3I553

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 6
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3i55300
1VQ63 3CCL3 1S723 1YIT3 3CCJ3 1QVG2 1W2B2 1Q864 3G713 3I563 3CCE3 1VQ73 1VQP3 1VQM3 1VQL3 1VQK3 1Q814 3CC43 1K9M4 3CPW2 1JJ22 3CMA3 1VQ53 1KD14 1YJW3 3CXC2 1M904 2QA43 3OW22 1QVF2 1VQ83 1K734 1VQO3 1KC84 2OTJ3 3CC23 3CC73 1YHQ3 3CD63 3CCQ3 3CCM3 1Q7Y4 3CCU3 3CME3 1VQ43 1Q824 2QEX3 3CCR3 1NJI4 1VQN3 3G6E3 3G4S3 3CCS3 3CCV3 1K8A4 1YJN3 3I553 1M1K4 1YJ93 1KQS2 1YI23 1YIJ3 1VQ93 1N8R4 2OTL3
chains in the Genus database with same CATH superfamily
1MWSA 1CEWI 1M9GA 3HIGA 3LXUX 4LMIA 1QALA 1RMSA 1SIHA 2BMOB 1T3BA 1G02A 2F5WA 1E97A 1FZUA 5AEUB 1D6ZA 1BNFA 2XH9A 1A67A 4H61A 1UCJA 4Q53A 4HM2B 4PEJA 1GOVA 3LTCA 1O7WB 1UI8A 2W0QA 4L8PA 3WHOA 2XRXB 1LOXA 2XF3A 3CMA3 5CLKA 1JNQA 1BRJA 1IDPA 1YNVX 4EC6A 1HZ1A 4G1MB 4MJDA 5RNTA 4AKZA 2INXA 3N9HA 1QAKA 4JF8A 2O3OA 1AVLA 4WYKB 3CME3 1BRSA 3A76A 3RNTA 4TX4A 1B2SA 3CCR3 1EKMA 1UDII 2CH9A 3K7CA 3GZBA 3BLZA 2XEPA 1WNHA 5AYSC 4ZM8A 4N6OB 1S723 3S5CA 3GZYB 4O02B 1G96A 2V1LA 2C10A 2E2TA 1A90A 3SXXA 4FCZA 1LVNA 2J8XB 1WMNA 2WGQA 2CHCA 1LQGC 2KF3A 2CFKA 3ZFZA 1W2ZA 1NNVA 2OCTA 2CFGA 2W6JH 3BB9A 3H51A 1GOYA 5BU4A 2ZL8A 1JJ22 3KIIA 1A2VA 2K54A 1JKGB 1OH0A 1M904 5M19A 2Z77A 3AGNA 1IT7A 2QGUA 1ZS7A 3F7SA 2GSPA 1W02A 4K1VA 1ZO2A 3GAXA 1ROAA 3ZG0A 1RGCA 4CCVA 1PFPA 1RJOA 3EQQB 1OHPA 3X42A 3AMOB 3MSOA 7RNTA 3GRDA 1CYUA 1Q7HA 3T8NA 2W9QA 1GY6A 3KSED 1UUVB 3F7XA 3NHXA 4ORLA 1RGHA 2IMJA 4STDA 1BNRA 1MWUA 2FNQA 1DYUA 3FF0A 4J8TA 4MMYB 3MKIA 5HOHA 3NUVA 2HMNB 1UUGB 2W56B 3AHWA 4HBRA 5D82A 1ZGXA 2STDA 3EBYA 3FGYA 1X1YA 3FCSB 4GHOA 1KC84 4EYCA 2H0HA 1BSBA 1RGKA 2CWUA 1X1UA 3DXOA 1BU4A 3Q90A 2ZHXB 1NJI4 4R80A 1FGMA 1EEJA 3WOFB 4J5KA 1N8R4 2UUGC 2IUJA 4FMBA 2YX9A 4KVHA 2KF4A 2BIRA 5GSPA 4U13A 1QVG2 1A2KA 2L1SA 4KFFA 2CFWA 2W56A 2Y73A 3K0ZA 1CQSA 1IVXA 1DE3A 2W2CA 3MWZA 6GSPA 3OWYA 3S67A 3UB1A 1LOWA 3K9MC 4J9AA 5LC7A 2WGOA 5KP4A 1YGEA 3CXC2 1UGHI 2XSHB 3JUOA 3JUQA 5G1LA 1AR0A 1FUTA 3JUMA 3X40A 5IG4A 2HMKB 5IERA 1TU5A 3CCM3 1BRHA 3G0KA 1JBSA 1IV7A 1AVKA 3CNXA 2KAAA 2CW9A 3JVCA 4K1UA 3AHSA 1ULJB 3HIIA 2GU1A 3MPHA 2CWVA 1JKGA 3FH1A 4O8SA 1W6CA 2CG1A 1NU3A 2CX1A 5EEOA 2B1XB 3TDGA 4N6MA 1O7HB 1OGXA 4N6LA 1TJDA 1V74A 4K90B 2Y74A 3ECFA 2CFDA 3F40A 3RGAA 3CC43 4N6TA 3NBRA 3ALAA 4XBXA 1GMQA 2F98A 1I8VA 4FMDA 2JQ5A 4HM8B 1BANA 5IG0A 2F4YA 3T0UA 1W4NA 5IENA 2ZDJA 1PYLA 4OK0A 1RHLA 1WQLB 3DGMA 2CC3A 4CJNA 1BSEA 3FZWA 4RNYA 1SPUA 3EE1A 3G6E3 2HMOB 1VQ93 3SOAA 3OWSA 3EJVA 1YIJ3 1TFKA 5IG5A 4GSPA 2P05A 1VZZA 3IPTA 1IVWA 3DH2A 4XM4A 2JDIH 3VF1A 4HYZA 4GB5A 5EQLA 1GY5A 2K3DA 3V98A 4CDLA 1MGRA 5IEOA 1IV9A 1B27A 5A0OB 1DVDA 1N9EA 3EBTA 1LNIA 1S5AA 1Y4KA 2P38A 3RDEA 1IQ8A 1K9M4 3X3ZA 1OPYA 1QJGA 3NBBA 4HVNA 1BOXA 1CYVA 2PNCA 2HMLB 2RFRA 2XFTA 3QK9A 3OX9A 3S28A 5IEPA 1YJW3 1KSIA 1W00A 3D4AA 1US1A 3UL5A 1Z1SA 2E2VA 4N6UA 3EX9A 1DMMA 2GEXA 4HM6B 3DZLA 4JRFA 3PGBA 1VQN3 1M1K4 1RN4A 1SJWA 2R4IA 3GZRA 3URPA 5M18A 1RGLA 1PU4A 1ZX2A 1A2PA 4KT3B 2ZA4A 3LOYA 3SVAA 1JB5A 1T2IA 2GXFA 3EN8A 3I563 2Z76A 1JZDA 3BNEA 2CG0A 2BU4A 3PYJA 3GZXB 4NPBA 1TUHA 3HOHA 3SEDA 3GWRA 2E2UA 1RNBA 3WMDA 1QVF2 3OXAA 2BT3A 1K734 5STDA 2OTJ3 3CPOA 3CU3A 1YVBI 2XGLA 4EV2A 3JUNA 4ILFA 1BRIA 2OWPA 2PZVA 3CCV3 3G4S3 3PCSA 1JBTA 3U1WA 4XBYA 1RKYA 2WOFA 1JRQA 3I0YA 3MYTA 2Q07A 4H3UA 1I2FA 1W5ZA 1W01A 5HGRA 1DMNA 1TFOA 2RSXA 1UI7A 1Q864 2LQVA 1OHSA 4HZ9B 2RCDA 1FGOA 1RDSA 1TP6A 3NV0A 2L4VA 3KFQC 1Q814 1RGEA 3EN1B 4KZ1A 1STFI 2HOHA 1LQMB 4NHFA 2QA43 4RBNA 4HM5B 1UUWB 1SQWA 9RNTA 2AADA 1YHQ3 1EUIC 1IYYA 2KRTA 3T8UA 3D3LA 3LYGA 3S27A 1IVVA 2CFLA 2RBIA 2W04A 1C7HA 1VQ43 4HM0B 3B8LA 1R4CA 7STDA 1UCIA 2BMRB 3MG3A 3NQYA 3K63A 4LSOA 4RNZA 1HKXA 1BUQA 3MG2A 1GD3A 2P09A 1YIT3 1JN5B 4WHAA 3M8CA 4IIAA 5TGNA 4MEIA 1T5YA 3OWUA 3STDA 3G713 1GD4A 4XDVA 4N6NB 1VQ73 1VQL3 1BVIA 2Z6BA 3LTDA 1V58A 2KXGA 1NWWA 1GS3A 1F8NA 1MWRA 2A15A 1I0XA 1I2GA 2WO0A 3EF8A 1BNJA 3FG1A 4EV5A 1E3VA 4O3VA 3Q1CA 4L7KA 2XR8B 2HMMB 4EBGA 3D9RA 3DGNA 5CF2A 3ZG5A 1O7GB 1DETA 1STDA 3DMCA 4XBTA 1RGGA 3CCS3 3ROBA 4GL6A 3SLUA 3RGRA 2OTL3 1O7NB 2C11A 1YGWA 4J5GA 4OUQA 2K0MA 5CXOA 3WA2X 1UCLA 1W2B2 4BU4A 3LT9A 4FMCA 1BGSA 5EVHA 3QRDA 5CK6A 1ASKA 1W6YA 2P0XA 1B2XA 3AMOA 1GOUA 4BTWA 3BU4A 1C54A 2ML6A 4HM3B 1EG9B 4LZIA 3X41A 3BNDA 2IY2A 1BNEA 1UGIA 1X1XA 3BIRA 3LTAA 3Q2PA 1TRQA 2QIYA 1IVUA 4RZMA 1Q7Y4 1RGFA 3DY5A 1NO3A 3PZWA 2QEX3 2W9PA 2GEYA 1K8A4 1LOYA 2XGNA 1MWTA 2BNGA 4LYLB 4RNTA 1I0VA 3D5GA 4HJLB 4R4KA 3KSPA 1VQ63 3AGOA 2MC8A 3X3YA 4HM7B 1OCVA 1RCKA 4FCMA 5D81A 1GY7A 3A5EA 2UGIA 2ML5A 2R41A 1TIJA 2F5MA 2OOVC 3EB8A 1BRKA 1NB5I 1FUWA 1DMQA 4HKVB 1UCKA 4CPKA 3FSDA 3NQZA 3LTBA 3GSPA 4FR9A 1WMOA 3F8HA 1BSDA 2CWTA 1VQK3 4LGQA 3CPW2 3O8YA 1ULIB 3BNBA 1W6GA 3NBJA 3LT8A 5IF6A 1U8CB 3CCU3 1AQZA 1I3IA 1QAFA 3FG4A 1B3SA 1FGRA 3B7CA 4MMXB 3IJEB 5IG3A 4XB5A 2OQEA 1Q824 1X1WA 1Q40B 3FKAA 3NM7A 1RCLA 3BNCA 1YJN3 1O7MB 4KFDA 4QWTA 1SARA 1MNLA 1KQS2 4HZBB 1BSAA 1PY3A 5JBSA 3CCL3 1FW7A 5FGOA 3NXJA 1J2BA 3Q3FA 3U97A 4AEQA 3D79A 3PCRA 1OHOA 4BTXA 2YFLB 1EA2A 1VQP3 2YFJB 1R4YA 1I70A 5JPPA 4WWUC 4IT7A 1N5PA 1RN7A 2BO9B 5G1KA 4R9LA 2C4BA 1BIRA 2F56A 2MF7A 1OF5B 2CKFB 4N6V0 2OQEC 2RGQA 3H3HA 4XDWA 3KZTA 3WDGB 3UNLA 4KFEA 2GBWB 3D5IA 3CC73 3F14A 1K41A 1M1XB 1AV4A 3PXMA 5ELUA 3CCQ3 4I5QA 1BNGA 3L0RA 1JV2B 1B20A 3DGLA 5JPUA 1LOVA 5BIRA 4BTYA 1IQXA 1SIIA 1JZOA 1JBRA 2F86B 3NX0A 3LZAA 1RGAA 5AEWB 5FW5A 4BL3A 8CHOA 3DGYA 5DREA 1FYSA 3B4PA 5LC6A 1FGTA 1EQKA 3K5TA 5AIFA 1JB4A 2HMJB 1RSNA 1TTOA 1KD14 1U5OA 3WR2A 3N54B 4WP5A 1IT8A 1AY7A 1YVSA 2H0GA 2GU3A 3EHCA 3IMAB 1W7CA 1LNHA 1N5HA 3X3XA 3G8ZA 4DKIA 3G16A 1OACA 3CNMA 5BXQA 1QMAA 2D1WA 1UW1A 4BL2A 2F99A 1Q42A 3E99A 5DRVA 3CCJ3 4WFOA 2IYJA 5AI1A 1LXEA 3F9SA 3LH4A 2I9WA 1RRHA 4AKYA 2SARA 1VQM3 1RRLA 3HZPA 1OGZA 1HYFA 2OOVA 1V57A 1WTHA 1NB3I 3DUKA 3N8BA 3WODG 1VQ53 2XFSA 1BRNL 4EW5A 4R9KA 1VQ83 1GMPA 1D6YA 1N9JA 3MG1A 2CK3H 3UL6A 1GYBA 3J7Yd 1B21A 3FF2A 1BNIA 1WMPA 2BHMA 2SBLA 3DGOA 1NDOB 3KKGA 4O2HA 1BRGA 1HU9A 5G2GA 2P0MA 4IPBA 5D83A 2FXTA 3MHEA 3UJMA 3I553 1BNSA 4N3VA 4NREA 4BIRA 1MOLA 2KF6A 2WOHA 3VGNA 4HAAA 2D42A 2O9UX 3S29A 3LMLA 5ELJA 2M7OA 3VSYA 5AIGA 3WOEB 2RNTA 1I2EA 2YFIB 3B4OA 3KE7A 6STDA 1FUSA 5AYRB 5I97A 1FGQA 3CCE3 5CF1A 1B2MA 1N8QA 4WYKA 1B2ZA 4EXRA 2IUKA 2W03A 1OUNA 2CIUA 2BMQB 2KF5A 2Z7AA 3DM8A 6RNTA 1I3FA 4R1KA 1LRAA 3HK4A 3PS8A 4OVMA 3KCHA 4HM4B 1E3RA 3CC23 2H0IA 4I4KA 3SOYA 3KN4A 4X2OA 1TRPA 3F8XA 5M1AA 3WA3A 3JUPA 1IQYA 4LEHA 3HI7A 3ER7A 4FCJA 2CX0A 5KP1A 3NV0B 3SYUA 8RNTA 1YI23 1CH0A 2UX0A 1L5GB 1Q9EA 1T2HA 1BUJA 5AIHA 1DVCA 4X2HA 1O7PB 1RLSA 5BVBA 1GMRA 1MGWA 4MMZB 7GSPA 1KWIA 3SX1A 1B2UA 2B24B 4K61A 4L8OA 1G0TA 1GSPA 1ROVA 1BSCA 1IU7A 1Q40A 2AAEA 2XSOB 1OF5A 3NM2A 3OV4A 2GBXB 5IW9A 1RN1A 3HX8A 4FMAA 4HM1B 3OW22 1D6UA 5KP3A 1VQO3 4HOHA 1RNTA 1IK3A 2IA7A 2FGTA 1JN5A 3V99A 3V92A 5AIIA 3CD63 1K28A 3FLJA 2KCDA 3FG3A 1VQQA 1FA3A 2LYXA 1RTUA 1JB2A 3EC9A 1YJ93 1ISKA 1BAOA
chains in the Genus database with same CATH topology
1CEWI 1M9GA 3HIGA 3LXUX 4LMIA 1QALA 1SIHA 2BMOB 1E97A 5AEUB 1D6ZA 2XH9A 1A67A 4H61A 4Q53A 4HM2B 4PEJA 3LTCA 1O7WB 1UI8A 2W0QA 4L8PA 2XRXB 1LOXA 2XF3A 3CMA3 5CLKA 1JNQA 1IDPA 4EC6A 4MJDA 4G1MB 4AKZA 2INXA 3N9HA 1QAKA 4JF8A 2O3OA 1AVLA 4WYKB 3CME3 3A76A 3CCR3 4TX4A 1EKMA 2CH9A 3K7CA 3GZBA 3BLZA 2XEPA 1WNHA 5AYSC 4ZM8A 4N6OB 1S723 3S5CA 3GZYB 4O02B 1G96A 2V1LA 2C10A 2E2TA 1A90A 3SXXA 4FCZA 1LVNA 2WGQA 1WMNA 2CHCA 2CFKA 1W2ZA 2OCTA 2CFGA 2W6JH 3BB9A 3H51A 2ZL8A 1JJ22 3KIIA 1A2VA 2K54A 1JKGB 1OH0A 1M904 2Z77A 1IT7A 2QGUA 3F7SA 1W02A 4K1VA 1ZO2A 3GAXA 1ROAA 4CCVA 1PFPA 1RJOA 3EQQB 1OHPA 3X42A 3AMOB 3MSOA 3GRDA 1CYUA 3T8NA 2W9QA 1GY6A 3KSED 1UUVB 3F7XA 3NHXA 4ORLA 2IMJA 4STDA 2FNQA 1DYUA 3FF0A 4J8TA 4MMYB 3MKIA 3NUVA 2HMNB 2W56B 4HBRA 5D82A 2STDA 3EBYA 3FGYA 3FCSB 1KC84 4EYCA 2CWUA 3DXOA 3Q90A 1NJI4 4R80A 1FGMA 3WOFB 1N8R4 2IUJA 4FMBA 2YX9A 4KVHA 4U13A 1QVG2 1A2KA 4KFFA 2CFWA 2W56A 2Y73A 3K0ZA 1CQSA 1IVXA 2W2CA 3MWZA 3OWYA 3S67A 3UB1A 3K9MC 4J9AA 5LC7A 2WGOA 5KP4A 1YGEA 3CXC2 2XSHB 3JUOA 3JUQA 1AR0A 3JUMA 3X40A 5IG4A 2HMKB 5IERA 1TU5A 3CCM3 3G0KA 1IV7A 1AVKA 3CNXA 4K1UA 2CW9A 3JVCA 3G6E3 1ULJB 3HIIA 2GU1A 3MPHA 2CWVA 1JKGA 3FH1A 4O8SA 1W6CA 2CG1A 1NU3A 5EEOA 2B1XB 3TDGA 4N6MA 1O7HB 1OGXA 4N6LA 1V74A 4K90B 2Y74A 3ECFA 2CFDA 3F40A 3RGAA 3CC43 4N6TA 3NBRA 3ALAA 4XBXA 2F98A 4FMDA 2JQ5A 4HM8B 5IG0A 3T0UA 1W4NA 5IENA 2ZDJA 4OK0A 1WQLB 3DGMA 2CC3A 3FZWA 4RNYA 1SPUA 3EE1A 2HMOB 1VQ93 3SOAA 3OWSA 3EJVA 1YIJ3 1TFKA 5IG5A 2P05A 1VZZA 3IPTA 1IVWA 4XM4A 2JDIH 3VF1A 4HYZA 4GB5A 5EQLA 1GY5A 3V98A 4CDLA 5IEOA 1DVDA 1IV9A 5A0OB 1N9EA 3EBTA 1S5AA 1Y4KA 2P38A 3RDEA 1IQ8A 1K9M4 3X3ZA 1OPYA 1QJGA 3NBBA 4HVNA 2RFRA 1CYVA 2PNCA 2HMLB 2XFTA 3QK9A 4IT7A 3OX9A 5IEPA 1YJW3 1KSIA 1W00A 1US1A 3UL5A 1Z1SA 2E2VA 4N6UA 3EX9A 1DMMA 2GEXA 4HM6B 3DZLA 4JRFA 3PGBA 1VQN3 1M1K4 1SJWA 2R4IA 3GZRA 1PU4A 1ZX2A 3LOYA 3SVAA 1JB5A 2GXFA 3EN8A 3I563 2Z76A 3BNEA 2CG0A 3PYJA 3GZXB 1TUHA 3SEDA 3GWRA 2E2UA 3WMDA 1QVF2 3OXAA 2BT3A 1K734 5STDA 2OTJ3 3CPOA 3CU3A 1YVBI 2XGLA 4EV2A 3JUNA 2OWPA 2PZVA 3CCV3 3G4S3 3PCSA 3U1WA 4XBYA 1RKYA 2WOFA 1JRQA 3I0YA 3MYTA 2Q07A 4H3UA 1W5ZA 1W01A 5HGRA 1DMNA 1TFOA 2RSXA 1UI7A 1Q864 2LQVA 1OHSA 4HZ9B 2RCDA 1FGOA 1TP6A 3NV0A 2L4VA 3KFQC 1Q814 3EN1B 4KZ1A 1STFI 4NHFA 2QA43 4RBNA 4HM5B 1UUWB 1SQWA 1YHQ3 2KRTA 3T8UA 3D3LA 3LYGA 3S27A 1IVVA 2CFLA 2W04A 1C7HA 1VQ43 4HM0B 3B8LA 1R4CA 7STDA 2BMRB 3MG3A 3NQYA 3K63A 4LSOA 4RNZA 1HKXA 1BUQA 3MG2A 1GD3A 2P09A 1YIT3 1JN5B 4WHAA 3M8CA 4IIAA 5TGNA 4MEIA 1T5YA 3OWUA 3STDA 3G713 1GD4A 4XDVA 4N6NB 1VQ73 1VQL3 2Z6BA 3LTDA 2KXGA 1NWWA 1GS3A 1F8NA 2A15A 3EF8A 2WO0A 3FG1A 4EV5A 1E3VA 4O3VA 3Q1CA 4L7KA 2XR8B 2HMMB 4EBGA 3D9RA 3DGNA 5CF2A 1O7GB 1STDA 3DMCA 4XBTA 3CCS3 3ROBA 4GL6A 3SLUA 3RGRA 2OTL3 1O7NB 2C11A 4OUQA 2K0MA 5CXOA 3WA2X 1W2B2 3LT9A 4FMCA 5EVHA 3QRDA 5CK6A 1ASKA 1W6YA 2P0XA 3AMOA 4BTWA 2ML6A 4HM3B 1EG9B 4LZIA 3X41A 3BNDA 3LTAA 3Q2PA 2QIYA 1IVUA 4RZMA 1Q7Y4 3DY5A 3PZWA 1NO3A 2QEX3 2W9PA 2GEYA 1K8A4 2XGNA 2BNGA 4R4KA 4HJLB 3KSPA 1VQ63 2MC8A 3X3YA 4HM7B 1OCVA 4FCMA 5D81A 1GY7A 2ML5A 1TIJA 3EB8A 2OOVC 1FUWA 1NB5I 1DMQA 4HKVB 3FSDA 3NQZA 3LTBA 4FR9A 1VQK3 1WMOA 3F8HA 2CWTA 4LGQA 3CPW2 3O8YA 1ULIB 3BNBA 1W6GA 3NBJA 3LT8A 5IF6A 1U8CB 1QAFA 3FG4A 1FGRA 3B7CA 4MMXB 3IJEB 5IG3A 4XB5A 2OQEA 1Q824 3FKAA 1Q40B 3NM7A 3BNCA 1YJN3 1O7MB 4KFDA 4QWTA 1KQS2 1MNLA 4HZBB 5JBSA 3CCL3 5FGOA 3NXJA 1J2BA 4AEQA 3U97A 3PCRA 1OHOA 4BTXA 2YFLB 1EA2A 1VQP3 2YFJB 5JPPA 4WWUC 1N5PA 1RN7A 2BO9B 4R9LA 2MF7A 1OF5B 2CKFB 4N6V0 2OQEC 2RGQA 3H3HA 4XDWA 3KZTA 3WDGB 3UNLA 4KFEA 2GBWB 3CC73 3CCQ3 3F14A 1K41A 1M1XB 1AV4A 3PXMA 5ELUA 3L0RA 1JV2B 3DGLA 5JPUA 4BTYA 1IQXA 1SIIA 2F86B 3NX0A 3LZAA 5AEWB 5FW5A 8CHOA 5DREA 3B4PA 5LC6A 1FGTA 1EQKA 3K5TA 5AIFA 1JB4A 2HMJB 1KD14 1U5OA 3N54B 4WP5A 1IT8A 2GU3A 3EHCA 3IMAB 1W7CA 1LNHA 1N5HA 3X3XA 3G8ZA 3G16A 1OACA 3CNMA 5BXQA 1QMAA 2D1WA 1UW1A 2F99A 1Q42A 3E99A 5DRVA 3CCJ3 4WFOA 5AI1A 1LXEA 3F9SA 3LH4A 2I9WA 1RRHA 4AKYA 1VQM3 1RRLA 3HZPA 1OGZA 2OOVA 3DUKA 1NB3I 1WTHA 3N8BA 3WODG 1VQ53 2XFSA 4R9KA 1VQ83 1D6YA 1N9JA 3MG1A 2CK3H 3UL6A 1GYBA 3J7Yd 3FF2A 3S28A 2BHMA 1WMPA 3DGOA 2SBLA 3KKGA 1NDOB 4O2HA 3CCU3 1HU9A 5G2GA 2P0MA 4IPBA 5D83A 2FXTA 3MHEA 3UJMA 3I553 4N3VA 4NREA 1MOLA 2WOHA 3VGNA 2D42A 2O9UX 3S29A 3LMLA 5ELJA 2M7OA 3VSYA 5AIGA 3WOEB 2YFIB 3B4OA 6STDA 5I97A 3KE7A 3CCE3 5AYRB 1FGQA 5CF1A 1N8QA 4WYKA 4EXRA 2IUKA 2W03A 1OUNA 2CIUA 2BMQB 2Z7AA 3DM8A 4R1KA 4OVMA 3HK4A 3PS8A 4HM4B 1E3RA 3CC23 4I4KA 3SOYA 3KN4A 4X2OA 3WA3A 3F8XA 3JUPA 1IQYA 4LEHA 3HI7A 3ER7A 4FCJA 5KP1A 3NV0B 1YI23 2UX0A 1L5GB 5AIHA 1DVCA 4X2HA 1O7PB 5BVBA 4MMZB 1KWIA 3SX1A 2B24B 4K61A 4L8OA 1ROVA 1IU7A 1Q40A 2XSOB 1OF5A 3NM2A 3OV4A 2GBXB 5IW9A 3HX8A 4FMAA 4HM1B 3OW22 1D6UA 5KP3A 1VQO3 1IK3A 2IA7A 2FGTA 1JN5A 3V99A 3V92A 5AIIA 3CD63 1K28A 3FLJA 2KCDA 3FG3A 1FA3A 2LYXA 1JB2A 3EC9A 1YJ93 1ISKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 3;  3CCL 3;  1S72 3;  1YIT 3;  3CCJ 3;  1QVG 2;  1W2B 2;  1Q86 4;  3G71 3;  3I56 3;  3CCE 3;  1VQ7 3;  1VQP 3;  1VQM 3;  1VQL 3;  1VQK 3;  1Q81 4;  3CC4 3;  1K9M 4;  3CPW 2;  1JJ2 2;  3CMA 3;  1VQ5 3;  1KD1 4;  1YJW 3;  3CXC 2;  1M90 4;  2QA4 3;  3OW2 2;  1QVF 2;  1VQ8 3;  1K73 4;  1VQO 3;  1KC8 4;  2OTJ 3;  3CC2 3;  3CC7 3;  1YHQ 3;  3CD6 3;  3CCQ 3;  3CCM 3;  1Q7Y 4;  3CCU 3;  3CME 3;  1VQ4 3;  1Q82 4;  2QEX 3;  3CCR 3;  1NJI 4;  1VQN 3;  3G6E 3;  3G4S 3;  3CCS 3;  3CCV 3;  1K8A 4;  1YJN 3;  3I55 3;  1M1K 4;  1YJ9 3;  1KQS 2;  1YI2 3;  1YIJ 3;  1VQ9 3;  1N8R 4;  2OTL 3; 
#chains in the Genus database with same CATH topology
 1MWS A;  1CEW I;  1M9G A;  3HIG A;  3LXU X;  4LMI A;  1QAL A;  1RMS A;  1SIH A;  2BMO B;  1T3B A;  1G02 A;  2F5W A;  1E97 A;  1FZU A;  5AEU B;  1D6Z A;  1BNF A;  2XH9 A;  1A67 A;  4H61 A;  1UCJ A;  4Q53 A;  4HM2 B;  4PEJ A;  1GOV A;  3LTC A;  1O7W B;  1UI8 A;  2W0Q A;  4L8P A;  3WHO A;  2XRX B;  1LOX A;  2XF3 A;  3CMA 3;  5CLK A;  1JNQ A;  1BRJ A;  1IDP A;  1YNV X;  4EC6 A;  1HZ1 A;  4G1M B;  4MJD A;  5RNT A;  4AKZ A;  2INX A;  3N9H A;  1QAK A;  4JF8 A;  2O3O A;  1AVL A;  4WYK B;  3CME 3;  1BRS A;  3A76 A;  3RNT A;  4TX4 A;  1B2S A;  3CCR 3;  1EKM A;  1UDI I;  2CH9 A;  3K7C A;  3GZB A;  3BLZ A;  2XEP A;  1WNH A;  5AYS C;  4ZM8 A;  4N6O B;  1S72 3;  3S5C A;  3GZY B;  4O02 B;  1G96 A;  2V1L A;  2C10 A;  2E2T A;  1A90 A;  3SXX A;  4FCZ A;  1LVN A;  2J8X B;  1WMN A;  2WGQ A;  2CHC A;  1LQG C;  2KF3 A;  2CFK A;  3ZFZ A;  1W2Z A;  1NNV A;  2OCT A;  2CFG A;  2W6J H;  3BB9 A;  3H51 A;  1GOY A;  5BU4 A;  2ZL8 A;  1JJ2 2;  3KII A;  1A2V A;  2K54 A;  1JKG B;  1OH0 A;  1M90 4;  5M19 A;  2Z77 A;  3AGN A;  1IT7 A;  2QGU A;  1ZS7 A;  3F7S A;  2GSP A;  1W02 A;  4K1V A;  1ZO2 A;  3GAX A;  1ROA A;  3ZG0 A;  1RGC A;  4CCV A;  1PFP A;  1RJO A;  3EQQ B;  1OHP A;  3X42 A;  3AMO B;  3MSO A;  7RNT A;  3GRD A;  1CYU A;  1Q7H A;  3T8N A;  2W9Q A;  1GY6 A;  3KSE D;  1UUV B;  3F7X A;  3NHX A;  4ORL A;  1RGH A;  2IMJ A;  4STD A;  1BNR A;  1MWU A;  2FNQ A;  1DYU A;  3FF0 A;  4J8T A;  4MMY B;  3MKI A;  5HOH A;  3NUV A;  2HMN B;  1UUG B;  2W56 B;  3AHW A;  4HBR A;  5D82 A;  1ZGX A;  2STD A;  3EBY A;  3FGY A;  1X1Y A;  3FCS B;  4GHO A;  1KC8 4;  4EYC A;  2H0H A;  1BSB A;  1RGK A;  2CWU A;  1X1U A;  3DXO A;  1BU4 A;  3Q90 A;  2ZHX B;  1NJI 4;  4R80 A;  1FGM A;  1EEJ A;  3WOF B;  4J5K A;  1N8R 4;  2UUG C;  2IUJ A;  4FMB A;  2YX9 A;  4KVH A;  2KF4 A;  2BIR A;  5GSP A;  4U13 A;  1QVG 2;  1A2K A;  2L1S A;  4KFF A;  2CFW A;  2W56 A;  2Y73 A;  3K0Z A;  1CQS A;  1IVX A;  1DE3 A;  2W2C A;  3MWZ A;  6GSP A;  3OWY A;  3S67 A;  3UB1 A;  1LOW A;  3K9M C;  4J9A A;  5LC7 A;  2WGO A;  5KP4 A;  1YGE A;  3CXC 2;  1UGH I;  2XSH B;  3JUO A;  3JUQ A;  5G1L A;  1AR0 A;  1FUT A;  3JUM A;  3X40 A;  5IG4 A;  2HMK B;  5IER A;  1TU5 A;  3CCM 3;  1BRH A;  3G0K A;  1JBS A;  1IV7 A;  1AVK A;  3CNX A;  2KAA A;  2CW9 A;  3JVC A;  4K1U A;  3AHS A;  1ULJ B;  3HII A;  2GU1 A;  3MPH A;  2CWV A;  1JKG A;  3FH1 A;  4O8S A;  1W6C A;  2CG1 A;  1NU3 A;  2CX1 A;  5EEO A;  2B1X B;  3TDG A;  4N6M A;  1O7H B;  1OGX A;  4N6L A;  1TJD A;  1V74 A;  4K90 B;  2Y74 A;  3ECF A;  2CFD A;  3F40 A;  3RGA A;  3CC4 3;  4N6T A;  3NBR A;  3ALA A;  4XBX A;  1GMQ A;  2F98 A;  1I8V A;  4FMD A;  2JQ5 A;  4HM8 B;  1BAN A;  5IG0 A;  2F4Y A;  3T0U A;  1W4N A;  5IEN A;  2ZDJ A;  1PYL A;  4OK0 A;  1RHL A;  1WQL B;  3DGM A;  2CC3 A;  4CJN A;  1BSE A;  3FZW A;  4RNY A;  1SPU A;  3EE1 A;  3G6E 3;  2HMO B;  1VQ9 3;  3SOA A;  3OWS A;  3EJV A;  1YIJ 3;  1TFK A;  5IG5 A;  4GSP A;  2P05 A;  1VZZ A;  3IPT A;  1IVW A;  3DH2 A;  4XM4 A;  2JDI H;  3VF1 A;  4HYZ A;  4GB5 A;  5EQL A;  1GY5 A;  2K3D A;  3V98 A;  4CDL A;  1MGR A;  5IEO A;  1IV9 A;  1B27 A;  5A0O B;  1DVD A;  1N9E A;  3EBT A;  1LNI A;  1S5A A;  1Y4K A;  2P38 A;  3RDE A;  1IQ8 A;  1K9M 4;  3X3Z A;  1OPY A;  1QJG A;  3NBB A;  4HVN A;  1BOX A;  1CYV A;  2PNC A;  2HML B;  2RFR A;  2XFT A;  3QK9 A;  3OX9 A;  3S28 A;  5IEP A;  1YJW 3;  1KSI A;  1W00 A;  3D4A A;  1US1 A;  3UL5 A;  1Z1S A;  2E2V A;  4N6U A;  3EX9 A;  1DMM A;  2GEX A;  4HM6 B;  3DZL A;  4JRF A;  3PGB A;  1VQN 3;  1M1K 4;  1RN4 A;  1SJW A;  2R4I A;  3GZR A;  3URP A;  5M18 A;  1RGL A;  1PU4 A;  1ZX2 A;  1A2P A;  4KT3 B;  2ZA4 A;  3LOY A;  3SVA A;  1JB5 A;  1T2I A;  2GXF A;  3EN8 A;  3I56 3;  2Z76 A;  1JZD A;  3BNE A;  2CG0 A;  2BU4 A;  3PYJ A;  3GZX B;  4NPB A;  1TUH A;  3HOH A;  3SED A;  3GWR A;  2E2U A;  1RNB A;  3WMD A;  1QVF 2;  3OXA A;  2BT3 A;  1K73 4;  5STD A;  2OTJ 3;  3CPO A;  3CU3 A;  1YVB I;  2XGL A;  4EV2 A;  3JUN A;  4ILF A;  1BRI A;  2OWP A;  2PZV A;  3CCV 3;  3G4S 3;  3PCS A;  1JBT A;  3U1W A;  4XBY A;  1RKY A;  2WOF A;  1JRQ A;  3I0Y A;  3MYT A;  2Q07 A;  4H3U A;  1I2F A;  1W5Z A;  1W01 A;  5HGR A;  1DMN A;  1TFO A;  2RSX A;  1UI7 A;  1Q86 4;  2LQV A;  1OHS A;  4HZ9 B;  2RCD A;  1FGO A;  1RDS A;  1TP6 A;  3NV0 A;  2L4V A;  3KFQ C;  1Q81 4;  1RGE A;  3EN1 B;  4KZ1 A;  1STF I;  2HOH A;  1LQM B;  4NHF A;  2QA4 3;  4RBN A;  4HM5 B;  1UUW B;  1SQW A;  9RNT A;  2AAD A;  1YHQ 3;  1EUI C;  1IYY A;  2KRT A;  3T8U A;  3D3L A;  3LYG A;  3S27 A;  1IVV A;  2CFL A;  2RBI A;  2W04 A;  1C7H A;  1VQ4 3;  4HM0 B;  3B8L A;  1R4C A;  7STD A;  1UCI A;  2BMR B;  3MG3 A;  3NQY A;  3K63 A;  4LSO A;  4RNZ A;  1HKX A;  1BUQ A;  3MG2 A;  1GD3 A;  2P09 A;  1YIT 3;  1JN5 B;  4WHA A;  3M8C A;  4IIA A;  5TGN A;  4MEI A;  1T5Y A;  3OWU A;  3STD A;  3G71 3;  1GD4 A;  4XDV A;  4N6N B;  1VQ7 3;  1VQL 3;  1BVI A;  2Z6B A;  3LTD A;  1V58 A;  2KXG A;  1NWW A;  1GS3 A;  1F8N A;  1MWR A;  2A15 A;  1I0X A;  1I2G A;  2WO0 A;  3EF8 A;  1BNJ A;  3FG1 A;  4EV5 A;  1E3V A;  4O3V A;  3Q1C A;  4L7K A;  2XR8 B;  2HMM B;  4EBG A;  3D9R A;  3DGN A;  5CF2 A;  3ZG5 A;  1O7G B;  1DET A;  1STD A;  3DMC A;  4XBT A;  1RGG A;  3CCS 3;  3ROB A;  4GL6 A;  3SLU A;  3RGR A;  2OTL 3;  1O7N B;  2C11 A;  1YGW A;  4J5G A;  4OUQ A;  2K0M A;  5CXO A;  3WA2 X;  1UCL A;  1W2B 2;  4BU4 A;  3LT9 A;  4FMC A;  1BGS A;  5EVH A;  3QRD A;  5CK6 A;  1ASK A;  1W6Y A;  2P0X A;  1B2X A;  3AMO A;  1GOU A;  4BTW A;  3BU4 A;  1C54 A;  2ML6 A;  4HM3 B;  1EG9 B;  4LZI A;  3X41 A;  3BND A;  2IY2 A;  1BNE A;  1UGI A;  1X1X A;  3BIR A;  3LTA A;  3Q2P A;  1TRQ A;  2QIY A;  1IVU A;  4RZM A;  1Q7Y 4;  1RGF A;  3DY5 A;  1NO3 A;  3PZW A;  2QEX 3;  2W9P A;  2GEY A;  1K8A 4;  1LOY A;  2XGN A;  1MWT A;  2BNG A;  4LYL B;  4RNT A;  1I0V A;  3D5G A;  4HJL B;  4R4K A;  3KSP A;  1VQ6 3;  3AGO A;  2MC8 A;  3X3Y A;  4HM7 B;  1OCV A;  1RCK A;  4FCM A;  5D81 A;  1GY7 A;  3A5E A;  2UGI A;  2ML5 A;  2R41 A;  1TIJ A;  2F5M A;  2OOV C;  3EB8 A;  1BRK A;  1NB5 I;  1FUW A;  1DMQ A;  4HKV B;  1UCK A;  4CPK A;  3FSD A;  3NQZ A;  3LTB A;  3GSP A;  4FR9 A;  1WMO A;  3F8H A;  1BSD A;  2CWT A;  1VQK 3;  4LGQ A;  3CPW 2;  3O8Y A;  1ULI B;  3BNB A;  1W6G A;  3NBJ A;  3LT8 A;  5IF6 A;  1U8C B;  3CCU 3;  1AQZ A;  1I3I A;  1QAF A;  3FG4 A;  1B3S A;  1FGR A;  3B7C A;  4MMX B;  3IJE B;  5IG3 A;  4XB5 A;  2OQE A;  1Q82 4;  1X1W A;  1Q40 B;  3FKA A;  3NM7 A;  1RCL A;  3BNC A;  1YJN 3;  1O7M B;  4KFD A;  4QWT A;  1SAR A;  1MNL A;  1KQS 2;  4HZB B;  1BSA A;  1PY3 A;  5JBS A;  3CCL 3;  1FW7 A;  5FGO A;  3NXJ A;  1J2B A;  3Q3F A;  3U97 A;  4AEQ A;  3D79 A;  3PCR A;  1OHO A;  4BTX A;  2YFL B;  1EA2 A;  1VQP 3;  2YFJ B;  1R4Y A;  1I70 A;  5JPP A;  4WWU C;  4IT7 A;  1N5P A;  1RN7 A;  2BO9 B;  5G1K A;  4R9L A;  2C4B A;  1BIR A;  2F56 A;  2MF7 A;  1OF5 B;  2CKF B;  4N6V 0;  2OQE C;  2RGQ A;  3H3H A;  4XDW A;  3KZT A;  3WDG B;  3UNL A;  4KFE A;  2GBW B;  3D5I A;  3CC7 3;  3F14 A;  1K41 A;  1M1X B;  1AV4 A;  3PXM A;  5ELU A;  3CCQ 3;  4I5Q A;  1BNG A;  3L0R A;  1JV2 B;  1B20 A;  3DGL A;  5JPU A;  1LOV A;  5BIR A;  4BTY A;  1IQX A;  1SII A;  1JZO A;  1JBR A;  2F86 B;  3NX0 A;  3LZA A;  1RGA A;  5AEW B;  5FW5 A;  4BL3 A;  8CHO A;  3DGY A;  5DRE A;  1FYS A;  3B4P A;  5LC6 A;  1FGT A;  1EQK A;  3K5T A;  5AIF A;  1JB4 A;  2HMJ B;  1RSN A;  1TTO A;  1KD1 4;  1U5O A;  3WR2 A;  3N54 B;  4WP5 A;  1IT8 A;  1AY7 A;  1YVS A;  2H0G A;  2GU3 A;  3EHC A;  3IMA B;  1W7C A;  1LNH A;  1N5H A;  3X3X A;  3G8Z A;  4DKI A;  3G16 A;  1OAC A;  3CNM A;  5BXQ A;  1QMA A;  2D1W A;  1UW1 A;  4BL2 A;  2F99 A;  1Q42 A;  3E99 A;  5DRV A;  3CCJ 3;  4WFO A;  2IYJ A;  5AI1 A;  1LXE A;  3F9S A;  3LH4 A;  2I9W A;  1RRH A;  4AKY A;  2SAR A;  1VQM 3;  1RRL A;  3HZP A;  1OGZ A;  1HYF A;  2OOV A;  1V57 A;  1WTH A;  1NB3 I;  3DUK A;  3N8B A;  3WOD G;  1VQ5 3;  2XFS A;  1BRN L;  4EW5 A;  4R9K A;  1VQ8 3;  1GMP A;  1D6Y A;  1N9J A;  3MG1 A;  2CK3 H;  3UL6 A;  1GYB A;  3J7Y d;  1B21 A;  3FF2 A;  1BNI A;  1WMP A;  2BHM A;  2SBL A;  3DGO A;  1NDO B;  3KKG A;  4O2H A;  1BRG A;  1HU9 A;  5G2G A;  2P0M A;  4IPB A;  5D83 A;  2FXT A;  3MHE A;  3UJM A;  3I55 3;  1BNS A;  4N3V A;  4NRE A;  4BIR A;  1MOL A;  2KF6 A;  2WOH A;  3VGN A;  4HAA A;  2D42 A;  2O9U X;  3S29 A;  3LML A;  5ELJ A;  2M7O A;  3VSY A;  5AIG A;  3WOE B;  2RNT A;  1I2E A;  2YFI B;  3B4O A;  3KE7 A;  6STD A;  1FUS A;  5AYR B;  5I97 A;  1FGQ A;  3CCE 3;  5CF1 A;  1B2M A;  1N8Q A;  4WYK A;  1B2Z A;  4EXR A;  2IUK A;  2W03 A;  1OUN A;  2CIU A;  2BMQ B;  2KF5 A;  2Z7A A;  3DM8 A;  6RNT A;  1I3F A;  4R1K A;  1LRA A;  3HK4 A;  3PS8 A;  4OVM A;  3KCH A;  4HM4 B;  1E3R A;  3CC2 3;  2H0I A;  4I4K A;  3SOY A;  3KN4 A;  4X2O A;  1TRP A;  3F8X A;  5M1A A;  3WA3 A;  3JUP A;  1IQY A;  4LEH A;  3HI7 A;  3ER7 A;  4FCJ A;  2CX0 A;  5KP1 A;  3NV0 B;  3SYU A;  8RNT A;  1YI2 3;  1CH0 A;  2UX0 A;  1L5G B;  1Q9E A;  1T2H A;  1BUJ A;  5AIH A;  1DVC A;  4X2H A;  1O7P B;  1RLS A;  5BVB A;  1GMR A;  1MGW A;  4MMZ B;  7GSP A;  1KWI A;  3SX1 A;  1B2U A;  2B24 B;  4K61 A;  4L8O A;  1G0T A;  1GSP A;  1ROV A;  1BSC A;  1IU7 A;  1Q40 A;  2AAE A;  2XSO B;  1OF5 A;  3NM2 A;  3OV4 A;  2GBX B;  5IW9 A;  1RN1 A;  3HX8 A;  4FMA A;  4HM1 B;  3OW2 2;  1D6U A;  5KP3 A;  1VQO 3;  4HOH A;  1RNT A;  1IK3 A;  2IA7 A;  2FGT A;  1JN5 A;  3V99 A;  3V92 A;  5AII A;  3CD6 3;  1K28 A;  3FLJ A;  2KCD A;  3FG3 A;  1VQQ A;  1FA3 A;  2LYX A;  1RTU A;  1JB2 A;  3EC9 A;  1YJ9 3;  1ISK A;  1BAO A; 
#chains in the Genus database with same CATH homology
 1CEW I;  1M9G A;  3HIG A;  3LXU X;  4LMI A;  1QAL A;  1SIH A;  2BMO B;  1E97 A;  5AEU B;  1D6Z A;  2XH9 A;  1A67 A;  4H61 A;  4Q53 A;  4HM2 B;  4PEJ A;  3LTC A;  1O7W B;  1UI8 A;  2W0Q A;  4L8P A;  2XRX B;  1LOX A;  2XF3 A;  3CMA 3;  5CLK A;  1JNQ A;  1IDP A;  4EC6 A;  4MJD A;  4G1M B;  4AKZ A;  2INX A;  3N9H A;  1QAK A;  4JF8 A;  2O3O A;  1AVL A;  4WYK B;  3CME 3;  3A76 A;  3CCR 3;  4TX4 A;  1EKM A;  2CH9 A;  3K7C A;  3GZB A;  3BLZ A;  2XEP A;  1WNH A;  5AYS C;  4ZM8 A;  4N6O B;  1S72 3;  3S5C A;  3GZY B;  4O02 B;  1G96 A;  2V1L A;  2C10 A;  2E2T A;  1A90 A;  3SXX A;  4FCZ A;  1LVN A;  2WGQ A;  1WMN A;  2CHC A;  2CFK A;  1W2Z A;  2OCT A;  2CFG A;  2W6J H;  3BB9 A;  3H51 A;  2ZL8 A;  1JJ2 2;  3KII A;  1A2V A;  2K54 A;  1JKG B;  1OH0 A;  1M90 4;  2Z77 A;  1IT7 A;  2QGU A;  3F7S A;  1W02 A;  4K1V A;  1ZO2 A;  3GAX A;  1ROA A;  4CCV A;  1PFP A;  1RJO A;  3EQQ B;  1OHP A;  3X42 A;  3AMO B;  3MSO A;  3GRD A;  1CYU A;  3T8N A;  2W9Q A;  1GY6 A;  3KSE D;  1UUV B;  3F7X A;  3NHX A;  4ORL A;  2IMJ A;  4STD A;  2FNQ A;  1DYU A;  3FF0 A;  4J8T A;  4MMY B;  3MKI A;  3NUV A;  2HMN B;  2W56 B;  4HBR A;  5D82 A;  2STD A;  3EBY A;  3FGY A;  3FCS B;  1KC8 4;  4EYC A;  2CWU A;  3DXO A;  3Q90 A;  1NJI 4;  4R80 A;  1FGM A;  3WOF B;  1N8R 4;  2IUJ A;  4FMB A;  2YX9 A;  4KVH A;  4U13 A;  1QVG 2;  1A2K A;  4KFF A;  2CFW A;  2W56 A;  2Y73 A;  3K0Z A;  1CQS A;  1IVX A;  2W2C A;  3MWZ A;  3OWY A;  3S67 A;  3UB1 A;  3K9M C;  4J9A A;  5LC7 A;  2WGO A;  5KP4 A;  1YGE A;  3CXC 2;  2XSH B;  3JUO A;  3JUQ A;  1AR0 A;  3JUM A;  3X40 A;  5IG4 A;  2HMK B;  5IER A;  1TU5 A;  3CCM 3;  3G0K A;  1IV7 A;  1AVK A;  3CNX A;  4K1U A;  2CW9 A;  3JVC A;  3G6E 3;  1ULJ B;  3HII A;  2GU1 A;  3MPH A;  2CWV A;  1JKG A;  3FH1 A;  4O8S A;  1W6C A;  2CG1 A;  1NU3 A;  5EEO A;  2B1X B;  3TDG A;  4N6M A;  1O7H B;  1OGX A;  4N6L A;  1V74 A;  4K90 B;  2Y74 A;  3ECF A;  2CFD A;  3F40 A;  3RGA A;  3CC4 3;  4N6T A;  3NBR A;  3ALA A;  4XBX A;  2F98 A;  4FMD A;  2JQ5 A;  4HM8 B;  5IG0 A;  3T0U A;  1W4N A;  5IEN A;  2ZDJ A;  4OK0 A;  1WQL B;  3DGM A;  2CC3 A;  3FZW A;  4RNY A;  1SPU A;  3EE1 A;  2HMO B;  1VQ9 3;  3SOA A;  3OWS A;  3EJV A;  1YIJ 3;  1TFK A;  5IG5 A;  2P05 A;  1VZZ A;  3IPT A;  1IVW A;  4XM4 A;  2JDI H;  3VF1 A;  4HYZ A;  4GB5 A;  5EQL A;  1GY5 A;  3V98 A;  4CDL A;  5IEO A;  1DVD A;  1IV9 A;  5A0O B;  1N9E A;  3EBT A;  1S5A A;  1Y4K A;  2P38 A;  3RDE A;  1IQ8 A;  1K9M 4;  3X3Z A;  1OPY A;  1QJG A;  3NBB A;  4HVN A;  2RFR A;  1CYV A;  2PNC A;  2HML B;  2XFT A;  3QK9 A;  4IT7 A;  3OX9 A;  5IEP A;  1YJW 3;  1KSI A;  1W00 A;  1US1 A;  3UL5 A;  1Z1S A;  2E2V A;  4N6U A;  3EX9 A;  1DMM A;  2GEX A;  4HM6 B;  3DZL A;  4JRF A;  3PGB A;  1VQN 3;  1M1K 4;  1SJW A;  2R4I A;  3GZR A;  1PU4 A;  1ZX2 A;  3LOY A;  3SVA A;  1JB5 A;  2GXF A;  3EN8 A;  3I56 3;  2Z76 A;  3BNE A;  2CG0 A;  3PYJ A;  3GZX B;  1TUH A;  3SED A;  3GWR A;  2E2U A;  3WMD A;  1QVF 2;  3OXA A;  2BT3 A;  1K73 4;  5STD A;  2OTJ 3;  3CPO A;  3CU3 A;  1YVB I;  2XGL A;  4EV2 A;  3JUN A;  2OWP A;  2PZV A;  3CCV 3;  3G4S 3;  3PCS A;  3U1W A;  4XBY A;  1RKY A;  2WOF A;  1JRQ A;  3I0Y A;  3MYT A;  2Q07 A;  4H3U A;  1W5Z A;  1W01 A;  5HGR A;  1DMN A;  1TFO A;  2RSX A;  1UI7 A;  1Q86 4;  2LQV A;  1OHS A;  4HZ9 B;  2RCD A;  1FGO A;  1TP6 A;  3NV0 A;  2L4V A;  3KFQ C;  1Q81 4;  3EN1 B;  4KZ1 A;  1STF I;  4NHF A;  2QA4 3;  4RBN A;  4HM5 B;  1UUW B;  1SQW A;  1YHQ 3;  2KRT A;  3T8U A;  3D3L A;  3LYG A;  3S27 A;  1IVV A;  2CFL A;  2W04 A;  1C7H A;  1VQ4 3;  4HM0 B;  3B8L A;  1R4C A;  7STD A;  2BMR B;  3MG3 A;  3NQY A;  3K63 A;  4LSO A;  4RNZ A;  1HKX A;  1BUQ A;  3MG2 A;  1GD3 A;  2P09 A;  1YIT 3;  1JN5 B;  4WHA A;  3M8C A;  4IIA A;  5TGN A;  4MEI A;  1T5Y A;  3OWU A;  3STD A;  3G71 3;  1GD4 A;  4XDV A;  4N6N B;  1VQ7 3;  1VQL 3;  2Z6B A;  3LTD A;  2KXG A;  1NWW A;  1GS3 A;  1F8N A;  2A15 A;  3EF8 A;  2WO0 A;  3FG1 A;  4EV5 A;  1E3V A;  4O3V A;  3Q1C A;  4L7K A;  2XR8 B;  2HMM B;  4EBG A;  3D9R A;  3DGN A;  5CF2 A;  1O7G B;  1STD A;  3DMC A;  4XBT A;  3CCS 3;  3ROB A;  4GL6 A;  3SLU A;  3RGR A;  2OTL 3;  1O7N B;  2C11 A;  4OUQ A;  2K0M A;  5CXO A;  3WA2 X;  1W2B 2;  3LT9 A;  4FMC A;  5EVH A;  3QRD A;  5CK6 A;  1ASK A;  1W6Y A;  2P0X A;  3AMO A;  4BTW A;  2ML6 A;  4HM3 B;  1EG9 B;  4LZI A;  3X41 A;  3BND A;  3LTA A;  3Q2P A;  2QIY A;  1IVU A;  4RZM A;  1Q7Y 4;  3DY5 A;  3PZW A;  1NO3 A;  2QEX 3;  2W9P A;  2GEY A;  1K8A 4;  2XGN A;  2BNG A;  4R4K A;  4HJL B;  3KSP A;  1VQ6 3;  2MC8 A;  3X3Y A;  4HM7 B;  1OCV A;  4FCM A;  5D81 A;  1GY7 A;  2ML5 A;  1TIJ A;  3EB8 A;  2OOV C;  1FUW A;  1NB5 I;  1DMQ A;  4HKV B;  3FSD A;  3NQZ A;  3LTB A;  4FR9 A;  1VQK 3;  1WMO A;  3F8H A;  2CWT A;  4LGQ A;  3CPW 2;  3O8Y A;  1ULI B;  3BNB A;  1W6G A;  3NBJ A;  3LT8 A;  5IF6 A;  1U8C B;  1QAF A;  3FG4 A;  1FGR A;  3B7C A;  4MMX B;  3IJE B;  5IG3 A;  4XB5 A;  2OQE A;  1Q82 4;  3FKA A;  1Q40 B;  3NM7 A;  3BNC A;  1YJN 3;  1O7M B;  4KFD A;  4QWT A;  1KQS 2;  1MNL A;  4HZB B;  5JBS A;  3CCL 3;  5FGO A;  3NXJ A;  1J2B A;  4AEQ A;  3U97 A;  3PCR A;  1OHO A;  4BTX A;  2YFL B;  1EA2 A;  1VQP 3;  2YFJ B;  5JPP A;  4WWU C;  1N5P A;  1RN7 A;  2BO9 B;  4R9L A;  2MF7 A;  1OF5 B;  2CKF B;  4N6V 0;  2OQE C;  2RGQ A;  3H3H A;  4XDW A;  3KZT A;  3WDG B;  3UNL A;  4KFE A;  2GBW B;  3CC7 3;  3CCQ 3;  3F14 A;  1K41 A;  1M1X B;  1AV4 A;  3PXM A;  5ELU A;  3L0R A;  1JV2 B;  3DGL A;  5JPU A;  4BTY A;  1IQX A;  1SII A;  2F86 B;  3NX0 A;  3LZA A;  5AEW B;  5FW5 A;  8CHO A;  5DRE A;  3B4P A;  5LC6 A;  1FGT A;  1EQK A;  3K5T A;  5AIF A;  1JB4 A;  2HMJ B;  1KD1 4;  1U5O A;  3N54 B;  4WP5 A;  1IT8 A;  2GU3 A;  3EHC A;  3IMA B;  1W7C A;  1LNH A;  1N5H A;  3X3X A;  3G8Z A;  3G16 A;  1OAC A;  3CNM A;  5BXQ A;  1QMA A;  2D1W A;  1UW1 A;  2F99 A;  1Q42 A;  3E99 A;  5DRV A;  3CCJ 3;  4WFO A;  5AI1 A;  1LXE A;  3F9S A;  3LH4 A;  2I9W A;  1RRH A;  4AKY A;  1VQM 3;  1RRL A;  3HZP A;  1OGZ A;  2OOV A;  3DUK A;  1NB3 I;  1WTH A;  3N8B A;  3WOD G;  1VQ5 3;  2XFS A;  4R9K A;  1VQ8 3;  1D6Y A;  1N9J A;  3MG1 A;  2CK3 H;  3UL6 A;  1GYB A;  3J7Y d;  3FF2 A;  3S28 A;  2BHM A;  1WMP A;  3DGO A;  2SBL A;  3KKG A;  1NDO B;  4O2H A;  3CCU 3;  1HU9 A;  5G2G A;  2P0M A;  4IPB A;  5D83 A;  2FXT A;  3MHE A;  3UJM A;  3I55 3;  4N3V A;  4NRE A;  1MOL A;  2WOH A;  3VGN A;  2D42 A;  2O9U X;  3S29 A;  3LML A;  5ELJ A;  2M7O A;  3VSY A;  5AIG A;  3WOE B;  2YFI B;  3B4O A;  6STD A;  5I97 A;  3KE7 A;  3CCE 3;  5AYR B;  1FGQ A;  5CF1 A;  1N8Q A;  4WYK A;  4EXR A;  2IUK A;  2W03 A;  1OUN A;  2CIU A;  2BMQ B;  2Z7A A;  3DM8 A;  4R1K A;  4OVM A;  3HK4 A;  3PS8 A;  4HM4 B;  1E3R A;  3CC2 3;  4I4K A;  3SOY A;  3KN4 A;  4X2O A;  3WA3 A;  3F8X A;  3JUP A;  1IQY A;  4LEH A;  3HI7 A;  3ER7 A;  4FCJ A;  5KP1 A;  3NV0 B;  1YI2 3;  2UX0 A;  1L5G B;  5AIH A;  1DVC A;  4X2H A;  1O7P B;  5BVB A;  4MMZ B;  1KWI A;  3SX1 A;  2B24 B;  4K61 A;  4L8O A;  1ROV A;  1IU7 A;  1Q40 A;  2XSO B;  1OF5 A;  3NM2 A;  3OV4 A;  2GBX B;  5IW9 A;  3HX8 A;  4FMA A;  4HM1 B;  3OW2 2;  1D6U A;  5KP3 A;  1VQO 3;  1IK3 A;  2IA7 A;  2FGT A;  1JN5 A;  3V99 A;  3V92 A;  5AII A;  3CD6 3;  1K28 A;  3FLJ A;  2KCD A;  3FG3 A;  1FA3 A;  2LYX A;  1JB2 A;  3EC9 A;  1YJ9 3;  1ISK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...