A 3UJMA 1VQ53 2KF5A 2MF7A 1OPYA 5ELUA 2AAEA 3D4AA 3ROBA 5M19A 1LQGC 1RCLA 3CME3 3FLJA 2UX0A 3BNDA 1VQN3 2HMNB 3N54B 3GAXA 4X2OA 1LQMB 1LRAA 4OK0A 1OGZA 3Q2PA 4L7KA 1LOVA 4N6UA 1IQXA 1RGCA 1BSAA 1C7HA 2XR8B 3BLZA 3E99A 2F56A 3V99A 6RNTA 3EQQB 1SPUA 3K0ZA 1T5YA 3UL5A 4IPBA 1AVKA 1GY5A 1VQL3 4GHOA 4R80A 2OQEA 4EXRA 1E97A 3CNXA 1U8CB 3PYJA 3WR2A 4CCVA 1JN5A 1DVCA 3BNBA 4BTWA 1VQ83 3L0RA 1OHSA 1IV9A 1KD14 1CH0A 1I2FA 1BNFA 3GZXB 1YGEA 1WMNA 1SQWA 3BU4A 3EJVA 3K63A 1FW7A 3D79A 1ZO2A 4NREA 2HMOB 1K8A4 4EV5A 2F4YA 3F7XA 3OXAA 2P0XA 3LYGA 3NV0A 3OWSA 4R9LA 3WODG 3HK4A 1CYVA 3LXUX 3EB8A 1LXEA 1T2IA 4N3VA 1JB5A 3RDEA 3FH1A 5AIGA 4L8PA 3K5TA 2CWTA 1TP6A 2WGQA 3AGNA 1HKXA 3HIIA 1ROVA 4RNZA 1GMPA 1ZX2A 1NJI4 3CCL3 1MWTA 3GWRA 1MGRA 3NUVA 2SBLA 5A0OB 4LMIA 1VQK3 3LT8A 3A5EA 4K1VA 1FGOA 2MC8A 4FCMA 2P0MA 1QJGA 1B2ZA 1W02A 1W5ZA 3GZRA 4HJLB 1DETA 3ZG5A 4J5KA 2W56A 2Z76A 3CNMA 1M1XB 1PU4A 3I553 1UI7A 1C54A 3B4PA 2BT3A 4HAAA 1WMPA 1ZS7A 4J8TA 6GSPA 1YIT3 1O7WB 1DMNA 1PFPA 3B8LA 2WO0A 3PGBA 4O3VA 3X3YA 1IQYA 2XRXB 5HGRA 5LC7A 4J9AA 2Q07A 4JF8A 3G16A 2CFGA 3KN4A 5AIHA 3X3XA 1BRIA 3EN8A 1BNEA 1BGSA 4MMZB 5STDA 1CQSA 1YIJ3 2Z6BA 4MMYB 1G02A 4BTXA 1Z1SA 4AKZA 4STDA 2STDA 4EV2A 5IG4A 1NWWA 1TRQA 1I2EA 1OUNA 2KAAA 3CCS3 3N9HA 1DMQA 9RNTA 2KF3A 5G1LA 1I2GA 1O7HB 1RGLA 1TTOA 1G0TA 2CIUA 4HM0B 4DKIA 1AVLA 4ZM8A 3CCE3 4HKVB 1SIHA 3KZTA 4HM1B 2OWPA 1JKGB 2W0QA 5G2GA 2CK3H 3G6E3 4FMAA 1RNTA 4RNTA 1STDA 1UDII 2YFJB 3KE7A 1BRNL 3U1WA 2HMJB 1ASKA 1A67A 4R1KA 1RN1A 2FNQA 5BU4A 1A2KA 4O8SA 5DRVA 4EYCA 2PNCA 3I0YA 3KFQC 3G713 5CF1A 3PXMA 2CH9A 1FUWA 5IF6A 1W2B2 2CW9A 1A2VA 3NM7A 1AR0A 3DUKA 2CFWA 1BRJA 2C4BA 3FF2A 1Q824 2CFLA 1A90A 2XFTA 3UB1A 3FG4A 4U13A 1MWSA 4BU4A 1YVBI 2C10A 1UUVB 3DMCA 3HX8A 2H0GA 1RGAA 2XGNA 3BIRA 5D81A 1IVXA 4BL3A 1RJOA 1NB5I 2ZDJA 1BUJA 2RBIA 1UCKA 1STFI 1GY6A 2YFIB 4RNYA 2JQ5A 1J2BA 2HMLB 2HMMB 4KFDA 4Q53A 5AI1A 5EEOA 1JRQA 3UNLA 5IEPA 3DGMA 1TU5A 3ECFA 5CF2A 3LMLA 3WA3A 1GMQA 3AHSA 1Q7HA 1EA2A 3H51A 3LTCA 1R4YA 1RGFA 4FMBA 1AQZA 5FW5A 2YFLB 3STDA 1DE3A 4N6TA 1CEWI 3FCSB 1V57A 4FCJA 3SX1A 3IMAB 1BUQA 1K28A 1KSIA 2W04A 1IYYA 1UUGB 3CPOA 2CHCA 3FF0A 3FSDA 3MG1A 1TFOA 3NV0B 4MMXB 3NBRA 2Z77A 3EC9A 1JBSA 4WYKA 4X2HA 2K3DA 2GSPA 2P09A 5BVBA 3H3HA 1YHQ3 4CPKA 4WWUC 1W6CA 1IVWA 6STDA 1RSNA 3K7CA 5AEWB 3FGYA 4O02B 3DM8A 3PS8A 1EKMA 3MHEA 4FR9A 3HOHA 1GD4A 2CG1A 2BHMA 1S5AA 1LNIA 1RN4A 1BSCA 2CWUA 4BIRA 5I97A 1B21A 5JPPA 1JB2A 5CK6A 7STDA 1NNVA 1SIIA 1Q40B 1YNVX 5D82A 3D5GA 1X1YA 1DMMA 5IERA 1ULIB 1FGQA 1FZUA 4FMDA 2H0IA 3AMOA 1IT8A 1IQ8A 1D6YA 3RNTA 1OGXA 3SXXA 4MEIA 1NDOB 4BTYA 4EC6A 1DVDA 1YJ93 1OCVA 3D5IA 3SOAA 1UUWB 2BNGA 1W4NA 3F8XA 1A2PA 4MJDA 4N6MA 3PCSA 1N9JA 5BIRA 3F40A 5IEOA 3EBTA 1VQ43 1O7GB 1BSBA 4WHAA 1CYUA 4GB5A 5AEUB 3MYTA 4XBYA 1EUIC 2R41A 2F5WA 3WMDA 1GYBA 3CCR3 1D6ZA 5M1AA 1YVSA 1RGHA 3D3LA 1VQ93 1UGIA 2KRTA 1NU3A 5KP3A 1BAOA 1IVVA 4HM2B 3OW22 1M9GA 1V74A 3S29A 1MWUA 4KT3B 2FGTA 1K734 2J8XB 1PYLA 1QAKA 3WHOA 3NHXA 5KP1A 1VQO3 4LZIA 1WNHA 1UI8A 5IENA 1FUTA 2P05A 3JUPA 1GOVA 4HOHA 2QEX3 2QGUA 3F7SA 3EHCA 4RBNA 5HOHA 1SJWA 2CX1A 2XGLA 1BRGA 3OWUA 3DZLA 4R9KA 5AIFA 1GOYA 3I563 1Q7Y4 3PZWA 5FGOA 4EBGA 1MOLA 2CKFB 2D1WA 1QAFA 4IIAA 3JUOA 2IUJA 2INXA 2B1XB 3T8UA 3URPA 1B2UA 1VQ73 1IV7A 1OH0A 1TIJA 1RRLA 3KIIA 3CD63 4JRFA 1X1UA 1BNGA 2KCDA 3ER7A 1W01A 3CPW2 4LSOA 1K9M4 3S67A 4KVHA 2W6JH 4HZ9B 5LC6A 1I0XA 3S5CA 3CC23 1I3FA 2A15A 2K0MA 3MSOA 4XBXA 1OHOA 4WFOA 1GS3A 1M1K4 3KKGA 4ORLA 1RGEA 3SYUA 1QVG2 1W2ZA 3MG3A 1N5PA 4HM3B 3AGOA 1MGWA 1BRHA 3BNCA 3KCHA 1TUHA 2BMOB 1BNIA 3KSPA 2XF3A 2F5MA 3FZWA 4GSPA 4OVMA 8RNTA 1BNRA 3IJEB 1JBRA 2KF4A 1IU7A 4N6OB 5JBSA 1RCKA 2OTL3 1UW1A 1LVNA 1IVUA 2OOVC 1OF5A 2WOFA 1IDPA 5EVHA 1BRKA 1G96A 1GMRA 3A76A 1Q9EA 1BVIA 1B27A 1K41A 2GEXA 5ELJA 1US1A 4WYKB 1UCJA 1FGTA 3IPTA 2ZA4A 1B20A 3JUQA 1GY7A 2W03A 1I8VA 3SVAA 5AIIA 1JN5B 2CFDA 3NQZA 1O7PB 3OX9A 4LYLB 3V92A 2JDIH 1EQKA 3X3ZA 3CCM3 1UCIA 1JBTA 2B24B 3BNEA 3LZAA 3OV4A 3QK9A 3G4S3 1O7NB 4K61A 4WP5A 2QA43 3RGAA 2KF6A 2Z7AA 2E2UA 3MKIA 3CCV3 3HI7A 3BB9A 5GSPA 5IG0A 5KP4A 1B3SA 4L8OA 3HZPA 3DH2A 3FKAA 1JZDA 2I9WA 3GZBA 3NBBA 1YJW3 4HM4B 3Q3FA 3Q90A 1W6YA 3AMOB 2IMJA 1FYSA 3QRDA 1VZZA 5RNTA 5D83A 3GRDA 4CDLA 2ML6A 1E3VA 5BXQA 1S723 1MWRA 2L1SA 4NPBA 2XEPA 5IG5A 1B2MA 1D6UA 4FCZA 2F86B 4HBRA 3O8YA 1EG9B 1N8R4 1FGMA 2CC3A 2GU3A 4I5QA 2AADA 2CFKA 2W56B 1BNJA 2OOVA 1GOUA 5AYSC 3MWZA 2GEYA 1Q864 2V1LA 4KFFA 3UL6A 1RRHA 2PZVA 1NB3I 3F8HA 5IG3A 1JV2B 1KQS2 3CC43 1OHPA 2IUKA 1WMOA 4O2HA 3NBJA 2E2TA 2W2CA 1JJ22 3FG1A 2BU4A 2RCDA 3LTDA 1YGWA 2CWVA 1W7CA 4XDWA 3RGRA 1Q814 2GXFA 1I3IA 4LEHA 8CHOA 1QMAA 1RGKA 2R4IA 2YX9A 2OCTA 3CU3A 1RNBA 2RNTA 1TFKA 3LT9A 3DGYA 1UGHI 3DY5A 3SLUA 2RSXA 1YJN3 3EX9A 4HM5B 1I70A 3G8ZA 2BIRA 3DGLA 3LTBA 1M904 1TRPA 2XSOB 4H3UA 3GSPA 3KSED 4I4KA 3WA2X 4HVNA 1BSEA 4PEJA 3T0UA 1YI23 4CJNA 3B7CA 1BNSA 1KWIA 2XFSA 4XB5A 3CCU3 2E2VA 2IY2A 1RKYA 1IT7A 2WGOA 3S27A 2XH9A 2D42A 2O3OA 3V98A 1WTHA 1BANA 1LOXA 3DXOA 1BOXA 4KFEA 2H0HA 2CG0A 2W9PA 1Q40A 3JUMA 1Q42A 3EN1B 1VQQA 1HZ1A 3CMA3 4HM8B 1L5GB 1GSPA 3WOFB 1ISKA 2BMRB 1BIRA 1RHLA 1RMSA 2L4VA 4GL6A 2IYJA 3F14A 1B2SA 2OTJ3 2RFRA 3CC73 3U97A 1F8NA 4TX4A 4HZBB 1RTUA 2O9UX 3CXC2 3DGOA 4FMCA 3CCJ3 2UUGC 1RLSA 1ROAA 1T3BA 2SARA 5TGNA 2LQVA 4AKYA 2F98A 1EEJA 1W00A 2QIYA 3JUNA 3VGNA 5JPUA 3Q1CA 1OF5B 2Y74A 3NM2A 1PY3A 1QVF2 1X1WA 2C11A 3K9MC 5CLKA 2LYXA 3AHWA 1RDSA 2P38A 3OWYA 1DYUA 4EW5A 7GSPA 1N9EA 1BRSA 4BL2A 5M18A 1LNHA 3SEDA 3ZG0A 4G1MB 3LH4A 1BU4A 1QALA 5AYRB 2RGQA 1ULJB 1LOWA 1UCLA 2ZL8A 3G0KA 1VQ63 4OUQA 5CXOA 4XBTA 4NHFA 3EE1A 4AEQA 1BSDA 3VSYA 1KC84 3VF1A 3GZYB 1NO3A 5IW9A 2GU1A 2ZHXB 3HIGA 2FXTA 3EF8A 1W6GA 3X40A 1ZGXA 4K1UA 1O7MB 1Y4KA 1AV4A 1N8QA 3NXJA 4HM6B 3F9SA 1N5HA 3FG3A 5DREA 4HM7B 1X1XA 3LTAA 2XSHB 1RGGA 3MG2A 4ILFA 4LGQA 2OQEC 2CX0A 1I0VA 2IA7A 2K54A 1JZOA 2HMKB 3JVCA 5EQLA 1VQM3 2BMQB 1VQP3 2WOHA 1JKGA 1MNLA 3B4OA 1TJDA 1B2XA 4N6NB 3ZFZA 1JNQA 3WDGB 3J7Yd 1T2HA 1WQLB 3WOEB 4H61A 3CCQ3 1HYFA 1SARA 4J5GA 5G1KA 3NQYA 7RNTA 2HOHA 3DGNA
chains in the Genus database with same CATH topology
4KZ1A 3X41A 3EBYA 1HU9A 1RN7A 1GD3A 3MPHA 3D9RA 4IT7A 1FGRA 1U5OA 4QWTA 2BO9B 4XM4A 1OACA 4R4KA 2KXGA 2ML5A 4N6LA 3ALAA 3N8BA 1R4CA 2F99A 3PCRA 3NX0A 3LOYA 3SOYA 1FA3A 2GBXB 2M7OA 1E3RA 4XDVA 4HYZA 4N6V0 3M8CA 2W9QA 3TDGA 2GBWB 4K90B 2Y73A 3S28A 3T8NA 4RZMA 3X42A 1JB4A 1IK3A 3UJMA 1VQ53 2MF7A 1OPYA 5ELUA 3ROBA 3CME3 3FLJA 2UX0A 3BNDA 1VQN3 2HMNB 3N54B 3GAXA 4X2OA 4OK0A 1OGZA 3Q2PA 4L7KA 4N6UA 1IQXA 1C7HA 2XR8B 3BLZA 3E99A 3V99A 3I563 3CCR3 3EQQB 1SPUA 3K0ZA 1T5YA 3UL5A 4IPBA 1AVKA 1GY5A 1VQL3 4EXRA 4R80A 2OQEA 1E97A 3CNXA 1U8CB 3PYJA 4CCVA 1JN5A 1DVCA 3BNBA 4BTWA 1VQ83 3L0RA 1OHSA 1IV9A 1KD14 3GZXB 1YGEA 1WMNA 1SQWA 3EJVA 3K63A 1ZO2A 4NREA 2HMOB 1K8A4 4EV5A 3F7XA 3OXAA 2P0XA 3LYGA 3NV0A 3OWSA 4R9LA 3WODG 3HK4A 1CYVA 3LXUX 3EB8A 1LXEA 4N3VA 1JB5A 3RDEA 3FH1A 5AIGA 4L8PA 3K5TA 2CWTA 1TP6A 2WGQA 1HKXA 3HIIA 1ROVA 4RNZA 1ZX2A 1NJI4 3CCL3 3GWRA 3NUVA 5A0OB 2SBLA 4LMIA 1VQK3 3LT8A 4K1VA 1FGOA 2MC8A 4FCMA 2P0MA 1QJGA 1W02A 1W5ZA 3GZRA 4HJLB 2W56A 2Z76A 3CNMA 1M1XB 1PU4A 3I553 1UI7A 3B4PA 2BT3A 4J8TA 1WMPA 1YIT3 1O7WB 1DMNA 1PFPA 3B8LA 2WO0A 3PGBA 4O3VA 3X3YA 1IQYA 2XRXB 5HGRA 5LC7A 4J9AA 2Q07A 4JF8A 3G16A 2CFGA 3KN4A 5AIHA 3X3XA 3EN8A 4MMZB 5STDA 1CQSA 1YIJ3 2Z6BA 4MMYB 4BTXA 1Z1SA 4AKZA 4STDA 2STDA 4EV2A 5IG4A 1NWWA 1OUNA 3CCS3 3N9HA 1DMQA 1O7HB 4HM0B 4ZM8A 2CIUA 3CCE3 1AVLA 4HKVB 1SIHA 3KZTA 4HM1B 2OWPA 1JKGB 2W0QA 5G2GA 2CK3H 3G6E3 4FMAA 1STDA 2YFJB 3KE7A 3U1WA 2HMJB 1ASKA 1A67A 4R1KA 2FNQA 1A2KA 4O8SA 5DRVA 4EYCA 2PNCA 3I0YA 3KFQC 3G713 5CF1A 3PXMA 2CH9A 1FUWA 5IF6A 1W2B2 2CW9A 1A2VA 3NM7A 1AR0A 3DUKA 2CFWA 3FF2A 1Q824 1A90A 2CFLA 2XFTA 3UB1A 3FG4A 4U13A 1YVBI 2C10A 1UUVB 3DMCA 3HX8A 2XGNA 5D81A 1IVXA 1RJOA 2ZDJA 1STFI 1GY6A 2YFIB 4RNYA 2JQ5A 2HMLB 2HMMB 4KFDA 4Q53A 5AI1A 5EEOA 1JRQA 3UNLA 5IEPA 3DGMA 1TU5A 3ECFA 5CF2A 3LMLA 3WA3A 1EA2A 3H51A 3LTCA 4FMBA 5FW5A 2YFLB 3STDA 4N6TA 1CEWI 3FCSB 4FCJA 3SX1A 3IMAB 1BUQA 1K28A 1KSIA 2W04A 3CPOA 2CHCA 3FF0A 3FSDA 3MG1A 1TFOA 3NV0B 4MMXB 3NBRA 2Z77A 3EC9A 4WYKA 4X2HA 2P09A 5BVBA 3H3HA 1YHQ3 4WWUC 1W6CA 1IVWA 6STDA 3K7CA 5AEWB 3FGYA 4O02B 3DM8A 3PS8A 1EKMA 3MHEA 4FR9A 1GD4A 2CG1A 2BHMA 1S5AA 2CWUA 5I97A 5JPPA 1JB2A 5CK6A 7STDA 1SIIA 1Q40B 5D82A 5IERA 1DMMA 1ULIB 1FGQA 4FMDA 3AMOA 1IT8A 1IQ8A 1D6YA 1OGXA 3SXXA 4MEIA 1NDOB 4BTYA 4EC6A 1DVDA 1YJ93 1OCVA 3SOAA 1UUWB 2BNGA 1W4NA 3F8XA 4MJDA 4N6MA 3PCSA 1N9JA 3F40A 5IEOA 3EBTA 1VQ43 1O7GB 4WHAA 1CYUA 4GB5A 5AEUB 3MYTA 4XBYA 3WMDA 1GYBA 1D6ZA 3D3LA 1VQ93 2KRTA 1NU3A 5KP3A 1IVVA 4HM2B 3OW22 1M9GA 1V74A 3S29A 1K734 2FGTA 1QAKA 3NHXA 5KP1A 1VQO3 4LZIA 1WNHA 1UI8A 5IENA 2P05A 3JUPA 2QEX3 2QGUA 3F7SA 3EHCA 4RBNA 1SJWA 2XGLA 3OWUA 4R9KA 3DZLA 5AIFA 1Q7Y4 3PZWA 5FGOA 4EBGA 1MOLA 2CKFB 2D1WA 1QAFA 4IIAA 3JUOA 2IUJA 2INXA 2B1XB 3T8UA 1VQ73 1IV7A 1OH0A 1TIJA 1RRLA 3KIIA 3CD63 4JRFA 2KCDA 3ER7A 1W01A 3CPW2 4LSOA 1K9M4 3S67A 4KVHA 2W6JH 4HZ9B 5LC6A 3S5CA 3CC23 2A15A 2K0MA 3MSOA 4XBXA 1OHOA 4WFOA 1GS3A 1M1K4 3KKGA 4ORLA 1QVG2 1W2ZA 3MG3A 1N5PA 4HM3B 3BNCA 1TUHA 2BMOB 3KSPA 2XF3A 3FZWA 4OVMA 3IJEB 1IU7A 4N6OB 5JBSA 2OTL3 1UW1A 1LVNA 1IVUA 2OOVC 1OF5A 2WOFA 1IDPA 5EVHA 1G96A 3A76A 1K41A 2GEXA 5ELJA 1US1A 4WYKB 1FGTA 3IPTA 3JUQA 1GY7A 2W03A 3SVAA 5AIIA 1JN5B 2CFDA 3NQZA 1O7PB 3OX9A 3V92A 2JDIH 1EQKA 3X3ZA 3CCM3 2B24B 3BNEA 3LZAA 3OV4A 3QK9A 3G4S3 1O7NB 4K61A 4WP5A 2QA43 3RGAA 2Z7AA 2E2UA 3MKIA 3CCV3 3HI7A 3BB9A 5IG0A 5KP4A 4L8OA 3HZPA 3FKAA 2I9WA 3GZBA 3NBBA 1YJW3 4HM4B 3Q90A 1W6YA 3AMOB 2IMJA 3QRDA 1VZZA 5D83A 3GRDA 4CDLA 2ML6A 1E3VA 5BXQA 1S723 5IG5A 2XEPA 1D6UA 4FCZA 2F86B 4HBRA 3O8YA 1EG9B 1N8R4 1FGMA 2CC3A 2GU3A 2W56B 2CFKA 2OOVA 5AYSC 3MWZA 2GEYA 2V1LA 4KFFA 3UL6A 1RRHA 2PZVA 1NB3I 3F8HA 5IG3A 1JV2B 1KQS2 3CC43 1OHPA 2IUKA 1WMOA 4O2HA 3NBJA 2E2TA 2W2CA 1JJ22 3FG1A 2RCDA 3LTDA 4XDWA 2CWVA 1W7CA 3RGRA 1Q814 2GXFA 4LEHA 8CHOA 1QMAA 2R4IA 2YX9A 2OCTA 3CU3A 1TFKA 3LT9A 3DY5A 3SLUA 1YJN3 2RSXA 3EX9A 4HM5B 3G8ZA 3LTBA 3DGLA 1M904 2XSOB 4H3UA 4I4KA 3KSED 3WA2X 4HVNA 4PEJA 3T0UA 1YI23 3B7CA 1KWIA 2XFSA 4XB5A 3CCU3 2E2VA 1RKYA 1IT7A 2WGOA 3S27A 2XH9A 2D42A 2O3OA 3V98A 1WTHA 1LOXA 3DXOA 4KFEA 2CG0A 2W9PA 1Q40A 3JUMA 1Q42A 3EN1B 3CMA3 4HM8B 1L5GB 3WOFB 1ISKA 2BMRB 2L4VA 4GL6A 3F14A 2OTJ3 2RFRA 3CC73 3U97A 1F8NA 4TX4A 4HZBB 2O9UX 3CXC2 3DGOA 4FMCA 3CCJ3 1ROAA 5TGNA 2LQVA 4AKYA 2F98A 1W00A 2QIYA 3JUNA 3VGNA 5JPUA 3Q1CA 1OF5B 2Y74A 3NM2A 1QVF2 3K9MC 2C11A 5CLKA 2LYXA 2P38A 3OWYA 1DYUA 1N9EA 1LNHA 3SEDA 4G1MB 3LH4A 1QALA 5AYRB 2RGQA 1ULJB 2ZL8A 3G0KA 1VQ63 4OUQA 5CXOA 4XBTA 4NHFA 3EE1A 4AEQA 3VSYA 1KC84 3VF1A 3GZYB 1NO3A 5IW9A 2GU1A 3HIGA 2FXTA 3EF8A 1W6GA 3X40A 4K1UA 1O7MB 1Y4KA 1AV4A 1N8QA 3NXJA 4HM6B 3F9SA 1N5HA 3FG3A 5DREA 4HM7B 3LTAA 2XSHB 3MG2A 4LGQA 1NB5I 2OQEC 3JVCA 5EQLA 2IA7A 2K54A 2HMKB 1VQM3 1VQP3 2BMQB 2WOHA 1JKGA 1MNLA 3B4OA 4N6NB 1JNQA 3WDGB 3J7Yd 1WQLB 3WOEB 4H61A 3CCQ3 1Q864 3NQYA 1J2BA 3DGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBY A;  3D9R A;  1U5O A;  4XM4 A;  2F99 A;  3SOY A;  2GBX B;  1E3R A;  4XDV A;  3M8C A;  2GBW B;  3T8N A;  4RZM A;  1JB4 A;  3UJM A;  1OPY A;  3ROB A;  3FLJ A;  2UX0 A;  2HMN B;  4X2O A;  1OGZ A;  4L7K A;  1C7H A;  2XR8 B;  3BLZ A;  3E99 A;  3EQQ B;  3K0Z A;  1GY5 A;  1E97 A;  3CNX A;  1JN5 A;  1OHS A;  3GZX B;  3EJV A;  1ZO2 A;  2HMO B;  3F7X A;  3OXA A;  3LYG A;  3NV0 A;  3OWS A;  4R9L A;  3HK4 A;  4N3V A;  1JB5 A;  3FH1 A;  5AIG A;  4L8P A;  1TP6 A;  1HKX A;  1ZX2 A;  3GWR A;  3NUV A;  4LMI A;  4K1V A;  4FCM A;  1QJG A;  1W02 A;  3GZR A;  4HJL B;  2Z76 A;  3CNM A;  3B4P A;  4J8T A;  1O7W B;  1DMN A;  3B8L A;  2XRX B;  5HGR A;  4J9A A;  3G16 A;  5AIH A;  3EN8 A;  5STD A;  1CQS A;  1Z1S A;  4STD A;  2STD A;  5IG4 A;  1NWW A;  1OUN A;  1DMQ A;  1O7H B;  4HM0 B;  4HKV B;  4HM1 B;  3KZT A;  2OWP A;  1JKG B;  5G2G A;  1STD A;  2YFJ B;  3KE7 A;  2HMJ B;  1ASK A;  4R1K A;  1A2K A;  5DRV A;  3I0Y A;  5CF1 A;  5IF6 A;  1AR0 A;  3DUK A;  3FF2 A;  4U13 A;  1UUV B;  3DMC A;  3HX8 A;  5D81 A;  2YFI B;  1GY6 A;  2JQ5 A;  2HML B;  2HMM B;  4Q53 A;  5AI1 A;  3UNL A;  5IEP A;  3ECF A;  5CF2 A;  1EA2 A;  3H51 A;  5FW5 A;  2YFL B;  3STD A;  4FCJ A;  1BUQ A;  3CPO A;  2CHC A;  3FF0 A;  3FSD A;  3MG1 A;  3NV0 B;  3NBR A;  2Z77 A;  3EC9 A;  4WYK A;  4X2H A;  5BVB A;  3H3H A;  4WWU C;  6STD A;  3K7C A;  5AEW B;  3FGY A;  3DM8 A;  3MHE A;  1S5A A;  5JPP A;  1JB2 A;  5CK6 A;  7STD A;  1Q40 B;  5D82 A;  5IER A;  1DMM A;  1ULI B;  1OGX A;  1NDO B;  1OCV A;  3SOA A;  1UUW B;  2BNG A;  3F8X A;  4MJD A;  3F40 A;  5IEO A;  3EBT A;  1O7G B;  4GB5 A;  5AEU B;  3MYT A;  4XBY A;  3WMD A;  1GYB A;  5KP3 A;  1NU3 A;  4HM2 B;  3NHX A;  5KP1 A;  5IEN A;  3JUP A;  2QGU A;  3F7S A;  3EHC A;  1SJW A;  3OWU A;  4R9K A;  3DZL A;  5AIF A;  2CKF B;  4IIA A;  3T8U A;  3JUO A;  2INX A;  2B1X B;  1OH0 A;  3ER7 A;  1W01 A;  4KVH A;  4HZ9 B;  3S5C A;  2A15 A;  3MSO A;  4XBX A;  1OHO A;  1GS3 A;  3KKG A;  4ORL A;  3MG3 A;  4HM3 B;  1TUH A;  2BMO B;  3KSP A;  3FZW A;  4OVM A;  1OF5 A;  1IDP A;  5EVH A;  3A76 A;  1K41 A;  2GEX A;  4WYK B;  3IPT A;  3JUQ A;  1GY7 A;  5AII A;  1JN5 B;  3OX9 A;  1O7P B;  2B24 B;  3OV4 A;  3LZA A;  1O7N B;  4WP5 A;  3RGA A;  2Z7A A;  3MKI A;  3BB9 A;  5IG0 A;  5KP4 A;  4L8O A;  3HZP A;  3FKA A;  2I9W A;  3GZB A;  4HM4 B;  3Q90 A;  1W6Y A;  2IMJ A;  1VZZ A;  5D83 A;  3GRD A;  4CDL A;  5BXQ A;  1E3V A;  5IG5 A;  2F86 B;  1EG9 B;  2GEY A;  2PZV A;  3F8H A;  5IG3 A;  1OHP A;  2W2C A;  2RCD A;  4XDW A;  3RGR A;  2GXF A;  4LEH A;  8CHO A;  1QMA A;  2R4I A;  3CU3 A;  3EX9 A;  4HM5 B;  3G8Z A;  2XSO B;  4H3U A;  4I4K A;  4HVN A;  4PEJ A;  3B7C A;  4XB5 A;  3DXO A;  1Q40 A;  3JUM A;  1Q42 A;  3EN1 B;  4HM8 B;  1ISK A;  2BMR B;  3F14 A;  2RFR A;  4HZB B;  5TGN A;  2F98 A;  1W00 A;  2QIY A;  3JUN A;  3VGN A;  5JPU A;  1OF5 B;  3NM2 A;  5CLK A;  3OWY A;  3SED A;  2RGQ A;  1ULJ B;  3G0K A;  4OUQ A;  5CXO A;  4XBT A;  3VSY A;  3GZY B;  3EF8 A;  4K1U A;  1O7M B;  3NXJ A;  4HM6 B;  3F9S A;  5DRE A;  4HM7 B;  2XSH B;  3MG2 A;  4LGQ A;  2K54 A;  2HMK B;  2BMQ B;  3B4O A;  1JKG A;  1WQL B; 
#chains in the Genus database with same CATH topology
 4KZ1 A;  3X41 A;  3EBY A;  1HU9 A;  1RN7 A;  1GD3 A;  3MPH A;  2UGI A;  3D9R A;  1FUS A;  1FGR A;  4IT7 A;  1U5O A;  4QWT A;  2BO9 B;  4XM4 A;  1OAC A;  4R4K A;  2KXG A;  2ML5 A;  4N6L A;  3ALA A;  3N8B A;  1R4C A;  2F99 A;  1LOY A;  3PCR A;  3NX0 A;  3LOY A;  3SOY A;  1FA3 A;  2GBX B;  2M7O A;  1E3R A;  4XDV A;  4HYZ A;  4N6V 0;  3M8C A;  1V58 A;  2W9Q A;  3TDG A;  2GBW B;  4K90 B;  1AY7 A;  2Y73 A;  3S28 A;  3T8N A;  4RZM A;  3X42 A;  1JB4 A;  1IK3 A;  3UJM A;  1VQ5 3;  2KF5 A;  2MF7 A;  1OPY A;  5ELU A;  2AAE A;  3D4A A;  3ROB A;  5M19 A;  1LQG C;  1RCL A;  3CME 3;  3FLJ A;  2UX0 A;  3BND A;  1VQN 3;  2HMN B;  3N54 B;  3GAX A;  4X2O A;  1LQM B;  1LRA A;  4OK0 A;  1OGZ A;  3Q2P A;  4L7K A;  1LOV A;  4N6U A;  1IQX A;  1RGC A;  1BSA A;  1C7H A;  2XR8 B;  3BLZ A;  3E99 A;  2F56 A;  3V99 A;  6RNT A;  3EQQ B;  1SPU A;  3K0Z A;  1T5Y A;  3UL5 A;  4IPB A;  1AVK A;  1GY5 A;  1VQL 3;  4GHO A;  4R80 A;  2OQE A;  4EXR A;  1E97 A;  3CNX A;  1U8C B;  3PYJ A;  3WR2 A;  4CCV A;  1JN5 A;  1DVC A;  3BNB A;  4BTW A;  1VQ8 3;  3L0R A;  1OHS A;  1IV9 A;  1KD1 4;  1CH0 A;  1I2F A;  1BNF A;  3GZX B;  1YGE A;  1WMN A;  1SQW A;  3BU4 A;  3EJV A;  3K63 A;  1FW7 A;  3D79 A;  1ZO2 A;  4NRE A;  2HMO B;  1K8A 4;  4EV5 A;  2F4Y A;  3F7X A;  3OXA A;  2P0X A;  3LYG A;  3NV0 A;  3OWS A;  4R9L A;  3WOD G;  3HK4 A;  1CYV A;  3LXU X;  3EB8 A;  1LXE A;  1T2I A;  4N3V A;  1JB5 A;  3RDE A;  3FH1 A;  5AIG A;  4L8P A;  3K5T A;  2CWT A;  1TP6 A;  2WGQ A;  3AGN A;  1HKX A;  3HII A;  1ROV A;  4RNZ A;  1GMP A;  1ZX2 A;  1NJI 4;  3CCL 3;  1MWT A;  3GWR A;  1MGR A;  3NUV A;  2SBL A;  5A0O B;  4LMI A;  1VQK 3;  3LT8 A;  3A5E A;  4K1V A;  1FGO A;  2MC8 A;  4FCM A;  2P0M A;  1QJG A;  1B2Z A;  1W02 A;  1W5Z A;  3GZR A;  4HJL B;  1DET A;  3ZG5 A;  4J5K A;  2W56 A;  2Z76 A;  3CNM A;  1M1X B;  1PU4 A;  3I55 3;  1UI7 A;  1C54 A;  3B4P A;  2BT3 A;  4HAA A;  1WMP A;  1ZS7 A;  4J8T A;  6GSP A;  1YIT 3;  1O7W B;  1DMN A;  1PFP A;  3B8L A;  2WO0 A;  3PGB A;  4O3V A;  3X3Y A;  1IQY A;  2XRX B;  5HGR A;  5LC7 A;  4J9A A;  2Q07 A;  4JF8 A;  3G16 A;  2CFG A;  3KN4 A;  5AIH A;  3X3X A;  1BRI A;  3EN8 A;  1BNE A;  1BGS A;  4MMZ B;  5STD A;  1CQS A;  1YIJ 3;  2Z6B A;  4MMY B;  1G02 A;  4BTX A;  1Z1S A;  4AKZ A;  4STD A;  2STD A;  4EV2 A;  5IG4 A;  1NWW A;  1TRQ A;  1I2E A;  1OUN A;  2KAA A;  3CCS 3;  3N9H A;  1DMQ A;  9RNT A;  2KF3 A;  5G1L A;  1I2G A;  1O7H B;  1RGL A;  1TTO A;  1G0T A;  2CIU A;  4HM0 B;  4DKI A;  1AVL A;  4ZM8 A;  3CCE 3;  4HKV B;  1SIH A;  3KZT A;  4HM1 B;  2OWP A;  1JKG B;  2W0Q A;  5G2G A;  2CK3 H;  3G6E 3;  4FMA A;  1RNT A;  4RNT A;  1STD A;  1UDI I;  2YFJ B;  3KE7 A;  1BRN L;  3U1W A;  2HMJ B;  1ASK A;  1A67 A;  4R1K A;  1RN1 A;  2FNQ A;  5BU4 A;  1A2K A;  4O8S A;  5DRV A;  4EYC A;  2PNC A;  3I0Y A;  3KFQ C;  3G71 3;  5CF1 A;  3PXM A;  2CH9 A;  1FUW A;  5IF6 A;  1W2B 2;  2CW9 A;  1A2V A;  3NM7 A;  1AR0 A;  3DUK A;  2CFW A;  1BRJ A;  2C4B A;  3FF2 A;  1Q82 4;  2CFL A;  1A90 A;  2XFT A;  3UB1 A;  3FG4 A;  4U13 A;  1MWS A;  4BU4 A;  1YVB I;  2C10 A;  1UUV B;  3DMC A;  3HX8 A;  2H0G A;  1RGA A;  2XGN A;  3BIR A;  5D81 A;  1IVX A;  4BL3 A;  1RJO A;  1NB5 I;  2ZDJ A;  1BUJ A;  2RBI A;  1UCK A;  1STF I;  1GY6 A;  2YFI B;  4RNY A;  2JQ5 A;  1J2B A;  2HML B;  2HMM B;  4KFD A;  4Q53 A;  5AI1 A;  5EEO A;  1JRQ A;  3UNL A;  5IEP A;  3DGM A;  1TU5 A;  3ECF A;  5CF2 A;  3LML A;  3WA3 A;  1GMQ A;  3AHS A;  1Q7H A;  1EA2 A;  3H51 A;  3LTC A;  1R4Y A;  1RGF A;  4FMB A;  1AQZ A;  5FW5 A;  2YFL B;  3STD A;  1DE3 A;  4N6T A;  1CEW I;  3FCS B;  1V57 A;  4FCJ A;  3SX1 A;  3IMA B;  1BUQ A;  1K28 A;  1KSI A;  2W04 A;  1IYY A;  1UUG B;  3CPO A;  2CHC A;  3FF0 A;  3FSD A;  3MG1 A;  1TFO A;  3NV0 B;  4MMX B;  3NBR A;  2Z77 A;  3EC9 A;  1JBS A;  4WYK A;  4X2H A;  2K3D A;  2GSP A;  2P09 A;  5BVB A;  3H3H A;  1YHQ 3;  4CPK A;  4WWU C;  1W6C A;  1IVW A;  6STD A;  1RSN A;  3K7C A;  5AEW B;  3FGY A;  4O02 B;  3DM8 A;  3PS8 A;  1EKM A;  3MHE A;  4FR9 A;  3HOH A;  1GD4 A;  2CG1 A;  2BHM A;  1S5A A;  1LNI A;  1RN4 A;  1BSC A;  2CWU A;  4BIR A;  5I97 A;  1B21 A;  5JPP A;  1JB2 A;  5CK6 A;  7STD A;  1NNV A;  1SII A;  1Q40 B;  1YNV X;  5D82 A;  3D5G A;  1X1Y A;  1DMM A;  5IER A;  1ULI B;  1FGQ A;  1FZU A;  4FMD A;  2H0I A;  3AMO A;  1IT8 A;  1IQ8 A;  1D6Y A;  3RNT A;  1OGX A;  3SXX A;  4MEI A;  1NDO B;  4BTY A;  4EC6 A;  1DVD A;  1YJ9 3;  1OCV A;  3D5I A;  3SOA A;  1UUW B;  2BNG A;  1W4N A;  3F8X A;  1A2P A;  4MJD A;  4N6M A;  3PCS A;  1N9J A;  5BIR A;  3F40 A;  5IEO A;  3EBT A;  1VQ4 3;  1O7G B;  1BSB A;  4WHA A;  1CYU A;  4GB5 A;  5AEU B;  3MYT A;  4XBY A;  1EUI C;  2R41 A;  2F5W A;  3WMD A;  1GYB A;  3CCR 3;  1D6Z A;  5M1A A;  1YVS A;  1RGH A;  3D3L A;  1VQ9 3;  1UGI A;  2KRT A;  1NU3 A;  5KP3 A;  1BAO A;  1IVV A;  4HM2 B;  3OW2 2;  1M9G A;  1V74 A;  3S29 A;  1MWU A;  4KT3 B;  2FGT A;  1K73 4;  2J8X B;  1PYL A;  1QAK A;  3WHO A;  3NHX A;  5KP1 A;  1VQO 3;  4LZI A;  1WNH A;  1UI8 A;  5IEN A;  1FUT A;  2P05 A;  3JUP A;  1GOV A;  4HOH A;  2QEX 3;  2QGU A;  3F7S A;  3EHC A;  4RBN A;  5HOH A;  1SJW A;  2CX1 A;  2XGL A;  1BRG A;  3OWU A;  3DZL A;  4R9K A;  5AIF A;  1GOY A;  3I56 3;  1Q7Y 4;  3PZW A;  5FGO A;  4EBG A;  1MOL A;  2CKF B;  2D1W A;  1QAF A;  4IIA A;  3JUO A;  2IUJ A;  2INX A;  2B1X B;  3T8U A;  3URP A;  1B2U A;  1VQ7 3;  1IV7 A;  1OH0 A;  1TIJ A;  1RRL A;  3KII A;  3CD6 3;  4JRF A;  1X1U A;  1BNG A;  2KCD A;  3ER7 A;  1W01 A;  3CPW 2;  4LSO A;  1K9M 4;  3S67 A;  4KVH A;  2W6J H;  4HZ9 B;  5LC6 A;  1I0X A;  3S5C A;  3CC2 3;  1I3F A;  2A15 A;  2K0M A;  3MSO A;  4XBX A;  1OHO A;  4WFO A;  1GS3 A;  1M1K 4;  3KKG A;  4ORL A;  1RGE A;  3SYU A;  1QVG 2;  1W2Z A;  3MG3 A;  1N5P A;  4HM3 B;  3AGO A;  1MGW A;  1BRH A;  3BNC A;  3KCH A;  1TUH A;  2BMO B;  1BNI A;  3KSP A;  2XF3 A;  2F5M A;  3FZW A;  4GSP A;  4OVM A;  8RNT A;  1BNR A;  3IJE B;  1JBR A;  2KF4 A;  1IU7 A;  4N6O B;  5JBS A;  1RCK A;  2OTL 3;  1UW1 A;  1LVN A;  1IVU A;  2OOV C;  1OF5 A;  2WOF A;  1IDP A;  5EVH A;  1BRK A;  1G96 A;  1GMR A;  3A76 A;  1Q9E A;  1BVI A;  1B27 A;  1K41 A;  2GEX A;  5ELJ A;  1US1 A;  4WYK B;  1UCJ A;  1FGT A;  3IPT A;  2ZA4 A;  1B20 A;  3JUQ A;  1GY7 A;  2W03 A;  1I8V A;  3SVA A;  5AII A;  1JN5 B;  2CFD A;  3NQZ A;  1O7P B;  3OX9 A;  4LYL B;  3V92 A;  2JDI H;  1EQK A;  3X3Z A;  3CCM 3;  1UCI A;  1JBT A;  2B24 B;  3BNE A;  3LZA A;  3OV4 A;  3QK9 A;  3G4S 3;  1O7N B;  4K61 A;  4WP5 A;  2QA4 3;  3RGA A;  2KF6 A;  2Z7A A;  2E2U A;  3MKI A;  3CCV 3;  3HI7 A;  3BB9 A;  5GSP A;  5IG0 A;  5KP4 A;  1B3S A;  4L8O A;  3HZP A;  3DH2 A;  3FKA A;  1JZD A;  2I9W A;  3GZB A;  3NBB A;  1YJW 3;  4HM4 B;  3Q3F A;  3Q90 A;  1W6Y A;  3AMO B;  2IMJ A;  1FYS A;  3QRD A;  1VZZ A;  5RNT A;  5D83 A;  3GRD A;  4CDL A;  2ML6 A;  1E3V A;  5BXQ A;  1S72 3;  1MWR A;  2L1S A;  4NPB A;  2XEP A;  5IG5 A;  1B2M A;  1D6U A;  4FCZ A;  2F86 B;  4HBR A;  3O8Y A;  1EG9 B;  1N8R 4;  1FGM A;  2CC3 A;  2GU3 A;  4I5Q A;  2AAD A;  2CFK A;  2W56 B;  1BNJ A;  2OOV A;  1GOU A;  5AYS C;  3MWZ A;  2GEY A;  1Q86 4;  2V1L A;  4KFF A;  3UL6 A;  1RRH A;  2PZV A;  1NB3 I;  3F8H A;  5IG3 A;  1JV2 B;  1KQS 2;  3CC4 3;  1OHP A;  2IUK A;  1WMO A;  4O2H A;  3NBJ A;  2E2T A;  2W2C A;  1JJ2 2;  3FG1 A;  2BU4 A;  2RCD A;  3LTD A;  1YGW A;  2CWV A;  1W7C A;  4XDW A;  3RGR A;  1Q81 4;  2GXF A;  1I3I A;  4LEH A;  8CHO A;  1QMA A;  1RGK A;  2R4I A;  2YX9 A;  2OCT A;  3CU3 A;  1RNB A;  2RNT A;  1TFK A;  3LT9 A;  3DGY A;  1UGH I;  3DY5 A;  3SLU A;  2RSX A;  1YJN 3;  3EX9 A;  4HM5 B;  1I70 A;  3G8Z A;  2BIR A;  3DGL A;  3LTB A;  1M90 4;  1TRP A;  2XSO B;  4H3U A;  3GSP A;  3KSE D;  4I4K A;  3WA2 X;  4HVN A;  1BSE A;  4PEJ A;  3T0U A;  1YI2 3;  4CJN A;  3B7C A;  1BNS A;  1KWI A;  2XFS A;  4XB5 A;  3CCU 3;  2E2V A;  2IY2 A;  1RKY A;  1IT7 A;  2WGO A;  3S27 A;  2XH9 A;  2D42 A;  2O3O A;  3V98 A;  1WTH A;  1BAN A;  1LOX A;  3DXO A;  1BOX A;  4KFE A;  2H0H A;  2CG0 A;  2W9P A;  1Q40 A;  3JUM A;  1Q42 A;  3EN1 B;  1VQQ A;  1HZ1 A;  3CMA 3;  4HM8 B;  1L5G B;  1GSP A;  3WOF B;  1ISK A;  2BMR B;  1BIR A;  1RHL A;  1RMS A;  2L4V A;  4GL6 A;  2IYJ A;  3F14 A;  1B2S A;  2OTJ 3;  2RFR A;  3CC7 3;  3U97 A;  1F8N A;  4TX4 A;  4HZB B;  1RTU A;  2O9U X;  3CXC 2;  3DGO A;  4FMC A;  3CCJ 3;  2UUG C;  1RLS A;  1ROA A;  1T3B A;  2SAR A;  5TGN A;  2LQV A;  4AKY A;  2F98 A;  1EEJ A;  1W00 A;  2QIY A;  3JUN A;  3VGN A;  5JPU A;  3Q1C A;  1OF5 B;  2Y74 A;  3NM2 A;  1PY3 A;  1QVF 2;  1X1W A;  2C11 A;  3K9M C;  5CLK A;  2LYX A;  3AHW A;  1RDS A;  2P38 A;  3OWY A;  1DYU A;  4EW5 A;  7GSP A;  1N9E A;  1BRS A;  4BL2 A;  5M18 A;  1LNH A;  3SED A;  3ZG0 A;  4G1M B;  3LH4 A;  1BU4 A;  1QAL A;  5AYR B;  2RGQ A;  1ULJ B;  1LOW A;  1UCL A;  2ZL8 A;  3G0K A;  1VQ6 3;  4OUQ A;  5CXO A;  4XBT A;  4NHF A;  3EE1 A;  4AEQ A;  1BSD A;  3VSY A;  1KC8 4;  3VF1 A;  3GZY B;  1NO3 A;  5IW9 A;  2GU1 A;  2ZHX B;  3HIG A;  2FXT A;  3EF8 A;  1W6G A;  3X40 A;  1ZGX A;  4K1U A;  1O7M B;  1Y4K A;  1AV4 A;  1N8Q A;  3NXJ A;  4HM6 B;  3F9S A;  1N5H A;  3FG3 A;  5DRE A;  4HM7 B;  1X1X A;  3LTA A;  2XSH B;  1RGG A;  3MG2 A;  4ILF A;  4LGQ A;  2OQE C;  2CX0 A;  1I0V A;  2IA7 A;  2K54 A;  1JZO A;  2HMK B;  3JVC A;  5EQL A;  1VQM 3;  2BMQ B;  1VQP 3;  2WOH A;  1JKG A;  1MNL A;  3B4O A;  1TJD A;  1B2X A;  4N6N B;  3ZFZ A;  1JNQ A;  3WDG B;  3J7Y d;  1T2H A;  1WQL B;  3WOE B;  4H61 A;  3CCQ 3;  1HYF A;  1SAR A;  4J5G A;  5G1K A;  3NQY A;  7RNT A;  2HOH A;  3DGN A; 
#chains in the Genus database with same CATH homology
 4KZ1 A;  3X41 A;  3EBY A;  1HU9 A;  1RN7 A;  1GD3 A;  3MPH A;  3D9R A;  4IT7 A;  1FGR A;  1U5O A;  4QWT A;  2BO9 B;  4XM4 A;  1OAC A;  4R4K A;  2KXG A;  2ML5 A;  4N6L A;  3ALA A;  3N8B A;  1R4C A;  2F99 A;  3PCR A;  3NX0 A;  3LOY A;  3SOY A;  1FA3 A;  2GBX B;  2M7O A;  1E3R A;  4XDV A;  4HYZ A;  4N6V 0;  3M8C A;  2W9Q A;  3TDG A;  2GBW B;  4K90 B;  2Y73 A;  3S28 A;  3T8N A;  4RZM A;  3X42 A;  1JB4 A;  1IK3 A;  3UJM A;  1VQ5 3;  2MF7 A;  1OPY A;  5ELU A;  3ROB A;  3CME 3;  3FLJ A;  2UX0 A;  3BND A;  1VQN 3;  2HMN B;  3N54 B;  3GAX A;  4X2O A;  4OK0 A;  1OGZ A;  3Q2P A;  4L7K A;  4N6U A;  1IQX A;  1C7H A;  2XR8 B;  3BLZ A;  3E99 A;  3V99 A;  3I56 3;  3CCR 3;  3EQQ B;  1SPU A;  3K0Z A;  1T5Y A;  3UL5 A;  4IPB A;  1AVK A;  1GY5 A;  1VQL 3;  4EXR A;  4R80 A;  2OQE A;  1E97 A;  3CNX A;  1U8C B;  3PYJ A;  4CCV A;  1JN5 A;  1DVC A;  3BNB A;  4BTW A;  1VQ8 3;  3L0R A;  1OHS A;  1IV9 A;  1KD1 4;  3GZX B;  1YGE A;  1WMN A;  1SQW A;  3EJV A;  3K63 A;  1ZO2 A;  4NRE A;  2HMO B;  1K8A 4;  4EV5 A;  3F7X A;  3OXA A;  2P0X A;  3LYG A;  3NV0 A;  3OWS A;  4R9L A;  3WOD G;  3HK4 A;  1CYV A;  3LXU X;  3EB8 A;  1LXE A;  4N3V A;  1JB5 A;  3RDE A;  3FH1 A;  5AIG A;  4L8P A;  3K5T A;  2CWT A;  1TP6 A;  2WGQ A;  1HKX A;  3HII A;  1ROV A;  4RNZ A;  1ZX2 A;  1NJI 4;  3CCL 3;  3GWR A;  3NUV A;  5A0O B;  2SBL A;  4LMI A;  1VQK 3;  3LT8 A;  4K1V A;  1FGO A;  2MC8 A;  4FCM A;  2P0M A;  1QJG A;  1W02 A;  1W5Z A;  3GZR A;  4HJL B;  2W56 A;  2Z76 A;  3CNM A;  1M1X B;  1PU4 A;  3I55 3;  1UI7 A;  3B4P A;  2BT3 A;  4J8T A;  1WMP A;  1YIT 3;  1O7W B;  1DMN A;  1PFP A;  3B8L A;  2WO0 A;  3PGB A;  4O3V A;  3X3Y A;  1IQY A;  2XRX B;  5HGR A;  5LC7 A;  4J9A A;  2Q07 A;  4JF8 A;  3G16 A;  2CFG A;  3KN4 A;  5AIH A;  3X3X A;  3EN8 A;  4MMZ B;  5STD A;  1CQS A;  1YIJ 3;  2Z6B A;  4MMY B;  4BTX A;  1Z1S A;  4AKZ A;  4STD A;  2STD A;  4EV2 A;  5IG4 A;  1NWW A;  1OUN A;  3CCS 3;  3N9H A;  1DMQ A;  1O7H B;  4HM0 B;  4ZM8 A;  2CIU A;  3CCE 3;  1AVL A;  4HKV B;  1SIH A;  3KZT A;  4HM1 B;  2OWP A;  1JKG B;  2W0Q A;  5G2G A;  2CK3 H;  3G6E 3;  4FMA A;  1STD A;  2YFJ B;  3KE7 A;  3U1W A;  2HMJ B;  1ASK A;  1A67 A;  4R1K A;  2FNQ A;  1A2K A;  4O8S A;  5DRV A;  4EYC A;  2PNC A;  3I0Y A;  3KFQ C;  3G71 3;  5CF1 A;  3PXM A;  2CH9 A;  1FUW A;  5IF6 A;  1W2B 2;  2CW9 A;  1A2V A;  3NM7 A;  1AR0 A;  3DUK A;  2CFW A;  3FF2 A;  1Q82 4;  1A90 A;  2CFL A;  2XFT A;  3UB1 A;  3FG4 A;  4U13 A;  1YVB I;  2C10 A;  1UUV B;  3DMC A;  3HX8 A;  2XGN A;  5D81 A;  1IVX A;  1RJO A;  2ZDJ A;  1STF I;  1GY6 A;  2YFI B;  4RNY A;  2JQ5 A;  2HML B;  2HMM B;  4KFD A;  4Q53 A;  5AI1 A;  5EEO A;  1JRQ A;  3UNL A;  5IEP A;  3DGM A;  1TU5 A;  3ECF A;  5CF2 A;  3LML A;  3WA3 A;  1EA2 A;  3H51 A;  3LTC A;  4FMB A;  5FW5 A;  2YFL B;  3STD A;  4N6T A;  1CEW I;  3FCS B;  4FCJ A;  3SX1 A;  3IMA B;  1BUQ A;  1K28 A;  1KSI A;  2W04 A;  3CPO A;  2CHC A;  3FF0 A;  3FSD A;  3MG1 A;  1TFO A;  3NV0 B;  4MMX B;  3NBR A;  2Z77 A;  3EC9 A;  4WYK A;  4X2H A;  2P09 A;  5BVB A;  3H3H A;  1YHQ 3;  4WWU C;  1W6C A;  1IVW A;  6STD A;  3K7C A;  5AEW B;  3FGY A;  4O02 B;  3DM8 A;  3PS8 A;  1EKM A;  3MHE A;  4FR9 A;  1GD4 A;  2CG1 A;  2BHM A;  1S5A A;  2CWU A;  5I97 A;  5JPP A;  1JB2 A;  5CK6 A;  7STD A;  1SII A;  1Q40 B;  5D82 A;  5IER A;  1DMM A;  1ULI B;  1FGQ A;  4FMD A;  3AMO A;  1IT8 A;  1IQ8 A;  1D6Y A;  1OGX A;  3SXX A;  4MEI A;  1NDO B;  4BTY A;  4EC6 A;  1DVD A;  1YJ9 3;  1OCV A;  3SOA A;  1UUW B;  2BNG A;  1W4N A;  3F8X A;  4MJD A;  4N6M A;  3PCS A;  1N9J A;  3F40 A;  5IEO A;  3EBT A;  1VQ4 3;  1O7G B;  4WHA A;  1CYU A;  4GB5 A;  5AEU B;  3MYT A;  4XBY A;  3WMD A;  1GYB A;  1D6Z A;  3D3L A;  1VQ9 3;  2KRT A;  1NU3 A;  5KP3 A;  1IVV A;  4HM2 B;  3OW2 2;  1M9G A;  1V74 A;  3S29 A;  1K73 4;  2FGT A;  1QAK A;  3NHX A;  5KP1 A;  1VQO 3;  4LZI A;  1WNH A;  1UI8 A;  5IEN A;  2P05 A;  3JUP A;  2QEX 3;  2QGU A;  3F7S A;  3EHC A;  4RBN A;  1SJW A;  2XGL A;  3OWU A;  4R9K A;  3DZL A;  5AIF A;  1Q7Y 4;  3PZW A;  5FGO A;  4EBG A;  1MOL A;  2CKF B;  2D1W A;  1QAF A;  4IIA A;  3JUO A;  2IUJ A;  2INX A;  2B1X B;  3T8U A;  1VQ7 3;  1IV7 A;  1OH0 A;  1TIJ A;  1RRL A;  3KII A;  3CD6 3;  4JRF A;  2KCD A;  3ER7 A;  1W01 A;  3CPW 2;  4LSO A;  1K9M 4;  3S67 A;  4KVH A;  2W6J H;  4HZ9 B;  5LC6 A;  3S5C A;  3CC2 3;  2A15 A;  2K0M A;  3MSO A;  4XBX A;  1OHO A;  4WFO A;  1GS3 A;  1M1K 4;  3KKG A;  4ORL A;  1QVG 2;  1W2Z A;  3MG3 A;  1N5P A;  4HM3 B;  3BNC A;  1TUH A;  2BMO B;  3KSP A;  2XF3 A;  3FZW A;  4OVM A;  3IJE B;  1IU7 A;  4N6O B;  5JBS A;  2OTL 3;  1UW1 A;  1LVN A;  1IVU A;  2OOV C;  1OF5 A;  2WOF A;  1IDP A;  5EVH A;  1G96 A;  3A76 A;  1K41 A;  2GEX A;  5ELJ A;  1US1 A;  4WYK B;  1FGT A;  3IPT A;  3JUQ A;  1GY7 A;  2W03 A;  3SVA A;  5AII A;  1JN5 B;  2CFD A;  3NQZ A;  1O7P B;  3OX9 A;  3V92 A;  2JDI H;  1EQK A;  3X3Z A;  3CCM 3;  2B24 B;  3BNE A;  3LZA A;  3OV4 A;  3QK9 A;  3G4S 3;  1O7N B;  4K61 A;  4WP5 A;  2QA4 3;  3RGA A;  2Z7A A;  2E2U A;  3MKI A;  3CCV 3;  3HI7 A;  3BB9 A;  5IG0 A;  5KP4 A;  4L8O A;  3HZP A;  3FKA A;  2I9W A;  3GZB A;  3NBB A;  1YJW 3;  4HM4 B;  3Q90 A;  1W6Y A;  3AMO B;  2IMJ A;  3QRD A;  1VZZ A;  5D83 A;  3GRD A;  4CDL A;  2ML6 A;  1E3V A;  5BXQ A;  1S72 3;  5IG5 A;  2XEP A;  1D6U A;  4FCZ A;  2F86 B;  4HBR A;  3O8Y A;  1EG9 B;  1N8R 4;  1FGM A;  2CC3 A;  2GU3 A;  2W56 B;  2CFK A;  2OOV A;  5AYS C;  3MWZ A;  2GEY A;  2V1L A;  4KFF A;  3UL6 A;  1RRH A;  2PZV A;  1NB3 I;  3F8H A;  5IG3 A;  1JV2 B;  1KQS 2;  3CC4 3;  1OHP A;  2IUK A;  1WMO A;  4O2H A;  3NBJ A;  2E2T A;  2W2C A;  1JJ2 2;  3FG1 A;  2RCD A;  3LTD A;  4XDW A;  2CWV A;  1W7C A;  3RGR A;  1Q81 4;  2GXF A;  4LEH A;  8CHO A;  1QMA A;  2R4I A;  2YX9 A;  2OCT A;  3CU3 A;  1TFK A;  3LT9 A;  3DY5 A;  3SLU A;  1YJN 3;  2RSX A;  3EX9 A;  4HM5 B;  3G8Z A;  3LTB A;  3DGL A;  1M90 4;  2XSO B;  4H3U A;  4I4K A;  3KSE D;  3WA2 X;  4HVN A;  4PEJ A;  3T0U A;  1YI2 3;  3B7C A;  1KWI A;  2XFS A;  4XB5 A;  3CCU 3;  2E2V A;  1RKY A;  1IT7 A;  2WGO A;  3S27 A;  2XH9 A;  2D42 A;  2O3O A;  3V98 A;  1WTH A;  1LOX A;  3DXO A;  4KFE A;  2CG0 A;  2W9P A;  1Q40 A;  3JUM A;  1Q42 A;  3EN1 B;  3CMA 3;  4HM8 B;  1L5G B;  3WOF B;  1ISK A;  2BMR B;  2L4V A;  4GL6 A;  3F14 A;  2OTJ 3;  2RFR A;  3CC7 3;  3U97 A;  1F8N A;  4TX4 A;  4HZB B;  2O9U X;  3CXC 2;  3DGO A;  4FMC A;  3CCJ 3;  1ROA A;  5TGN A;  2LQV A;  4AKY A;  2F98 A;  1W00 A;  2QIY A;  3JUN A;  3VGN A;  5JPU A;  3Q1C A;  1OF5 B;  2Y74 A;  3NM2 A;  1QVF 2;  3K9M C;  2C11 A;  5CLK A;  2LYX A;  2P38 A;  3OWY A;  1DYU A;  1N9E A;  1LNH A;  3SED A;  4G1M B;  3LH4 A;  1QAL A;  5AYR B;  2RGQ A;  1ULJ B;  2ZL8 A;  3G0K A;  1VQ6 3;  4OUQ A;  5CXO A;  4XBT A;  4NHF A;  3EE1 A;  4AEQ A;  3VSY A;  1KC8 4;  3VF1 A;  3GZY B;  1NO3 A;  5IW9 A;  2GU1 A;  3HIG A;  2FXT A;  3EF8 A;  1W6G A;  3X40 A;  4K1U A;  1O7M B;  1Y4K A;  1AV4 A;  1N8Q A;  3NXJ A;  4HM6 B;  3F9S A;  1N5H A;  3FG3 A;  5DRE A;  4HM7 B;  3LTA A;  2XSH B;  3MG2 A;  4LGQ A;  1NB5 I;  2OQE C;  3JVC A;  5EQL A;  2IA7 A;  2K54 A;  2HMK B;  1VQM 3;  1VQP 3;  2BMQ B;  2WOH A;  1JKG A;  1MNL A;  3B4O A;  4N6N B;  1JNQ A;  3WDG B;  3J7Y d;  1WQL B;  3WOE B;  4H61 A;  3CCQ 3;  1Q86 4;  3NQY A;  1J2B A;  3DGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...