3I553

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 6
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3i55300
1Q864 1YJN3 3CC23 1VQP3 1Q814 1QVF2 3I563 3G4S3 1VQO3 1VQ73 3G6E3 1YJW3 1W2B2 1JJ22 3CMA3 1VQ63 1VQ53 1Q824 1N8R4 3CCQ3 3CC43 1KC84 1M1K4 3CPW2 3G713 1Q7Y4 1K9M4 3CCL3 3CC73 1KQS2 1VQ43 1VQ93 3CCJ3 1VQK3 2OTL3 2QA43 3CCE3 3CME3 2OTJ3 2QEX3 1YIT3 3CCM3 1VQ83 1QVG2 1M904 3CD63 1VQN3 3I553 3CCU3 1VQM3 1NJI4 1K8A4 1S723 1KD14 1K734 3CCV3 1YI23 1YJ93 1YIJ3 3CCR3 3CCS3 3CXC2 1YHQ3 1VQL3 3OW22
chains in the Genus database with same CATH superfamily
3HOHA 4FCZA 1GMQA 1I3FA 4GHOA 4JF8A 3N9HA 2Y73A 5JPPA 1BNRA 3F8XA 1SARA 1W2B2 1DVDA 4L7KA 3EB8A 3G6E3 1JJ22 4ILFA 1X1XA 1FGTA 1JZOA 2B24B 3J7Yd 1CQSA 4BL2A 1GOYA 3PXMA 1RGHA 3NBBA 1RGCA 4L8OA 1UI7A 2CX1A 3LTAA 4EV2A 1Q40A 1RRHA 2CFKA 5KP3A 1EKMA 3K7CA 3BU4A 3AMOB 4AKZA 1N9JA 1SJWA 3GZBA 3U97A 3A5EA 1JV2B 1O7WB 2KXGA 4X2OA 3DGLA 1ZS7A 5FW5A 4GSPA 4N6V0 1I8VA 3IJEB 1ZX2A 1BNFA 4XM4A 1G0TA 1U8CB 2PZVA 3FF2A 1UCJA 2XFSA 1RGEA 1UUGB 5JBSA 3G0KA 1JKGA 1IYYA 5IW9A 2SARA 1M9GA 3WODG 1CEWI 1VQ53 4MMZB 1IT7A 1OGZA 2CFWA 4JRFA 8CHOA 1ROVA 2QIYA 4R9LA 1GD4A 3ROBA 3NM2A 1W00A 3MHEA 4HM7B 4H61A 5D83A 1BGSA 5G1LA 3JUNA 4N6NB 1B3SA 3B8LA 4IPBA 2W0QA 2IYJA 1GSPA 1D6UA 1YGWA 1BSBA 3OV4A 1JBSA 2HMJB 3FCSB 1YI23 1FZUA 1LNHA 2OOVC 3NV0B 2D42A 3GSPA 4H3UA 1LOXA 3OW22 2WOHA 2XSHB 2OQEC 2R41A 2CC3A 2AAEA 4WWUC 2F98A 2IUKA 2XGLA 3SEDA 1TIJA 8RNTA 1GS3A 5I97A 3ZG5A 1N5PA 3EF8A 4K90B 1OHOA 3PCSA 4QWTA 3D5GA 3JUQA 1W01A 1M1XB 1UW1A 3CCE3 1I70A 3IMAB 2GBWB 1LNIA 2ZA4A 3GAXA 1QVG2 1QALA 3Q3FA 1RGGA 3BNCA 3RDEA 1VQM3 4HM4B 4GL6A 4HOHA 1RNBA 2YFIB 4FMAA 1YIJ3 5HOHA 3RNTA 1AV4A 2KF6A 1UI8A 1F8NA 2KF3A 1RGKA 2UUGC 4X2HA 1UUVB 1S5AA 1AY7A 1BSAA 1QAKA 5BU4A 1Q814 3EN1B 3SX1A 1O7NB 4BU4A 2H0HA 1SIHA 1A2PA 4CJNA 2IMJA 2B1XB 3BNBA 3GWRA 1NB5I 1RCKA 3X40A 1UCKA 4WYKB 4J9AA 2M7OA 1K9M4 3CCJ3 1IQXA 4RNZA 2L4VA 2OCTA 3UB1A 1IVUA 1GY7A 2C4BA 1TRPA 3KKGA 2F99A 4I4KA 1RKYA 4NPBA 1L5GB 1B21A 3OWYA 2K0MA 4L8PA 2HMNB 4LGQA 3UNLA 1S723 2CG1A 1DMNA 1LOWA 4DKIA 2MC8A 1BRJA 4ORLA 1GOUA 1LOVA 3G16A 1FA3A 1BSDA 3LT9A 1LRAA 3FLJA 3JUOA 2Z7AA 1I3IA 3EHCA 1RGFA 1QAFA 2CG0A 3CNMA 2ZHXB 2BHMA 5BXQA 3I563 2HMLB 1UGHI 3T8UA 1W6YA 1ASKA 1RTUA 1KC84 3X3YA 1M1K4 9RNTA 1B2UA 2A15A 4R4KA 2BMRB 2O3OA 3K0ZA 5AEUB 1FUTA 2CWTA 5G1KA 3TDGA 2XGNA 3D4AA 1YIT3 2D1WA 1NB3I 3CCM3 1W7CA 3DGOA 2ZDJA 3WA2X 2MF7A 2WOFA 2FGTA 2RBIA 1CYVA 1BRIA 1RHLA 1YJ93 2Y74A 4KFFA 3MG1A 3D9RA 3X42A 1K28A 3F7XA 3K9MC 4R80A 3SOYA 2CWVA 2E2TA 3OWUA 4HJLB 2F86B 1QVF2 1NO3A 4BTWA 3FSDA 2QGUA 3Q90A 5D82A 5BIRA 3SOAA 3UJMA 1BIRA 2RCDA 1W6CA 4XBYA 1V74A 1WQLB 1OGXA 3HI7A 5AIGA 5DRVA 2LYXA 2W9QA 2OOVA 2WO0A 1DMQA 1N9EA 4IIAA 1N5HA 3VSYA 1I2GA 3BNEA 2OWPA 5AIHA 2BMQB 1IV9A 2CX0A 3K5TA 1KD14 1B2MA 3JVCA 2BMOB 1Z1SA 3AGOA 3LXUX 2FXTA 1RN7A 2XF3A 1VQ83 3I0YA 4HVNA 1Q864 1RLSA 6RNTA 2P09A 3NM7A 2V1LA 2Z77A 1VQ73 2RNTA 4BL3A 5CXOA 3JUPA 4EW5A 3LOYA 4TX4A 1TU5A 1GMRA 1ISKA 1LXEA 2H0IA 3EE1A 1HZ1A 1AVLA 3F14A 1KWIA 3G713 1VQ43 3MKIA 1VQ93 2WGOA 4HM2B 4CDLA 2I9WA 5IF6A 2W9PA 3CPOA 3FGYA 3OX9A 1T2HA 3NBRA 1ULJB 5LC7A 2XSOB 1JN5A 3OXAA 3VGNA 1FUSA 1NJI4 1LQMB 3MPHA 5RNTA 1RJOA 1EUIC 1BRNL 1IVXA 5AYSC 3ALAA 4K1VA 4MJDA 1MWUA 2O9UX 3BLZA 4MEIA 3WHOA 1BSEA 3KSED 5M1AA 1A90A 1VQ63 1JB5A 2W56A 1N8R4 1OF5A 2BU4A 4RNTA 3KCHA 1RSNA 1R4YA 1GYBA 1BNGA 2FNQA 4LEHA 5STDA 5A0OB 3NBJA 1AQZA 1ZO2A 3KIIA 4HM3B 1BAOA 3JUMA 1E3RA 3EBYA 3O8YA 2KF4A 4BTXA 2CFDA 1TRQA 1UGIA 3MYTA 2IUJA 3FKAA 1VQN3 5CK6A 1IDPA 2KCDA 4HM6B 3FF0A 1DVCA 2YFJB 3PCRA 2XR8B 1MOLA 1G96A 2CIUA 3CCS3 5JPUA 1RGAA 6GSPA 3DUKA 3HZPA 3PZWA 1A2VA 3K63A 3FZWA 3LMLA 3GZXB 5M19A 1YJW3 1JBTA 4LMIA 1FUWA 2Z76A 4FMDA 1VQP3 1OPYA 1IVVA 1TJDA 2HMMB 1UUWB 1QMAA 2HMKB 5AIIA 3S29A 6STDA 3G4S3 1W6GA 5IEOA 3AMOA 4KFDA 4U13A 3CPW2 2XEPA 3DY5A 1Q9EA 1EG9B 3IPTA 3DGYA 4LYLB 4MMXB 2H0GA 4KZ1A 4OUQA 3RGRA 4EXRA 1VQK3 5G2GA 1EEJA 1I0XA 1PU4A 4FMBA 4BIRA 1BRSA 1SIIA 3QRDA 1RCLA 1DMMA 1EQKA 4N6MA 1Q40B 2YFLB 1GY5A 5D81A 4HZBB 3WOFB 4Q53A 3DZLA 3ZG0A 2CWUA 4CCVA 1T3BA 3F40A 3QK9A 1OHSA 1PYLA 1GMPA 3PGBA 4O3VA 3LTDA 1WMOA 1NDOB 1RGLA 1MWSA 1NWWA 2GBXB 2W03A 3ER7A 3CCQ3 1BRKA 1Q42A 3AGNA 3AHWA 4J5GA 5BVBA 3HK4A 1JKGB 1IK3A 1B2SA 1JB2A 2P05A 3KSPA 3PS8A 1Y4KA 3MSOA 1C7HA 2OTL3 2KF5A 2OTJ3 3L0RA 1LVNA 1T2IA 1RN4A 1D6ZA 1BNEA 1JNQA 4N6UA 3NV0A 4XDVA 3X3ZA 3X3XA 1M904 2UGIA 2UX0A 1NU3A 4HAAA 1AR0A 2BIRA 4LSOA 3E99A 3CCV3 1DE3A 1LQGC 3B7CA 5EEOA 1WTHA 3DGMA 4OK0A 3VF1A 1I2EA 1TUHA 1YGEA 1YHQ3 1Q824 1TFKA 1B2XA 5IG0A 1IT8A 1YJN3 1IQYA 3LYGA 2BT3A 1MGRA 1X1WA 1IU7A 4CPKA 1W5ZA 3CMA3 2GXFA 4LZIA 1GY6A 3V92A 3F8HA 1BRHA 2W2CA 4RNYA 3S28A 4I5QA 1O7GB 1US1A 4HM8B 4K1UA 3ZFZA 3CCL3 1BNSA 3S27A 5IERA 1FW7A 3F7SA 3S5CA 5AEWB 2CFGA 4FR9A 1JZDA 3KZTA 3T0UA 3WA3A 3SXXA 1RDSA 4HKVB 1DETA 1AVKA 2PNCA 4HZ9B 3GZRA 2OQEA 1PFPA 2J8XB 1BUJA 1HYFA 3M8CA 3S67A 1UDII 5CF2A 1WMNA 4WYKA 2F5MA 3D3LA 3NQYA 4XBTA 3T8NA 4KVHA 7STDA 1C54A 1V58A 4N3VA 4HM1B 1MNLA 4J8TA 4HYZA 3BNDA 3B4OA 3CC43 2C11A 1R4CA 3N54B 2P0XA 4O02B 1B20A 3NX0A 5IENA 1A2KA 5ELUA 2F56A 3Q2PA 1BNJA 2IA7A 3NXJA 1BANA 5IG4A 2IY2A 2GEYA 5KP4A 2P38A 1STDA 1KSIA 2L1SA 1UCIA 2E2UA 3GZYB 1FYSA 4EYCA 2E2VA 1YVBI 3BIRA 1VQQA 2RSXA 3EX9A 2GU3A 3HX8A 4K61A 2XRXB 1WMPA 7RNTA 2ML6A 2LQVA 3D79A 2CW9A 3WDGB 3RGAA 3HIGA 2F4YA 1MWRA 4N6TA 3U1WA 3WMDA 2JDIH 3NQZA 4HM0B 1CH0A 4N6OB 3CD63 1ROAA 3MWZA 1B2ZA 1ZGXA 1QJGA 3MG3A 1Q7Y4 3LZAA 4N6LA 3GRDA 5HGRA 3Q1CA 3LTBA 1O7MB 2STDA 3STDA 1FGMA 1NNVA 1OHPA 2ZL8A 4O2HA 2XFTA 1BSCA 2K54A 4O8SA 4WP5A 5LC6A 2CH9A 3FG1A 3KN4A 1VZZA 2AADA 5GSPA 1YVSA 3I553 2BNGA 5AI1A 1K734 1HU9A 4IT7A 2BO9B 2JQ5A 4BTYA 3KE7A 1UCLA 3CU3A 5KP1A 1WNHA 1G02A 1I2FA 2CK3H 4NREA 4WHAA 1EA2A 5CF1A 3FG4A 1BNIA 1BOXA 3EN8A 7GSPA 2SBLA 3EJVA 1O7HB 5EVHA 3UL6A 1K41A 3SVAA 1A67A 1LOYA 1N8QA 3EC9A 2WGQA 1T5YA 3WOEB 1ULIB 1E3VA 1TTOA 3H3HA 3CME3 2QA43 3AHSA 2QEX3 4KT3B 3LH4A 4XB5A 1SQWA 2HMOB 2KAAA 1SPUA 3H51A 2RGQA 1E97A 1FGRA 1YNVX 4WFOA 1OACA 2CFLA 1IVWA 4STDA 4EBGA 4RBNA 1MGWA 3V98A 1J2BA 1JBRA 1BUQA 2YX9A 1VQL3 5TGNA 1RNTA 1OCVA 3CC23 3WR2A 2XH9A 1RN1A 2P0MA 2Z6BA 3D5IA 5AYRB 3F9SA 3NUVA 4AEQA 4PEJA 3B4PA 4FCJA 4HM5B 4HBRA 2INXA 1GD3A 3EBTA 1DYUA 1KQS2 3PYJA 3CC73 4GB5A 3SYUA 1STFI 4G1MB 3KFQC 5AIFA 1GOVA 3DGNA 2R4IA 3UL5A 4EC6A 2W04A 3N8BA 1CYUA 5ELJA 4R9KA 1B27A 5CLKA 3CCU3 3EQQB 4NHFA 1BRGA 1I0VA 1OH0A 3SLUA 1K8A4 1FGQA 1IV7A 4FCMA 4R1KA 1IQ8A 5DREA 1MWTA 3ECFA 3FH1A 1FGOA 1OUNA 3X41A 3CCR3 2GEXA 1VQO3 4RZMA 5IEPA 1TFOA 5FGOA 1JN5B 2RFRA 2GU1A 4EV5A 2HOHA 1BVIA 4MMYB 1BU4A 3DXOA 5M18A 1W02A 4OVMA 3HIIA 3A76A 1JB4A 2K3DA 2W6JH 3CNXA 2Q07A 3DM8A 1HKXA 2CKFB 4XBXA 1X1UA 3URPA 1PY3A 4FMCA 4ZM8A 4J5KA 2ML5A 3DH2A 1X1YA 3FG3A 2GSPA 2W56B 1TP6A 1OF5B 1O7PB 1V57A 1U5OA 1W2ZA 1JRQA 2C10A 3LTCA 4XDWA 1D6YA 3DMCA 2KRTA 5IG5A 3LT8A 1RMSA 1RRLA 2F5WA 1Q7HA 1W4NA 5IG3A 3MG2A 2CHCA 3BB9A 3G8ZA 5EQLA 3NHXA 3CXC2 4KFEA 3V99A 3OWSA 4AKYA
chains in the Genus database with same CATH topology
4FCZA 4JF8A 5JPPA 3N9HA 2Y73A 3F8XA 1W2B2 1DVDA 4L7KA 3EB8A 3G6E3 1JJ22 1FGTA 2B24B 3J7Yd 1CQSA 3PXMA 3NBBA 4L8OA 4EV2A 1UI7A 3LTAA 1Q40A 1RRHA 2CFKA 5KP3A 1EKMA 3K7CA 3AMOB 4AKZA 1N9JA 1SJWA 3GZBA 3U97A 1JV2B 1O7WB 2KXGA 4X2OA 3DGLA 5FW5A 4N6V0 4XM4A 3IJEB 1ZX2A 1U8CB 2PZVA 3FF2A 2XFSA 5JBSA 3G0KA 1JKGA 5IW9A 1M9GA 3WODG 1CEWI 1VQ53 4MMZB 1IT7A 1OGZA 2CFWA 4JRFA 8CHOA 1ROVA 2QIYA 4R9LA 1GD4A 3ROBA 3NM2A 1W00A 3MHEA 4HM7B 4H61A 5D83A 3JUNA 4N6NB 4IPBA 3B8LA 2W0QA 3OV4A 1D6UA 2HMJB 3FCSB 1YI23 1LNHA 2OOVC 3NV0B 2D42A 4H3UA 1LOXA 3OW22 2WOHA 2XSHB 2OQEC 2CC3A 4WWUC 2F98A 2IUKA 2XGLA 3SEDA 1TIJA 5I97A 1GS3A 1N5PA 3EF8A 4K90B 1OHOA 3PCSA 4QWTA 3JUQA 1W01A 1M1XB 1UW1A 3CCE3 3IMAB 2GBWB 3GAXA 1QVG2 1QALA 3BNCA 3RDEA 1VQM3 4HM4B 4GL6A 2YFIB 4FMAA 1YIJ3 1AV4A 1UI8A 1F8NA 4X2HA 1UUVB 1S5AA 1QAKA 1Q814 3EN1B 3SX1A 1O7NB 1SIHA 2IMJA 2B1XB 3BNBA 3GWRA 1NB5I 3X40A 4WYKB 4J9AA 2M7OA 1K9M4 3CCJ3 1IQXA 4RNZA 2L4VA 2OCTA 3UB1A 1IVUA 1GY7A 4I4KA 3KKGA 1RKYA 2F99A 1L5GB 3OWYA 2K0MA 4L8PA 2HMNB 4LGQA 3UNLA 1S723 2CG1A 1DMNA 2MC8A 4ORLA 3G16A 1FA3A 3LT9A 3JUOA 3FLJA 2Z7AA 3EHCA 2CG0A 1QAFA 3CNMA 2BHMA 5BXQA 3I563 2HMLB 3T8UA 1W6YA 1ASKA 1KC84 3X3YA 1M1K4 2A15A 4R4KA 2BMRB 2O3OA 3K0ZA 5AEUB 2CWTA 3TDGA 2XGNA 1YIT3 2D1WA 1NB3I 3CCM3 1W7CA 3DGOA 2ZDJA 3WA2X 2MF7A 2WOFA 2FGTA 1CYVA 1YJ93 2Y74A 4KFFA 3MG1A 3D9RA 3X42A 1K28A 3F7XA 3K9MC 4R80A 3SOYA 2CWVA 2E2TA 3OWUA 4HJLB 2F86B 1QVF2 1NO3A 4BTWA 3FSDA 2QGUA 3Q90A 5D82A 3SOAA 3UJMA 2RCDA 1W6CA 4XBYA 1V74A 1WQLB 1OGXA 3HI7A 5AIGA 5DRVA 2LYXA 2W9QA 2OOVA 2WO0A 1DMQA 1N9EA 4IIAA 1N5HA 3VSYA 3BNEA 5AIHA 2OWPA 1KD14 2BMQB 1IV9A 3K5TA 3JVCA 2BMOB 1Z1SA 3LXUX 2FXTA 1RN7A 2XF3A 1VQ83 3I0YA 4HVNA 1Q864 2P09A 3NM7A 2V1LA 2Z77A 1VQ73 5CXOA 3JUPA 3LOYA 4TX4A 1TU5A 1ISKA 1LXEA 3EE1A 1AVLA 3F14A 1KWIA 3G713 1VQ43 3MKIA 1VQ93 2WGOA 4HM2B 4CDLA 2I9WA 5IF6A 2W9PA 3CPOA 3FGYA 3OX9A 3NBRA 1ULJB 5LC7A 2XSOB 1JN5A 3OXAA 3VGNA 1NJI4 3MPHA 1RJOA 1IVXA 5AYSC 3ALAA 4K1VA 4MJDA 2O9UX 3BLZA 4MEIA 3KSED 1A90A 1VQ63 1JB5A 2W56A 1N8R4 1OF5A 1GYBA 2FNQA 4LEHA 5STDA 5A0OB 3NBJA 1ZO2A 3KIIA 4HM3B 3JUMA 1E3RA 3EBYA 3O8YA 4BTXA 2CFDA 3MYTA 2IUJA 3FKAA 1VQN3 5CK6A 1IDPA 2KCDA 4HM6B 3FF0A 1DVCA 2YFJB 3PCRA 2XR8B 1MOLA 1G96A 2CIUA 3CCS3 5JPUA 3DUKA 3HZPA 3PZWA 1A2VA 3K63A 3FZWA 3LMLA 3GZXB 1YJW3 4LMIA 1FUWA 2Z76A 4FMDA 1VQP3 1OPYA 1IVVA 2HMMB 2HMKB 1UUWB 1QMAA 5AIIA 3S29A 3G4S3 6STDA 1VQO3 1W6GA 5IEOA 3AMOA 4KFDA 4U13A 3CPW2 2XEPA 3DY5A 1EG9B 3IPTA 3RGRA 4MMXB 1VQK3 4KZ1A 4OUQA 4EXRA 5G2GA 1PU4A 4FMBA 1SIIA 3QRDA 1EQKA 1DMMA 4N6MA 1Q40B 2YFLB 1GY5A 5D81A 4HZBB 3WOFB 4Q53A 3DZLA 2CWUA 4CCVA 3F40A 3QK9A 1OHSA 4O3VA 3PGBA 3LTDA 1WMOA 1NDOB 2GBXB 2W03A 1NWWA 3ER7A 3CCQ3 1Q42A 5BVBA 3HK4A 1JKGB 1IK3A 1JB2A 2P05A 3KSPA 3PS8A 1Y4KA 3MSOA 1C7HA 2OTL3 2OTJ3 3L0RA 1LVNA 1D6ZA 1JNQA 3X3ZA 4N6UA 3NV0A 4XDVA 3X3XA 1M904 2UX0A 1NU3A 1AR0A 4LSOA 3E99A 3CCV3 3B7CA 5EEOA 1WTHA 3DGMA 4OK0A 3VF1A 1YHQ3 1TUHA 1YGEA 1Q824 1TFKA 5IG0A 1IT8A 1YJN3 1IQYA 3LYGA 2BT3A 1IU7A 1W5ZA 3CMA3 2GXFA 4LZIA 1GY6A 3V92A 3F8HA 2W2CA 4RNYA 3S28A 1O7GB 1US1A 4HM8B 4K1UA 3CCL3 3S27A 5IERA 3F7SA 3S5CA 5AEWB 2CFGA 4FR9A 3KZTA 3T0UA 3WA3A 3SXXA 4HKVB 2PNCA 1AVKA 4HZ9B 3GZRA 2OQEA 1PFPA 3M8CA 3S67A 5CF2A 1WMNA 4WYKA 7STDA 3D3LA 3NQYA 4XBTA 3T8NA 4KVHA 4N3VA 4HM1B 1MNLA 4J8TA 4HYZA 3BNDA 3B4OA 3CC43 2C11A 1R4CA 3N54B 2P0XA 4O02B 3NX0A 5IENA 1A2KA 5ELUA 3Q2PA 3NXJA 2IA7A 5KP4A 5IG4A 2GEYA 2P38A 1STDA 1KSIA 3GZYB 2E2UA 4EYCA 2E2VA 1YVBI 2RSXA 3EX9A 2GU3A 3HX8A 4K61A 2XRXB 1WMPA 2ML6A 2LQVA 2CW9A 3WDGB 3RGAA 3HIGA 4N6TA 3U1WA 3WMDA 2JDIH 3NQZA 4HM0B 3CD63 4N6OB 1ROAA 3MWZA 1QJGA 3MG3A 1Q7Y4 3LZAA 4N6LA 3GRDA 5HGRA 3Q1CA 3LTBA 1O7MB 2STDA 3STDA 1FGMA 1OHPA 2ZL8A 4WP5A 4O2HA 2XFTA 2K54A 5LC6A 4O8SA 2CH9A 3FG1A 3KN4A 1VZZA 3I553 2BNGA 5AI1A 1K734 1HU9A 4IT7A 2BO9B 2JQ5A 4BTYA 3KE7A 3CU3A 5KP1A 1WNHA 4NREA 2CK3H 4WHAA 1EA2A 5CF1A 3FG4A 3EN8A 2SBLA 3EJVA 1O7HB 5EVHA 3UL6A 1K41A 3SVAA 1A67A 1N8QA 3EC9A 2WGQA 1T5YA 3WOEB 1ULIB 1E3VA 3H3HA 3CME3 2QA43 2QEX3 3LH4A 4XB5A 1SQWA 2HMOB 1SPUA 3H51A 2RGQA 1E97A 1FGRA 4WFOA 1OACA 2CFLA 1IVWA 4STDA 4EBGA 4RBNA 3V98A 1J2BA 1BUQA 2YX9A 1VQL3 5TGNA 1OCVA 3CC23 2XH9A 2P0MA 2Z6BA 5AYRB 3F9SA 3NUVA 4AEQA 4PEJA 3B4PA 4FCJA 4HM5B 4HBRA 2INXA 1GD3A 3EBTA 1DYUA 1KQS2 3PYJA 3CC73 4GB5A 1STFI 4G1MB 3KFQC 5AIFA 3DGNA 2R4IA 3UL5A 4EC6A 2W04A 3N8BA 1CYUA 5ELJA 4R9KA 5CLKA 3CCU3 3EQQB 4NHFA 3SLUA 1OH0A 1K8A4 1FGQA 1IV7A 4FCMA 4R1KA 1IQ8A 5DREA 3ECFA 3FH1A 3CCR3 1FGOA 1OUNA 3X41A 2GEXA 4RZMA 5IEPA 1TFOA 5FGOA 1JN5B 2RFRA 2GU1A 4EV5A 4MMYB 3DXOA 1W02A 4OVMA 3HIIA 3A76A 1JB4A 3DM8A 2W6JH 3CNXA 2Q07A 4XBXA 1HKXA 2CKFB 4FMCA 4ZM8A 2ML5A 3FG3A 2W56B 1TP6A 1OF5B 1O7PB 1U5OA 1W2ZA 1JRQA 2C10A 3LTCA 4XDWA 1D6YA 3DMCA 2KRTA 5IG5A 3LT8A 1RRLA 1W4NA 5IG3A 3MG2A 2CHCA 3BB9A 3G8ZA 5EQLA 3NHXA 3CXC2 4KFEA 3V99A 3OWSA 4AKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 4;  1YJN 3;  3CC2 3;  1VQP 3;  1Q81 4;  1QVF 2;  3I56 3;  3G4S 3;  1VQO 3;  1VQ7 3;  3G6E 3;  1YJW 3;  1W2B 2;  1JJ2 2;  3CMA 3;  1VQ6 3;  1VQ5 3;  1Q82 4;  1N8R 4;  3CCQ 3;  3CC4 3;  1KC8 4;  1M1K 4;  3CPW 2;  3G71 3;  1Q7Y 4;  1K9M 4;  3CCL 3;  3CC7 3;  1KQS 2;  1VQ4 3;  1VQ9 3;  3CCJ 3;  1VQK 3;  2OTL 3;  2QA4 3;  3CCE 3;  3CME 3;  2OTJ 3;  2QEX 3;  1YIT 3;  3CCM 3;  1VQ8 3;  1QVG 2;  1M90 4;  3CD6 3;  1VQN 3;  3I55 3;  3CCU 3;  1VQM 3;  1NJI 4;  1K8A 4;  1S72 3;  1KD1 4;  1K73 4;  3CCV 3;  1YI2 3;  1YJ9 3;  1YIJ 3;  3CCR 3;  3CCS 3;  3CXC 2;  1YHQ 3;  1VQL 3;  3OW2 2; 
#chains in the Genus database with same CATH topology
 3HOH A;  4FCZ A;  1GMQ A;  1I3F A;  4GHO A;  4JF8 A;  3N9H A;  2Y73 A;  5JPP A;  1BNR A;  3F8X A;  1SAR A;  1W2B 2;  1DVD A;  4L7K A;  3EB8 A;  3G6E 3;  1JJ2 2;  4ILF A;  1X1X A;  1FGT A;  1JZO A;  2B24 B;  3J7Y d;  1CQS A;  4BL2 A;  1GOY A;  3PXM A;  1RGH A;  3NBB A;  1RGC A;  4L8O A;  1UI7 A;  2CX1 A;  3LTA A;  4EV2 A;  1Q40 A;  1RRH A;  2CFK A;  5KP3 A;  1EKM A;  3K7C A;  3BU4 A;  3AMO B;  4AKZ A;  1N9J A;  1SJW A;  3GZB A;  3U97 A;  3A5E A;  1JV2 B;  1O7W B;  2KXG A;  4X2O A;  3DGL A;  1ZS7 A;  5FW5 A;  4GSP A;  4N6V 0;  1I8V A;  3IJE B;  1ZX2 A;  1BNF A;  4XM4 A;  1G0T A;  1U8C B;  2PZV A;  3FF2 A;  1UCJ A;  2XFS A;  1RGE A;  1UUG B;  5JBS A;  3G0K A;  1JKG A;  1IYY A;  5IW9 A;  2SAR A;  1M9G A;  3WOD G;  1CEW I;  1VQ5 3;  4MMZ B;  1IT7 A;  1OGZ A;  2CFW A;  4JRF A;  8CHO A;  1ROV A;  2QIY A;  4R9L A;  1GD4 A;  3ROB A;  3NM2 A;  1W00 A;  3MHE A;  4HM7 B;  4H61 A;  5D83 A;  1BGS A;  5G1L A;  3JUN A;  4N6N B;  1B3S A;  3B8L A;  4IPB A;  2W0Q A;  2IYJ A;  1GSP A;  1D6U A;  1YGW A;  1BSB A;  3OV4 A;  1JBS A;  2HMJ B;  3FCS B;  1YI2 3;  1FZU A;  1LNH A;  2OOV C;  3NV0 B;  2D42 A;  3GSP A;  4H3U A;  1LOX A;  3OW2 2;  2WOH A;  2XSH B;  2OQE C;  2R41 A;  2CC3 A;  2AAE A;  4WWU C;  2F98 A;  2IUK A;  2XGL A;  3SED A;  1TIJ A;  8RNT A;  1GS3 A;  5I97 A;  3ZG5 A;  1N5P A;  3EF8 A;  4K90 B;  1OHO A;  3PCS A;  4QWT A;  3D5G A;  3JUQ A;  1W01 A;  1M1X B;  1UW1 A;  3CCE 3;  1I70 A;  3IMA B;  2GBW B;  1LNI A;  2ZA4 A;  3GAX A;  1QVG 2;  1QAL A;  3Q3F A;  1RGG A;  3BNC A;  3RDE A;  1VQM 3;  4HM4 B;  4GL6 A;  4HOH A;  1RNB A;  2YFI B;  4FMA A;  1YIJ 3;  5HOH A;  3RNT A;  1AV4 A;  2KF6 A;  1UI8 A;  1F8N A;  2KF3 A;  1RGK A;  2UUG C;  4X2H A;  1UUV B;  1S5A A;  1AY7 A;  1BSA A;  1QAK A;  5BU4 A;  1Q81 4;  3EN1 B;  3SX1 A;  1O7N B;  4BU4 A;  2H0H A;  1SIH A;  1A2P A;  4CJN A;  2IMJ A;  2B1X B;  3BNB A;  3GWR A;  1NB5 I;  1RCK A;  3X40 A;  1UCK A;  4WYK B;  4J9A A;  2M7O A;  1K9M 4;  3CCJ 3;  1IQX A;  4RNZ A;  2L4V A;  2OCT A;  3UB1 A;  1IVU A;  1GY7 A;  2C4B A;  1TRP A;  3KKG A;  2F99 A;  4I4K A;  1RKY A;  4NPB A;  1L5G B;  1B21 A;  3OWY A;  2K0M A;  4L8P A;  2HMN B;  4LGQ A;  3UNL A;  1S72 3;  2CG1 A;  1DMN A;  1LOW A;  4DKI A;  2MC8 A;  1BRJ A;  4ORL A;  1GOU A;  1LOV A;  3G16 A;  1FA3 A;  1BSD A;  3LT9 A;  1LRA A;  3FLJ A;  3JUO A;  2Z7A A;  1I3I A;  3EHC A;  1RGF A;  1QAF A;  2CG0 A;  3CNM A;  2ZHX B;  2BHM A;  5BXQ A;  3I56 3;  2HML B;  1UGH I;  3T8U A;  1W6Y A;  1ASK A;  1RTU A;  1KC8 4;  3X3Y A;  1M1K 4;  9RNT A;  1B2U A;  2A15 A;  4R4K A;  2BMR B;  2O3O A;  3K0Z A;  5AEU B;  1FUT A;  2CWT A;  5G1K A;  3TDG A;  2XGN A;  3D4A A;  1YIT 3;  2D1W A;  1NB3 I;  3CCM 3;  1W7C A;  3DGO A;  2ZDJ A;  3WA2 X;  2MF7 A;  2WOF A;  2FGT A;  2RBI A;  1CYV A;  1BRI A;  1RHL A;  1YJ9 3;  2Y74 A;  4KFF A;  3MG1 A;  3D9R A;  3X42 A;  1K28 A;  3F7X A;  3K9M C;  4R80 A;  3SOY A;  2CWV A;  2E2T A;  3OWU A;  4HJL B;  2F86 B;  1QVF 2;  1NO3 A;  4BTW A;  3FSD A;  2QGU A;  3Q90 A;  5D82 A;  5BIR A;  3SOA A;  3UJM A;  1BIR A;  2RCD A;  1W6C A;  4XBY A;  1V74 A;  1WQL B;  1OGX A;  3HI7 A;  5AIG A;  5DRV A;  2LYX A;  2W9Q A;  2OOV A;  2WO0 A;  1DMQ A;  1N9E A;  4IIA A;  1N5H A;  3VSY A;  1I2G A;  3BNE A;  2OWP A;  5AIH A;  2BMQ B;  1IV9 A;  2CX0 A;  3K5T A;  1KD1 4;  1B2M A;  3JVC A;  2BMO B;  1Z1S A;  3AGO A;  3LXU X;  2FXT A;  1RN7 A;  2XF3 A;  1VQ8 3;  3I0Y A;  4HVN A;  1Q86 4;  1RLS A;  6RNT A;  2P09 A;  3NM7 A;  2V1L A;  2Z77 A;  1VQ7 3;  2RNT A;  4BL3 A;  5CXO A;  3JUP A;  4EW5 A;  3LOY A;  4TX4 A;  1TU5 A;  1GMR A;  1ISK A;  1LXE A;  2H0I A;  3EE1 A;  1HZ1 A;  1AVL A;  3F14 A;  1KWI A;  3G71 3;  1VQ4 3;  3MKI A;  1VQ9 3;  2WGO A;  4HM2 B;  4CDL A;  2I9W A;  5IF6 A;  2W9P A;  3CPO A;  3FGY A;  3OX9 A;  1T2H A;  3NBR A;  1ULJ B;  5LC7 A;  2XSO B;  1JN5 A;  3OXA A;  3VGN A;  1FUS A;  1NJI 4;  1LQM B;  3MPH A;  5RNT A;  1RJO A;  1EUI C;  1BRN L;  1IVX A;  5AYS C;  3ALA A;  4K1V A;  4MJD A;  1MWU A;  2O9U X;  3BLZ A;  4MEI A;  3WHO A;  1BSE A;  3KSE D;  5M1A A;  1A90 A;  1VQ6 3;  1JB5 A;  2W56 A;  1N8R 4;  1OF5 A;  2BU4 A;  4RNT A;  3KCH A;  1RSN A;  1R4Y A;  1GYB A;  1BNG A;  2FNQ A;  4LEH A;  5STD A;  5A0O B;  3NBJ A;  1AQZ A;  1ZO2 A;  3KII A;  4HM3 B;  1BAO A;  3JUM A;  1E3R A;  3EBY A;  3O8Y A;  2KF4 A;  4BTX A;  2CFD A;  1TRQ A;  1UGI A;  3MYT A;  2IUJ A;  3FKA A;  1VQN 3;  5CK6 A;  1IDP A;  2KCD A;  4HM6 B;  3FF0 A;  1DVC A;  2YFJ B;  3PCR A;  2XR8 B;  1MOL A;  1G96 A;  2CIU A;  3CCS 3;  5JPU A;  1RGA A;  6GSP A;  3DUK A;  3HZP A;  3PZW A;  1A2V A;  3K63 A;  3FZW A;  3LML A;  3GZX B;  5M19 A;  1YJW 3;  1JBT A;  4LMI A;  1FUW A;  2Z76 A;  4FMD A;  1VQP 3;  1OPY A;  1IVV A;  1TJD A;  2HMM B;  1UUW B;  1QMA A;  2HMK B;  5AII A;  3S29 A;  6STD A;  3G4S 3;  1W6G A;  5IEO A;  3AMO A;  4KFD A;  4U13 A;  3CPW 2;  2XEP A;  3DY5 A;  1Q9E A;  1EG9 B;  3IPT A;  3DGY A;  4LYL B;  4MMX B;  2H0G A;  4KZ1 A;  4OUQ A;  3RGR A;  4EXR A;  1VQK 3;  5G2G A;  1EEJ A;  1I0X A;  1PU4 A;  4FMB A;  4BIR A;  1BRS A;  1SII A;  3QRD A;  1RCL A;  1DMM A;  1EQK A;  4N6M A;  1Q40 B;  2YFL B;  1GY5 A;  5D81 A;  4HZB B;  3WOF B;  4Q53 A;  3DZL A;  3ZG0 A;  2CWU A;  4CCV A;  1T3B A;  3F40 A;  3QK9 A;  1OHS A;  1PYL A;  1GMP A;  3PGB A;  4O3V A;  3LTD A;  1WMO A;  1NDO B;  1RGL A;  1MWS A;  1NWW A;  2GBX B;  2W03 A;  3ER7 A;  3CCQ 3;  1BRK A;  1Q42 A;  3AGN A;  3AHW A;  4J5G A;  5BVB A;  3HK4 A;  1JKG B;  1IK3 A;  1B2S A;  1JB2 A;  2P05 A;  3KSP A;  3PS8 A;  1Y4K A;  3MSO A;  1C7H A;  2OTL 3;  2KF5 A;  2OTJ 3;  3L0R A;  1LVN A;  1T2I A;  1RN4 A;  1D6Z A;  1BNE A;  1JNQ A;  4N6U A;  3NV0 A;  4XDV A;  3X3Z A;  3X3X A;  1M90 4;  2UGI A;  2UX0 A;  1NU3 A;  4HAA A;  1AR0 A;  2BIR A;  4LSO A;  3E99 A;  3CCV 3;  1DE3 A;  1LQG C;  3B7C A;  5EEO A;  1WTH A;  3DGM A;  4OK0 A;  3VF1 A;  1I2E A;  1TUH A;  1YGE A;  1YHQ 3;  1Q82 4;  1TFK A;  1B2X A;  5IG0 A;  1IT8 A;  1YJN 3;  1IQY A;  3LYG A;  2BT3 A;  1MGR A;  1X1W A;  1IU7 A;  4CPK A;  1W5Z A;  3CMA 3;  2GXF A;  4LZI A;  1GY6 A;  3V92 A;  3F8H A;  1BRH A;  2W2C A;  4RNY A;  3S28 A;  4I5Q A;  1O7G B;  1US1 A;  4HM8 B;  4K1U A;  3ZFZ A;  3CCL 3;  1BNS A;  3S27 A;  5IER A;  1FW7 A;  3F7S A;  3S5C A;  5AEW B;  2CFG A;  4FR9 A;  1JZD A;  3KZT A;  3T0U A;  3WA3 A;  3SXX A;  1RDS A;  4HKV B;  1DET A;  1AVK A;  2PNC A;  4HZ9 B;  3GZR A;  2OQE A;  1PFP A;  2J8X B;  1BUJ A;  1HYF A;  3M8C A;  3S67 A;  1UDI I;  5CF2 A;  1WMN A;  4WYK A;  2F5M A;  3D3L A;  3NQY A;  4XBT A;  3T8N A;  4KVH A;  7STD A;  1C54 A;  1V58 A;  4N3V A;  4HM1 B;  1MNL A;  4J8T A;  4HYZ A;  3BND A;  3B4O A;  3CC4 3;  2C11 A;  1R4C A;  3N54 B;  2P0X A;  4O02 B;  1B20 A;  3NX0 A;  5IEN A;  1A2K A;  5ELU A;  2F56 A;  3Q2P A;  1BNJ A;  2IA7 A;  3NXJ A;  1BAN A;  5IG4 A;  2IY2 A;  2GEY A;  5KP4 A;  2P38 A;  1STD A;  1KSI A;  2L1S A;  1UCI A;  2E2U A;  3GZY B;  1FYS A;  4EYC A;  2E2V A;  1YVB I;  3BIR A;  1VQQ A;  2RSX A;  3EX9 A;  2GU3 A;  3HX8 A;  4K61 A;  2XRX B;  1WMP A;  7RNT A;  2ML6 A;  2LQV A;  3D79 A;  2CW9 A;  3WDG B;  3RGA A;  3HIG A;  2F4Y A;  1MWR A;  4N6T A;  3U1W A;  3WMD A;  2JDI H;  3NQZ A;  4HM0 B;  1CH0 A;  4N6O B;  3CD6 3;  1ROA A;  3MWZ A;  1B2Z A;  1ZGX A;  1QJG A;  3MG3 A;  1Q7Y 4;  3LZA A;  4N6L A;  3GRD A;  5HGR A;  3Q1C A;  3LTB A;  1O7M B;  2STD A;  3STD A;  1FGM A;  1NNV A;  1OHP A;  2ZL8 A;  4O2H A;  2XFT A;  1BSC A;  2K54 A;  4O8S A;  4WP5 A;  5LC6 A;  2CH9 A;  3FG1 A;  3KN4 A;  1VZZ A;  2AAD A;  5GSP A;  1YVS A;  3I55 3;  2BNG A;  5AI1 A;  1K73 4;  1HU9 A;  4IT7 A;  2BO9 B;  2JQ5 A;  4BTY A;  3KE7 A;  1UCL A;  3CU3 A;  5KP1 A;  1WNH A;  1G02 A;  1I2F A;  2CK3 H;  4NRE A;  4WHA A;  1EA2 A;  5CF1 A;  3FG4 A;  1BNI A;  1BOX A;  3EN8 A;  7GSP A;  2SBL A;  3EJV A;  1O7H B;  5EVH A;  3UL6 A;  1K41 A;  3SVA A;  1A67 A;  1LOY A;  1N8Q A;  3EC9 A;  2WGQ A;  1T5Y A;  3WOE B;  1ULI B;  1E3V A;  1TTO A;  3H3H A;  3CME 3;  2QA4 3;  3AHS A;  2QEX 3;  4KT3 B;  3LH4 A;  4XB5 A;  1SQW A;  2HMO B;  2KAA A;  1SPU A;  3H51 A;  2RGQ A;  1E97 A;  1FGR A;  1YNV X;  4WFO A;  1OAC A;  2CFL A;  1IVW A;  4STD A;  4EBG A;  4RBN A;  1MGW A;  3V98 A;  1J2B A;  1JBR A;  1BUQ A;  2YX9 A;  1VQL 3;  5TGN A;  1RNT A;  1OCV A;  3CC2 3;  3WR2 A;  2XH9 A;  1RN1 A;  2P0M A;  2Z6B A;  3D5I A;  5AYR B;  3F9S A;  3NUV A;  4AEQ A;  4PEJ A;  3B4P A;  4FCJ A;  4HM5 B;  4HBR A;  2INX A;  1GD3 A;  3EBT A;  1DYU A;  1KQS 2;  3PYJ A;  3CC7 3;  4GB5 A;  3SYU A;  1STF I;  4G1M B;  3KFQ C;  5AIF A;  1GOV A;  3DGN A;  2R4I A;  3UL5 A;  4EC6 A;  2W04 A;  3N8B A;  1CYU A;  5ELJ A;  4R9K A;  1B27 A;  5CLK A;  3CCU 3;  3EQQ B;  4NHF A;  1BRG A;  1I0V A;  1OH0 A;  3SLU A;  1K8A 4;  1FGQ A;  1IV7 A;  4FCM A;  4R1K A;  1IQ8 A;  5DRE A;  1MWT A;  3ECF A;  3FH1 A;  1FGO A;  1OUN A;  3X41 A;  3CCR 3;  2GEX A;  1VQO 3;  4RZM A;  5IEP A;  1TFO A;  5FGO A;  1JN5 B;  2RFR A;  2GU1 A;  4EV5 A;  2HOH A;  1BVI A;  4MMY B;  1BU4 A;  3DXO A;  5M18 A;  1W02 A;  4OVM A;  3HII A;  3A76 A;  1JB4 A;  2K3D A;  2W6J H;  3CNX A;  2Q07 A;  3DM8 A;  1HKX A;  2CKF B;  4XBX A;  1X1U A;  3URP A;  1PY3 A;  4FMC A;  4ZM8 A;  4J5K A;  2ML5 A;  3DH2 A;  1X1Y A;  3FG3 A;  2GSP A;  2W56 B;  1TP6 A;  1OF5 B;  1O7P B;  1V57 A;  1U5O A;  1W2Z A;  1JRQ A;  2C10 A;  3LTC A;  4XDW A;  1D6Y A;  3DMC A;  2KRT A;  5IG5 A;  3LT8 A;  1RMS A;  1RRL A;  2F5W A;  1Q7H A;  1W4N A;  5IG3 A;  3MG2 A;  2CHC A;  3BB9 A;  3G8Z A;  5EQL A;  3NHX A;  3CXC 2;  4KFE A;  3V99 A;  3OWS A;  4AKY A; 
#chains in the Genus database with same CATH homology
 4FCZ A;  4JF8 A;  5JPP A;  3N9H A;  2Y73 A;  3F8X A;  1W2B 2;  1DVD A;  4L7K A;  3EB8 A;  3G6E 3;  1JJ2 2;  1FGT A;  2B24 B;  3J7Y d;  1CQS A;  3PXM A;  3NBB A;  4L8O A;  4EV2 A;  1UI7 A;  3LTA A;  1Q40 A;  1RRH A;  2CFK A;  5KP3 A;  1EKM A;  3K7C A;  3AMO B;  4AKZ A;  1N9J A;  1SJW A;  3GZB A;  3U97 A;  1JV2 B;  1O7W B;  2KXG A;  4X2O A;  3DGL A;  5FW5 A;  4N6V 0;  4XM4 A;  3IJE B;  1ZX2 A;  1U8C B;  2PZV A;  3FF2 A;  2XFS A;  5JBS A;  3G0K A;  1JKG A;  5IW9 A;  1M9G A;  3WOD G;  1CEW I;  1VQ5 3;  4MMZ B;  1IT7 A;  1OGZ A;  2CFW A;  4JRF A;  8CHO A;  1ROV A;  2QIY A;  4R9L A;  1GD4 A;  3ROB A;  3NM2 A;  1W00 A;  3MHE A;  4HM7 B;  4H61 A;  5D83 A;  3JUN A;  4N6N B;  4IPB A;  3B8L A;  2W0Q A;  3OV4 A;  1D6U A;  2HMJ B;  3FCS B;  1YI2 3;  1LNH A;  2OOV C;  3NV0 B;  2D42 A;  4H3U A;  1LOX A;  3OW2 2;  2WOH A;  2XSH B;  2OQE C;  2CC3 A;  4WWU C;  2F98 A;  2IUK A;  2XGL A;  3SED A;  1TIJ A;  5I97 A;  1GS3 A;  1N5P A;  3EF8 A;  4K90 B;  1OHO A;  3PCS A;  4QWT A;  3JUQ A;  1W01 A;  1M1X B;  1UW1 A;  3CCE 3;  3IMA B;  2GBW B;  3GAX A;  1QVG 2;  1QAL A;  3BNC A;  3RDE A;  1VQM 3;  4HM4 B;  4GL6 A;  2YFI B;  4FMA A;  1YIJ 3;  1AV4 A;  1UI8 A;  1F8N A;  4X2H A;  1UUV B;  1S5A A;  1QAK A;  1Q81 4;  3EN1 B;  3SX1 A;  1O7N B;  1SIH A;  2IMJ A;  2B1X B;  3BNB A;  3GWR A;  1NB5 I;  3X40 A;  4WYK B;  4J9A A;  2M7O A;  1K9M 4;  3CCJ 3;  1IQX A;  4RNZ A;  2L4V A;  2OCT A;  3UB1 A;  1IVU A;  1GY7 A;  4I4K A;  3KKG A;  1RKY A;  2F99 A;  1L5G B;  3OWY A;  2K0M A;  4L8P A;  2HMN B;  4LGQ A;  3UNL A;  1S72 3;  2CG1 A;  1DMN A;  2MC8 A;  4ORL A;  3G16 A;  1FA3 A;  3LT9 A;  3JUO A;  3FLJ A;  2Z7A A;  3EHC A;  2CG0 A;  1QAF A;  3CNM A;  2BHM A;  5BXQ A;  3I56 3;  2HML B;  3T8U A;  1W6Y A;  1ASK A;  1KC8 4;  3X3Y A;  1M1K 4;  2A15 A;  4R4K A;  2BMR B;  2O3O A;  3K0Z A;  5AEU B;  2CWT A;  3TDG A;  2XGN A;  1YIT 3;  2D1W A;  1NB3 I;  3CCM 3;  1W7C A;  3DGO A;  2ZDJ A;  3WA2 X;  2MF7 A;  2WOF A;  2FGT A;  1CYV A;  1YJ9 3;  2Y74 A;  4KFF A;  3MG1 A;  3D9R A;  3X42 A;  1K28 A;  3F7X A;  3K9M C;  4R80 A;  3SOY A;  2CWV A;  2E2T A;  3OWU A;  4HJL B;  2F86 B;  1QVF 2;  1NO3 A;  4BTW A;  3FSD A;  2QGU A;  3Q90 A;  5D82 A;  3SOA A;  3UJM A;  2RCD A;  1W6C A;  4XBY A;  1V74 A;  1WQL B;  1OGX A;  3HI7 A;  5AIG A;  5DRV A;  2LYX A;  2W9Q A;  2OOV A;  2WO0 A;  1DMQ A;  1N9E A;  4IIA A;  1N5H A;  3VSY A;  3BNE A;  5AIH A;  2OWP A;  1KD1 4;  2BMQ B;  1IV9 A;  3K5T A;  3JVC A;  2BMO B;  1Z1S A;  3LXU X;  2FXT A;  1RN7 A;  2XF3 A;  1VQ8 3;  3I0Y A;  4HVN A;  1Q86 4;  2P09 A;  3NM7 A;  2V1L A;  2Z77 A;  1VQ7 3;  5CXO A;  3JUP A;  3LOY A;  4TX4 A;  1TU5 A;  1ISK A;  1LXE A;  3EE1 A;  1AVL A;  3F14 A;  1KWI A;  3G71 3;  1VQ4 3;  3MKI A;  1VQ9 3;  2WGO A;  4HM2 B;  4CDL A;  2I9W A;  5IF6 A;  2W9P A;  3CPO A;  3FGY A;  3OX9 A;  3NBR A;  1ULJ B;  5LC7 A;  2XSO B;  1JN5 A;  3OXA A;  3VGN A;  1NJI 4;  3MPH A;  1RJO A;  1IVX A;  5AYS C;  3ALA A;  4K1V A;  4MJD A;  2O9U X;  3BLZ A;  4MEI A;  3KSE D;  1A90 A;  1VQ6 3;  1JB5 A;  2W56 A;  1N8R 4;  1OF5 A;  1GYB A;  2FNQ A;  4LEH A;  5STD A;  5A0O B;  3NBJ A;  1ZO2 A;  3KII A;  4HM3 B;  3JUM A;  1E3R A;  3EBY A;  3O8Y A;  4BTX A;  2CFD A;  3MYT A;  2IUJ A;  3FKA A;  1VQN 3;  5CK6 A;  1IDP A;  2KCD A;  4HM6 B;  3FF0 A;  1DVC A;  2YFJ B;  3PCR A;  2XR8 B;  1MOL A;  1G96 A;  2CIU A;  3CCS 3;  5JPU A;  3DUK A;  3HZP A;  3PZW A;  1A2V A;  3K63 A;  3FZW A;  3LML A;  3GZX B;  1YJW 3;  4LMI A;  1FUW A;  2Z76 A;  4FMD A;  1VQP 3;  1OPY A;  1IVV A;  2HMM B;  2HMK B;  1UUW B;  1QMA A;  5AII A;  3S29 A;  3G4S 3;  6STD A;  1VQO 3;  1W6G A;  5IEO A;  3AMO A;  4KFD A;  4U13 A;  3CPW 2;  2XEP A;  3DY5 A;  1EG9 B;  3IPT A;  3RGR A;  4MMX B;  1VQK 3;  4KZ1 A;  4OUQ A;  4EXR A;  5G2G A;  1PU4 A;  4FMB A;  1SII A;  3QRD A;  1EQK A;  1DMM A;  4N6M A;  1Q40 B;  2YFL B;  1GY5 A;  5D81 A;  4HZB B;  3WOF B;  4Q53 A;  3DZL A;  2CWU A;  4CCV A;  3F40 A;  3QK9 A;  1OHS A;  4O3V A;  3PGB A;  3LTD A;  1WMO A;  1NDO B;  2GBX B;  2W03 A;  1NWW A;  3ER7 A;  3CCQ 3;  1Q42 A;  5BVB A;  3HK4 A;  1JKG B;  1IK3 A;  1JB2 A;  2P05 A;  3KSP A;  3PS8 A;  1Y4K A;  3MSO A;  1C7H A;  2OTL 3;  2OTJ 3;  3L0R A;  1LVN A;  1D6Z A;  1JNQ A;  3X3Z A;  4N6U A;  3NV0 A;  4XDV A;  3X3X A;  1M90 4;  2UX0 A;  1NU3 A;  1AR0 A;  4LSO A;  3E99 A;  3CCV 3;  3B7C A;  5EEO A;  1WTH A;  3DGM A;  4OK0 A;  3VF1 A;  1YHQ 3;  1TUH A;  1YGE A;  1Q82 4;  1TFK A;  5IG0 A;  1IT8 A;  1YJN 3;  1IQY A;  3LYG A;  2BT3 A;  1IU7 A;  1W5Z A;  3CMA 3;  2GXF A;  4LZI A;  1GY6 A;  3V92 A;  3F8H A;  2W2C A;  4RNY A;  3S28 A;  1O7G B;  1US1 A;  4HM8 B;  4K1U A;  3CCL 3;  3S27 A;  5IER A;  3F7S A;  3S5C A;  5AEW B;  2CFG A;  4FR9 A;  3KZT A;  3T0U A;  3WA3 A;  3SXX A;  4HKV B;  2PNC A;  1AVK A;  4HZ9 B;  3GZR A;  2OQE A;  1PFP A;  3M8C A;  3S67 A;  5CF2 A;  1WMN A;  4WYK A;  7STD A;  3D3L A;  3NQY A;  4XBT A;  3T8N A;  4KVH A;  4N3V A;  4HM1 B;  1MNL A;  4J8T A;  4HYZ A;  3BND A;  3B4O A;  3CC4 3;  2C11 A;  1R4C A;  3N54 B;  2P0X A;  4O02 B;  3NX0 A;  5IEN A;  1A2K A;  5ELU A;  3Q2P A;  3NXJ A;  2IA7 A;  5KP4 A;  5IG4 A;  2GEY A;  2P38 A;  1STD A;  1KSI A;  3GZY B;  2E2U A;  4EYC A;  2E2V A;  1YVB I;  2RSX A;  3EX9 A;  2GU3 A;  3HX8 A;  4K61 A;  2XRX B;  1WMP A;  2ML6 A;  2LQV A;  2CW9 A;  3WDG B;  3RGA A;  3HIG A;  4N6T A;  3U1W A;  3WMD A;  2JDI H;  3NQZ A;  4HM0 B;  3CD6 3;  4N6O B;  1ROA A;  3MWZ A;  1QJG A;  3MG3 A;  1Q7Y 4;  3LZA A;  4N6L A;  3GRD A;  5HGR A;  3Q1C A;  3LTB A;  1O7M B;  2STD A;  3STD A;  1FGM A;  1OHP A;  2ZL8 A;  4WP5 A;  4O2H A;  2XFT A;  2K54 A;  5LC6 A;  4O8S A;  2CH9 A;  3FG1 A;  3KN4 A;  1VZZ A;  3I55 3;  2BNG A;  5AI1 A;  1K73 4;  1HU9 A;  4IT7 A;  2BO9 B;  2JQ5 A;  4BTY A;  3KE7 A;  3CU3 A;  5KP1 A;  1WNH A;  4NRE A;  2CK3 H;  4WHA A;  1EA2 A;  5CF1 A;  3FG4 A;  3EN8 A;  2SBL A;  3EJV A;  1O7H B;  5EVH A;  3UL6 A;  1K41 A;  3SVA A;  1A67 A;  1N8Q A;  3EC9 A;  2WGQ A;  1T5Y A;  3WOE B;  1ULI B;  1E3V A;  3H3H A;  3CME 3;  2QA4 3;  2QEX 3;  3LH4 A;  4XB5 A;  1SQW A;  2HMO B;  1SPU A;  3H51 A;  2RGQ A;  1E97 A;  1FGR A;  4WFO A;  1OAC A;  2CFL A;  1IVW A;  4STD A;  4EBG A;  4RBN A;  3V98 A;  1J2B A;  1BUQ A;  2YX9 A;  1VQL 3;  5TGN A;  1OCV A;  3CC2 3;  2XH9 A;  2P0M A;  2Z6B A;  5AYR B;  3F9S A;  3NUV A;  4AEQ A;  4PEJ A;  3B4P A;  4FCJ A;  4HM5 B;  4HBR A;  2INX A;  1GD3 A;  3EBT A;  1DYU A;  1KQS 2;  3PYJ A;  3CC7 3;  4GB5 A;  1STF I;  4G1M B;  3KFQ C;  5AIF A;  3DGN A;  2R4I A;  3UL5 A;  4EC6 A;  2W04 A;  3N8B A;  1CYU A;  5ELJ A;  4R9K A;  5CLK A;  3CCU 3;  3EQQ B;  4NHF A;  3SLU A;  1OH0 A;  1K8A 4;  1FGQ A;  1IV7 A;  4FCM A;  4R1K A;  1IQ8 A;  5DRE A;  3ECF A;  3FH1 A;  3CCR 3;  1FGO A;  1OUN A;  3X41 A;  2GEX A;  4RZM A;  5IEP A;  1TFO A;  5FGO A;  1JN5 B;  2RFR A;  2GU1 A;  4EV5 A;  4MMY B;  3DXO A;  1W02 A;  4OVM A;  3HII A;  3A76 A;  1JB4 A;  3DM8 A;  2W6J H;  3CNX A;  2Q07 A;  4XBX A;  1HKX A;  2CKF B;  4FMC A;  4ZM8 A;  2ML5 A;  3FG3 A;  2W56 B;  1TP6 A;  1OF5 B;  1O7P B;  1U5O A;  1W2Z A;  1JRQ A;  2C10 A;  3LTC A;  4XDW A;  1D6Y A;  3DMC A;  2KRT A;  5IG5 A;  3LT8 A;  1RRL A;  1W4N A;  5IG3 A;  3MG2 A;  2CHC A;  3BB9 A;  3G8Z A;  5EQL A;  3NHX A;  3CXC 2;  4KFE A;  3V99 A;  3OWS A;  4AKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...