3I553

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 6
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3i55300
3CCU3 2QEX3 3CD63 3CC43 1YHQ3 1VQ53 1JJ22 3CMA3 3CPW2 1VQK3 1QVF2 3CC73 1W2B2 1KQS2 1K8A4 3CCS3 1VQO3 1VQP3 1YJW3 1N8R4 1K734 1Q864 1VQ93 3I553 3OW22 2OTL3 1K9M4 3CCL3 1Q7Y4 3G713 1VQ73 1QVG2 3CCJ3 2QA43 3CCM3 1YIJ3 1S723 1VQ43 1YJ93 3I563 1KD14 1M1K4 1VQN3 2OTJ3 1Q814 1YI23 1Q824 1KC84 1NJI4 3CXC2 3CCV3 1YIT3 3G4S3 1VQM3 3CCR3 1VQ83 1VQL3 3CC23 1VQ63 1YJN3 3G6E3 3CCE3 3CCQ3 3CME3 1M904
chains in the Genus database with same CATH superfamily
5EEOA 3A76A 2MC8A 1BSBA 1TP6A 1I70A 2W9PA 2W04A 1J2BA 1I3FA 4L8OA 1RN7A 3KSPA 5CK6A 5IEPA 1W00A 4RNTA 4L7KA 1LOWA 1GMRA 1W5ZA 1MGWA 2WOFA 2CWUA 3EHCA 3DH2A 1EEJA 1N5PA 3GSPA 3LZAA 3T8NA 4BL2A 4DKIA 5KP4A 1JBSA 3BNEA 7STDA 2QGUA 1Q9EA 5AEWB 1WMPA 1FYSA 1LVNA 1Q814 1KC84 1OH0A 4AEQA 4X2HA 2XR8B 1KSIA 4HM5B 3V92A 4J5GA 4HM7B 2GEXA 2Z76A 4BTYA 7GSPA 3EQQB 2W03A 1PY3A 3DGNA 2F5MA 3F40A 3NM7A 5KP1A 2QEX3 2W56A 3G0KA 2F4YA 4MJDA 2CIUA 1RGAA 4MMZB 1YHQ3 4XBTA 1IDPA 1MOLA 1RTUA 2FNQA 2R41A 2XFSA 1JB2A 3NBRA 4WFOA 1DYUA 1A2PA 1K734 2CFGA 2BO9B 1BSAA 3ZG5A 2CX0A 3LMLA 1X1YA 1JKGB 4HJLB 1YIJ3 4L8PA 3K7CA 1BRSA 4KT3B 1A90A 2RGQA 1RN4A 5RNTA 3SLUA 3UL5A 2E2UA 2O9UX 1D6ZA 2XH9A 3DXOA 4MEIA 4HM2B 5BU4A 1GY5A 5IF6A 1VQM3 3HIGA 1BVIA 1RDSA 1JBRA 4JF8A 3CCQ3 1KWIA 3L0RA 4KVHA 5AIGA 1BRKA 2O3OA 1A2VA 3JUMA 1JKGA 1TFOA 3ER7A 2WGOA 3M8CA 3HOHA 3LTAA 3T0UA 1OF5B 2H0HA 1FUTA 1O7PB 1RGHA 3S27A 1NNVA 4K61A 3X3YA 1LNHA 2Z7AA 6GSPA 3KIIA 2F86B 3WDGB 4OVMA 3K0ZA 1W6CA 1JRQA 1B2ZA 1DETA 3G16A 1M1XB 1Q824 4U13A 2BMOB 2CFLA 2HMNB 3IJEB 1RN1A 1K28A 2W6JH 2Z77A 1I2FA 3PS8A 4BTXA 1OF5A 4EV5A 9RNTA 1LNIA 3CCU3 3CC43 3FF0A 3FLJA 2OWPA 5AYSC 1U5OA 3CPW2 1TRPA 3EX9A 3FG3A 3IMAB 3LH4A 1MWSA 2HOHA 3FG4A 1ZS7A 3N9HA 4FCJA 1VQO3 1N8R4 1E3RA 2CC3A 2ZDJA 5BIRA 3SXXA 2JQ5A 3CNXA 4LEHA 1QAFA 1VQ43 4OK0A 2KXGA 3FF2A 4N6NB 4QWTA 1JN5B 5IERA 1BIRA 3GWRA 1ZX2A 1RGLA 4HVNA 1GY7A 4WYKB 3DGLA 1W01A 2R4IA 2YFLB 3D4AA 1FGOA 1IV9A 1GMPA 4FMBA 3OXAA 4H61A 4PEJA 5G1KA 1UI8A 3N54B 1TFKA 3KKGA 1OHPA 3Q1CA 1BNRA 1RNBA 1IVUA 4LZIA 5GSPA 3V98A 3AGOA 2GXFA 1VQK3 2IMJA 2IY2A 5JPUA 1X1XA 5JBSA 1QMAA 1BRGA 1Q40B 3NQZA 4WYKA 3HZPA 3N8BA 3X3ZA 4MMXB 4J5KA 1GOUA 5FGOA 2CG1A 1WNHA 4EXRA 4KFEA 3HK4A 3MSOA 1B2UA 3S67A 1SJWA 4BIRA 1V74A 2UGIA 3AHWA 3HX8A 3Q3FA 1LRAA 3BB9A 4R9KA 1T2IA 4GL6A 3MG1A 4R80A 3VSYA 1VQ83 2GEYA 2K3DA 1CH0A 1CYUA 2HMJB 2OQEC 3DM8A 4STDA 2KCDA 1Q40A 2CWVA 1O7MB 2F98A 5KP3A 2BIRA 2V1LA 3NUVA 7RNTA 1RLSA 2RSXA 5G2GA 3FH1A 2F99A 4IT7A 3O8YA 5HOHA 3CC73 2ZL8A 3F8HA 4HZBB 3WR2A 4XBYA 2CH9A 3F9SA 3KCHA 1TUHA 1I3IA 3I553 3K63A 1W6YA 1MWUA 3KE7A 1AQZA 4JRFA 1CEWI 1YJ93 2CK3H 2UUGC 1BSCA 4O8SA 1IVXA 1HKXA 1BUJA 1UI7A 3JVCA 2PZVA 1ZGXA 1MGRA 2HMLB 3HI7A 2KF6A 1STFI 2H0GA 2OCTA 3PYJA 1EG9B 4HZ9B 1FGQA 3EF8A 3SOYA 1EUIC 4ORLA 3SEDA 4HKVB 1QALA 3WOFB 3KSED 1I0XA 1LOVA 3F7SA 1UCJA 3FCSB 5AIIA 4KFDA 3WOEB 1YGEA 4HM8B 4CDLA 1RNTA 2C11A 1W2B2 1UUWB 3CCS3 2LQVA 5DREA 2ML6A 3FKAA 1QJGA 3MYTA 3RDEA 4FMDA 1WTHA 1OPYA 2STDA 3ROBA 2OTJ3 3T8UA 1LQMB 1SIHA 2CHCA 6STDA 5LC6A 2KF4A 3TDGA 2XSOB 3G4S3 1W02A 3DGOA 2D1WA 3J7Yd 1TU5A 4J9AA 1IVVA 1LOYA 2CFDA 4N6MA 4XB5A 3V99A 1I8VA 1CYVA 1N5HA 3I0YA 1B21A 1O7GB 5AIHA 2RBIA 5M1AA 4CCVA 1A67A 1BANA 4GSPA 4OUQA 1RGKA 4HM6B 3FZWA 1YVBI 3LYGA 2J8XB 4AKYA 1BNEA 1GOYA 1FA3A 4KZ1A 3AMOB 2XEPA 3FG1A 2INXA 3GZBA 3NHXA 3U1WA 3BLZA 2E2VA 1MWRA 1KQS2 2KAAA 3B7CA 5CF1A 1ISKA 2HMMB 1WMNA 1BU4A 4K1UA 2XGNA 3D5IA 1DMNA 4R9LA 2W0QA 1IU7A 1GYBA 1RGEA 1SIIA 3DY5A 1IT8A 1TJDA 3JUNA 1GD4A 3LXUX 1W2ZA 2AADA 4I4KA 4WHAA 1UGIA 2XGLA 5IENA 1S5AA 2WGQA 2CX1A 4XM4A 5FW5A 1RMSA 3MKIA 3NX0A 1JV2B 2Y73A 3AMOA 4EW5A 5IG3A 2WO0A 4RZMA 2BNGA 1Z1SA 2CKFB 2GU3A 5A0OB 3OV4A 1EKMA 2YX9A 2L1SA 1HZ1A 3D9RA 3F14A 4MMYB 4XBXA 3KFQC 3X42A 1UCIA 4O2HA 1US1A 3DUKA 1TRQA 3NBJA 1UW1A 1V58A 5EVHA 5M19A 3CPOA 4LYLB 4WP5A 3JUOA 2CW9A 3MWZA 1HYFA 2ZA4A 5ELUA 1GMQA 1YVSA 4ZM8A 5IG4A 5AEUB 1RCLA 1EQKA 1B3SA 2IUKA 1KD14 1BRIA 4RNZA 2P0XA 4HOHA 1GOVA 3URPA 3EB8A 3CXC2 3NXJA 3SVAA 4N3VA 3WA2X 1STDA 1IQYA 2BT3A 1BOXA 3EN8A 1VQ63 2IUJA 1T3BA 3CCE3 1M9GA 4FR9A 2AAEA 4CPKA 3UJMA 1JZOA 1NU3A 1FW7A 3FGYA 2KF5A 1OGXA 1RSNA 1HU9A 1WQLB 5CLKA 2ZHXB 5CXOA 1O7NB 2BMRB 2OQEA 1D6UA 3STDA 1RKYA 1NB5I 2WOHA 1E97A 1MNLA 1IQXA 1RHLA 5AI1A 2IYJA 1LOXA 5D82A 1C7HA 2CFKA 4RNYA 1JN5A 1D6YA 4LMIA 5JPPA 1LXEA 1RGFA 2OTL3 3OW22 1G96A 2P09A 1Q7HA 1MWTA 3CNMA 5EQLA 5IEOA 1K9M4 2KF3A 4BTWA 1M1K4 1BRNL 1OHSA 4AKZA 3SOAA 2C4BA 1YGWA 1PU4A 2XSHB 3BNDA 1W7CA 3D79A 3K9MC 3SYUA 2W9QA 3CU3A 3EE1A 3U97A 3CME3 3WMDA 1L5GB 2BU4A 2UX0A 1R4CA 2Y74A 3A5EA 5IG5A 3CD63 1BUQA 4NHFA 3QRDA 2YFJB 1Y4KA 2CG0A 1NDOB 3Q90A 2GSPA 3FSDA 1VQQA 1W4NA 1Q864 3EN1B 3AHSA 1JBTA 3QK9A 2QA43 2P0MA 4CJNA 1B2MA 2PNCA 3PCRA 4IPBA 1UUVB 1PFPA 3RGRA 6RNTA 2RFRA 3SX1A 1AV4A 2Z6BA 3K5TA 3GZYB 2K54A 4EYCA 1OCVA 3OWUA 2P05A 2YFIB 5DRVA 1OUNA 1W6GA 3OWYA 5IG0A 2MF7A 1BNIA 2GBXB 4IIAA 1X1UA 2XFTA 3AGNA 4NPBA 5TGNA 1SQWA 1FGRA 2GU1A 2W56B 2XRXB 1GSPA 3IPTA 2OOVC 5CF2A 3S28A 3ECFA 4O3VA 3EC9A 3PZWA 3G713 2BMQB 1B27A 3MHEA 1RGGA 1UGHI 3CCM3 1O7HB 3I563 4N6OB 4XDVA 2K0MA 3BNCA 5STDA 2CFWA 3WA3A 1GD3A 1YIT3 1OACA 3CCR3 4HM3B 5BVBA 2HMOB 1ROAA 4H3UA 1T2HA 1TIJA 2E2TA 2W2CA 3MG3A 1M904 1AR0A 3X40A 1T5YA 2HMKB 2XF3A 3DMCA 3NV0B 1WMOA 4HM0B 1JB4A 2D42A 3NQYA 3LT8A 4FCZA 4FMAA 1VQ53 1UCLA 3GAXA 2LYXA 3LTBA 3CMA3 1NO3A 5LC7A 2SBLA 3ALAA 1VQ93 3F7XA 1AVLA 4N6V0 3B4OA 3X3XA 3CCL3 1DE3A 1IQ8A 1VQ73 1G02A 1FZUA 3EJVA 3B8LA 1JNQA 1DVDA 1FGTA 3S29A 3BU4A 3DZLA 1ULIB 2B24B 1ROVA 3NV0A 3OWSA 1YI23 1RCKA 3PXMA 1ZO2A 2BHMA 4RBNA 8CHOA 5AYRB 1BAOA 2GBWB 3F8XA 4HYZA 1V57A 4Q53A 4J8TA 2RCDA 3PGBA 5AIFA 1QAKA 3GZXB 1JZDA 1O7WB 1I2GA 4HBRA 1RGCA 1YNVX 3VF1A 3H3HA 4K1VA 1SPUA 3EBYA 2JDIH 1B2SA 1TTOA 1N8QA 1NWWA 4N6TA 1N9JA 3ZG0A 1U8CB 2QIYA 1UDII 3PCSA 5ELJA 3DGYA 3VGNA 4HAAA 1Q7Y4 4HM4B 8RNTA 3LT9A 3RNTA 4BU4A 1SARA 1FUWA 1I0VA 1BSDA 3UL6A 1BSEA 1BRJA 1IYYA 1RRHA 1AVKA 2KRTA 1A2KA 1RRLA 3BNBA 4LGQA 4TX4A 1LQGC 3G6E3 4NREA 1N9EA 2SARA 3LTCA 4N6LA 4XDWA 4GHOA 1IVWA 5I97A 4FCMA 3Q2PA 1BGSA 1GY6A 2FXTA 1IT7A 1DMMA 4R1KA 2Q07A 3RGAA 4EBGA 4X2OA 5D81A 3X41A 1Q42A 1BNGA 1PYLA 3HIIA 2L4VA 1UUGB 4LSOA 1UCKA 1K8A4 3NM2A 4O02B 1B2XA 3LOYA 1YJW3 1RJOA 1I2EA 3MPHA 5G1LA 3LTDA 1GS3A 1S723 1R4YA 1G0TA 3MG2A 1VZZA 2F5WA 4EV2A 4FMCA 4R4KA 3BIRA 1NJI4 3WHOA 3OX9A 1F8NA 3EBTA 2H0IA 3UNLA 3KN4A 1DVCA 1YJN3 1E3VA 1BNSA 1B20A 3D3LA 3DGMA 1EA2A 1NB3I 1OHOA 1BRHA 1ULJB 3S5CA 5M18A 3E99A 1ASKA 1X1WA 1JJ22 2I9WA 3H51A 1DMQA 3KZTA 5BXQA 1JB5A 1QVF2 4WWUC 1IV7A 1BNJA 3NBBA 3D5GA 1VQP3 3ZFZA 3G8ZA 4KFFA 2M7OA 1FUSA 1BNFA 2ML5A 3B4PA 3JUQA 4ILFA 5D83A 2C10A 2OOVA 1QVG2 5HGRA 3CCJ3 4I5QA 2A15A 5IW9A 4HM1B 1C54A 1VQN3 1IK3A 3UB1A 1OGZA 2B1XB 1FGMA 3WODG 3CCV3 2CWTA 2RNTA 4N6UA 4G1MB 2IA7A 4EC6A 1VQL3 2F56A 3CC23 2FGTA 4GB5A 2P38A 4BL3A 1AY7A 4K90B 3JUPA 3GRDA 3GZRA 1CQSA 1K41A
chains in the Genus database with same CATH topology
5EEOA 3A76A 2MC8A 1TP6A 2W9PA 2W04A 1J2BA 4L8OA 1RN7A 3KSPA 5CK6A 5IEPA 1W00A 4L7KA 1W5ZA 2WOFA 2CWUA 3EHCA 5KP4A 1N5PA 3T8NA 3LZAA 3BNEA 7STDA 2QGUA 5AEWB 1WMPA 1LVNA 1Q814 1KC84 1OH0A 4AEQA 4X2HA 2XR8B 1KSIA 4HM5B 3V92A 4HM7B 2GEXA 2Z76A 4BTYA 3EQQB 2W03A 3DGNA 3F40A 3NM7A 5KP1A 2QEX3 2W56A 3G0KA 4MJDA 2CIUA 4MMZB 1YHQ3 4XBTA 1IDPA 1MOLA 2FNQA 2XFSA 1JB2A 3NBRA 4WFOA 1DYUA 1K734 2CFGA 2BO9B 3LMLA 4HJLB 1JKGB 1YIJ3 4L8PA 3K7CA 1A90A 2RGQA 3SLUA 3UL5A 2E2UA 2O9UX 1D6ZA 2XH9A 3DXOA 4MEIA 4HM2B 1GY5A 5IF6A 1VQM3 3HIGA 4JF8A 3CCQ3 1KWIA 3L0RA 4KVHA 5AIGA 2O3OA 1A2VA 3JUMA 1JKGA 1TFOA 3ER7A 2WGOA 3M8CA 3LTAA 3T0UA 1OF5B 1O7PB 3S27A 4K61A 3X3YA 1LNHA 2Z7AA 3KIIA 2F86B 3WDGB 4OVMA 3K0ZA 1W6CA 1JRQA 3G16A 1M1XB 1Q824 4U13A 2BMOB 2CFLA 2HMNB 3IJEB 1K28A 2W6JH 2Z77A 3PS8A 4BTXA 1OF5A 4EV5A 3CCU3 3CC43 3FF0A 3FLJA 2OWPA 5AYSC 1U5OA 3CPW2 3EX9A 3FG3A 3IMAB 3LH4A 3FG4A 3N9HA 4FCJA 1VQO3 1N8R4 1E3RA 2CC3A 2ZDJA 3SXXA 2JQ5A 3CNXA 4LEHA 1QAFA 1VQ43 4OK0A 2KXGA 3FF2A 4N6NB 4QWTA 1JN5B 5IERA 3GWRA 1ZX2A 4HVNA 1GY7A 4WYKB 3DGLA 2R4IA 2YFLB 1W01A 1FGOA 1IV9A 4FMBA 4H61A 3OXAA 4PEJA 1UI8A 3N54B 1TFKA 3KKGA 1OHPA 3Q1CA 1IVUA 4LZIA 3V98A 2GXFA 1VQK3 2IMJA 5JPUA 5JBSA 1QMAA 1Q40B 3NQZA 4WYKA 3HZPA 3N8BA 3X3ZA 4MMXB 5FGOA 2CG1A 1WNHA 4EXRA 4KFEA 3HK4A 3MSOA 3S67A 1SJWA 1V74A 3HX8A 3BB9A 4R9KA 4GL6A 3MG1A 4R80A 3VSYA 1VQ83 2GEYA 1CYUA 2HMJB 2OQEC 3DM8A 4STDA 2KCDA 1Q40A 2CWVA 1O7MB 2F98A 5KP3A 2V1LA 3NUVA 2RSXA 5G2GA 3FH1A 2F99A 4IT7A 3O8YA 3CC73 2ZL8A 3F8HA 4HZBB 4XBYA 2CH9A 3F9SA 1TUHA 3I553 3K63A 1W6YA 3KE7A 4JRFA 1CEWI 1YJ93 2CK3H 4O8SA 1IVXA 1HKXA 1UI7A 3JVCA 2PZVA 3HI7A 2HMLB 3PYJA 1STFI 2OCTA 1EG9B 4HZ9B 1FGQA 3EF8A 3SOYA 4ORLA 3SEDA 4HKVB 1QALA 3WOFB 3KSED 3F7SA 3FCSB 5AIIA 4KFDA 3WOEB 1YGEA 4HM8B 4CDLA 2C11A 1W2B2 1UUWB 3CCS3 2LQVA 5DREA 2ML6A 3FKAA 1QJGA 3MYTA 3RDEA 4FMDA 1WTHA 1OPYA 2STDA 3ROBA 2OTJ3 3T8UA 1SIHA 2CHCA 6STDA 5LC6A 3TDGA 2XSOB 3G4S3 1W02A 3DGOA 2D1WA 3J7Yd 1TU5A 4J9AA 1IVVA 2CFDA 4N6MA 4XB5A 3V99A 1CYVA 1N5HA 3I0YA 1O7GB 5AIHA 1A67A 4CCVA 4OUQA 4HM6B 3FZWA 1YVBI 3LYGA 4AKYA 1FA3A 4KZ1A 3AMOB 2XEPA 3FG1A 2INXA 3GZBA 3NHXA 3U1WA 3BLZA 2E2VA 1KQS2 3B7CA 5CF1A 1ISKA 2HMMB 1WMNA 4K1UA 2XGNA 4R9LA 1DMNA 2W0QA 1IU7A 1GYBA 1SIIA 3DY5A 1IT8A 3JUNA 1GD4A 3LXUX 1W2ZA 4I4KA 4WHAA 2XGLA 5IENA 1S5AA 2WGQA 5FW5A 4XM4A 3NX0A 3MKIA 1JV2B 2Y73A 3AMOA 5IG3A 2WO0A 4RZMA 2BNGA 1Z1SA 2CKFB 2GU3A 5A0OB 3OV4A 1EKMA 2YX9A 3D9RA 3F14A 4MMYB 4XBXA 3KFQC 3X42A 4O2HA 1US1A 3DUKA 3NBJA 5EVHA 1UW1A 3CPOA 4WP5A 3JUOA 2CW9A 3MWZA 5ELUA 4ZM8A 5IG4A 5AEUB 1EQKA 2IUKA 1KD14 4RNZA 2P0XA 3EB8A 3CXC2 3NXJA 3SVAA 4N3VA 3WA2X 1STDA 1IQYA 2BT3A 3EN8A 1VQ63 2IUJA 3CCE3 1M9GA 4FR9A 3UJMA 1NU3A 3FGYA 1OGXA 1WQLB 1HU9A 5CXOA 5CLKA 2OQEA 1O7NB 2BMRB 1D6UA 3STDA 1RKYA 1NB5I 2WOHA 1E97A 1MNLA 1IQXA 5AI1A 1LOXA 5D82A 1C7HA 2CFKA 4RNYA 1JN5A 1D6YA 4LMIA 5JPPA 1LXEA 2OTL3 3OW22 1G96A 2P09A 5IEOA 3CNMA 5EQLA 1K9M4 4BTWA 1M1K4 1OHSA 4AKZA 3SOAA 1PU4A 2XSHB 3BNDA 1W7CA 3K9MC 2W9QA 3CU3A 3EE1A 3U97A 3CME3 3WMDA 1L5GB 2UX0A 1R4CA 2Y74A 5IG5A 3CD63 1BUQA 4NHFA 3QRDA 2YFJB 1Y4KA 2CG0A 1NDOB 3Q90A 3FSDA 1W4NA 1Q864 3EN1B 3QK9A 2QA43 2P0MA 2PNCA 3PCRA 4IPBA 1UUVB 1PFPA 3RGRA 2RFRA 3SX1A 1AV4A 2Z6BA 3K5TA 3GZYB 2K54A 4EYCA 1OCVA 3OWUA 2P05A 2YFIB 5DRVA 1OUNA 1W6GA 3OWYA 5IG0A 2MF7A 2GBXB 4IIAA 2XFTA 5TGNA 1SQWA 1FGRA 2GU1A 2W56B 2XRXB 3IPTA 2OOVC 5CF2A 3S28A 3ECFA 4O3VA 3EC9A 3PZWA 3G713 2BMQB 3MHEA 3CCM3 1O7HB 3I563 4N6OB 4XDVA 2K0MA 3BNCA 5STDA 2CFWA 3WA3A 1GD3A 1YIT3 1OACA 3CCR3 4HM3B 5BVBA 2HMOB 1ROAA 4H3UA 1TIJA 2E2TA 2W2CA 3MG3A 1M904 1AR0A 3X40A 1T5YA 2HMKB 2XF3A 3DMCA 3NV0B 1WMOA 4HM0B 1JB4A 2D42A 3NQYA 3LT8A 4FCZA 4FMAA 1VQ53 3LTBA 3GAXA 2LYXA 3CMA3 1NO3A 5LC7A 2SBLA 3ALAA 1VQ93 3F7XA 1AVLA 4N6V0 3B4OA 3X3XA 3CCL3 1IQ8A 1VQ73 3EJVA 3B8LA 1JNQA 1DVDA 1FGTA 3S29A 3DZLA 1ULIB 2B24B 1ROVA 3NV0A 3OWSA 1YI23 3PXMA 1ZO2A 2BHMA 4RBNA 8CHOA 5AYRB 2GBWB 3F8XA 4HYZA 4Q53A 4J8TA 2RCDA 3PGBA 5AIFA 1QAKA 3GZXB 1O7WB 4HBRA 3VF1A 3H3HA 4K1VA 1SPUA 3EBYA 2JDIH 1N8QA 1NWWA 4N6TA 1N9JA 1U8CB 2QIYA 3PCSA 5ELJA 3VGNA 1Q7Y4 4HM4B 3LT9A 1FUWA 3UL6A 1RRHA 1AVKA 2KRTA 1A2KA 1RRLA 3BNBA 4LGQA 4TX4A 3G6E3 4NREA 1N9EA 3LTCA 4N6LA 4XDWA 1IVWA 5I97A 4FCMA 3Q2PA 1GY6A 2FXTA 3RGAA 1IT7A 1DMMA 4R1KA 2Q07A 4EBGA 4X2OA 5D81A 3X41A 1Q42A 3HIIA 2L4VA 4LSOA 1K8A4 3NM2A 4O02B 3LOYA 1YJW3 1RJOA 3MPHA 3LTDA 1GS3A 1S723 3MG2A 1VZZA 4EV2A 4FMCA 4R4KA 1NJI4 3OX9A 1F8NA 3EBTA 3UNLA 3KN4A 1DVCA 1YJN3 1E3VA 3D3LA 3DGMA 1EA2A 1NB3I 1OHOA 1ULJB 3S5CA 3E99A 1ASKA 1JJ22 2I9WA 3H51A 1DMQA 3KZTA 5BXQA 1JB5A 1QVF2 4WWUC 1IV7A 3NBBA 1VQP3 3G8ZA 4KFFA 2M7OA 2ML5A 3B4PA 3JUQA 2OOVA 5D83A 2C10A 1QVG2 5HGRA 3CCJ3 2A15A 5IW9A 4HM1B 1VQN3 1IK3A 3UB1A 1OGZA 2B1XB 1FGMA 3WODG 3CCV3 2CWTA 4N6UA 4G1MB 2IA7A 4EC6A 1VQL3 3CC23 2FGTA 4GB5A 2P38A 4K90B 3JUPA 3GRDA 3GZRA 1CQSA 1K41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU 3;  2QEX 3;  3CD6 3;  3CC4 3;  1YHQ 3;  1VQ5 3;  1JJ2 2;  3CMA 3;  3CPW 2;  1VQK 3;  1QVF 2;  3CC7 3;  1W2B 2;  1KQS 2;  1K8A 4;  3CCS 3;  1VQO 3;  1VQP 3;  1YJW 3;  1N8R 4;  1K73 4;  1Q86 4;  1VQ9 3;  3I55 3;  3OW2 2;  2OTL 3;  1K9M 4;  3CCL 3;  1Q7Y 4;  3G71 3;  1VQ7 3;  1QVG 2;  3CCJ 3;  2QA4 3;  3CCM 3;  1YIJ 3;  1S72 3;  1VQ4 3;  1YJ9 3;  3I56 3;  1KD1 4;  1M1K 4;  1VQN 3;  2OTJ 3;  1Q81 4;  1YI2 3;  1Q82 4;  1KC8 4;  1NJI 4;  3CXC 2;  3CCV 3;  1YIT 3;  3G4S 3;  1VQM 3;  3CCR 3;  1VQ8 3;  1VQL 3;  3CC2 3;  1VQ6 3;  1YJN 3;  3G6E 3;  3CCE 3;  3CCQ 3;  3CME 3;  1M90 4; 
#chains in the Genus database with same CATH topology
 5EEO A;  3A76 A;  2MC8 A;  1BSB A;  1TP6 A;  1I70 A;  2W9P A;  2W04 A;  1J2B A;  1I3F A;  4L8O A;  1RN7 A;  3KSP A;  5CK6 A;  5IEP A;  1W00 A;  4RNT A;  4L7K A;  1LOW A;  1GMR A;  1W5Z A;  1MGW A;  2WOF A;  2CWU A;  3EHC A;  3DH2 A;  1EEJ A;  1N5P A;  3GSP A;  3LZA A;  3T8N A;  4BL2 A;  4DKI A;  5KP4 A;  1JBS A;  3BNE A;  7STD A;  2QGU A;  1Q9E A;  5AEW B;  1WMP A;  1FYS A;  1LVN A;  1Q81 4;  1KC8 4;  1OH0 A;  4AEQ A;  4X2H A;  2XR8 B;  1KSI A;  4HM5 B;  3V92 A;  4J5G A;  4HM7 B;  2GEX A;  2Z76 A;  4BTY A;  7GSP A;  3EQQ B;  2W03 A;  1PY3 A;  3DGN A;  2F5M A;  3F40 A;  3NM7 A;  5KP1 A;  2QEX 3;  2W56 A;  3G0K A;  2F4Y A;  4MJD A;  2CIU A;  1RGA A;  4MMZ B;  1YHQ 3;  4XBT A;  1IDP A;  1MOL A;  1RTU A;  2FNQ A;  2R41 A;  2XFS A;  1JB2 A;  3NBR A;  4WFO A;  1DYU A;  1A2P A;  1K73 4;  2CFG A;  2BO9 B;  1BSA A;  3ZG5 A;  2CX0 A;  3LML A;  1X1Y A;  1JKG B;  4HJL B;  1YIJ 3;  4L8P A;  3K7C A;  1BRS A;  4KT3 B;  1A90 A;  2RGQ A;  1RN4 A;  5RNT A;  3SLU A;  3UL5 A;  2E2U A;  2O9U X;  1D6Z A;  2XH9 A;  3DXO A;  4MEI A;  4HM2 B;  5BU4 A;  1GY5 A;  5IF6 A;  1VQM 3;  3HIG A;  1BVI A;  1RDS A;  1JBR A;  4JF8 A;  3CCQ 3;  1KWI A;  3L0R A;  4KVH A;  5AIG A;  1BRK A;  2O3O A;  1A2V A;  3JUM A;  1JKG A;  1TFO A;  3ER7 A;  2WGO A;  3M8C A;  3HOH A;  3LTA A;  3T0U A;  1OF5 B;  2H0H A;  1FUT A;  1O7P B;  1RGH A;  3S27 A;  1NNV A;  4K61 A;  3X3Y A;  1LNH A;  2Z7A A;  6GSP A;  3KII A;  2F86 B;  3WDG B;  4OVM A;  3K0Z A;  1W6C A;  1JRQ A;  1B2Z A;  1DET A;  3G16 A;  1M1X B;  1Q82 4;  4U13 A;  2BMO B;  2CFL A;  2HMN B;  3IJE B;  1RN1 A;  1K28 A;  2W6J H;  2Z77 A;  1I2F A;  3PS8 A;  4BTX A;  1OF5 A;  4EV5 A;  9RNT A;  1LNI A;  3CCU 3;  3CC4 3;  3FF0 A;  3FLJ A;  2OWP A;  5AYS C;  1U5O A;  3CPW 2;  1TRP A;  3EX9 A;  3FG3 A;  3IMA B;  3LH4 A;  1MWS A;  2HOH A;  3FG4 A;  1ZS7 A;  3N9H A;  4FCJ A;  1VQO 3;  1N8R 4;  1E3R A;  2CC3 A;  2ZDJ A;  5BIR A;  3SXX A;  2JQ5 A;  3CNX A;  4LEH A;  1QAF A;  1VQ4 3;  4OK0 A;  2KXG A;  3FF2 A;  4N6N B;  4QWT A;  1JN5 B;  5IER A;  1BIR A;  3GWR A;  1ZX2 A;  1RGL A;  4HVN A;  1GY7 A;  4WYK B;  3DGL A;  1W01 A;  2R4I A;  2YFL B;  3D4A A;  1FGO A;  1IV9 A;  1GMP A;  4FMB A;  3OXA A;  4H61 A;  4PEJ A;  5G1K A;  1UI8 A;  3N54 B;  1TFK A;  3KKG A;  1OHP A;  3Q1C A;  1BNR A;  1RNB A;  1IVU A;  4LZI A;  5GSP A;  3V98 A;  3AGO A;  2GXF A;  1VQK 3;  2IMJ A;  2IY2 A;  5JPU A;  1X1X A;  5JBS A;  1QMA A;  1BRG A;  1Q40 B;  3NQZ A;  4WYK A;  3HZP A;  3N8B A;  3X3Z A;  4MMX B;  4J5K A;  1GOU A;  5FGO A;  2CG1 A;  1WNH A;  4EXR A;  4KFE A;  3HK4 A;  3MSO A;  1B2U A;  3S67 A;  1SJW A;  4BIR A;  1V74 A;  2UGI A;  3AHW A;  3HX8 A;  3Q3F A;  1LRA A;  3BB9 A;  4R9K A;  1T2I A;  4GL6 A;  3MG1 A;  4R80 A;  3VSY A;  1VQ8 3;  2GEY A;  2K3D A;  1CH0 A;  1CYU A;  2HMJ B;  2OQE C;  3DM8 A;  4STD A;  2KCD A;  1Q40 A;  2CWV A;  1O7M B;  2F98 A;  5KP3 A;  2BIR A;  2V1L A;  3NUV A;  7RNT A;  1RLS A;  2RSX A;  5G2G A;  3FH1 A;  2F99 A;  4IT7 A;  3O8Y A;  5HOH A;  3CC7 3;  2ZL8 A;  3F8H A;  4HZB B;  3WR2 A;  4XBY A;  2CH9 A;  3F9S A;  3KCH A;  1TUH A;  1I3I A;  3I55 3;  3K63 A;  1W6Y A;  1MWU A;  3KE7 A;  1AQZ A;  4JRF A;  1CEW I;  1YJ9 3;  2CK3 H;  2UUG C;  1BSC A;  4O8S A;  1IVX A;  1HKX A;  1BUJ A;  1UI7 A;  3JVC A;  2PZV A;  1ZGX A;  1MGR A;  2HML B;  3HI7 A;  2KF6 A;  1STF I;  2H0G A;  2OCT A;  3PYJ A;  1EG9 B;  4HZ9 B;  1FGQ A;  3EF8 A;  3SOY A;  1EUI C;  4ORL A;  3SED A;  4HKV B;  1QAL A;  3WOF B;  3KSE D;  1I0X A;  1LOV A;  3F7S A;  1UCJ A;  3FCS B;  5AII A;  4KFD A;  3WOE B;  1YGE A;  4HM8 B;  4CDL A;  1RNT A;  2C11 A;  1W2B 2;  1UUW B;  3CCS 3;  2LQV A;  5DRE A;  2ML6 A;  3FKA A;  1QJG A;  3MYT A;  3RDE A;  4FMD A;  1WTH A;  1OPY A;  2STD A;  3ROB A;  2OTJ 3;  3T8U A;  1LQM B;  1SIH A;  2CHC A;  6STD A;  5LC6 A;  2KF4 A;  3TDG A;  2XSO B;  3G4S 3;  1W02 A;  3DGO A;  2D1W A;  3J7Y d;  1TU5 A;  4J9A A;  1IVV A;  1LOY A;  2CFD A;  4N6M A;  4XB5 A;  3V99 A;  1I8V A;  1CYV A;  1N5H A;  3I0Y A;  1B21 A;  1O7G B;  5AIH A;  2RBI A;  5M1A A;  4CCV A;  1A67 A;  1BAN A;  4GSP A;  4OUQ A;  1RGK A;  4HM6 B;  3FZW A;  1YVB I;  3LYG A;  2J8X B;  4AKY A;  1BNE A;  1GOY A;  1FA3 A;  4KZ1 A;  3AMO B;  2XEP A;  3FG1 A;  2INX A;  3GZB A;  3NHX A;  3U1W A;  3BLZ A;  2E2V A;  1MWR A;  1KQS 2;  2KAA A;  3B7C A;  5CF1 A;  1ISK A;  2HMM B;  1WMN A;  1BU4 A;  4K1U A;  2XGN A;  3D5I A;  1DMN A;  4R9L A;  2W0Q A;  1IU7 A;  1GYB A;  1RGE A;  1SII A;  3DY5 A;  1IT8 A;  1TJD A;  3JUN A;  1GD4 A;  3LXU X;  1W2Z A;  2AAD A;  4I4K A;  4WHA A;  1UGI A;  2XGL A;  5IEN A;  1S5A A;  2WGQ A;  2CX1 A;  4XM4 A;  5FW5 A;  1RMS A;  3MKI A;  3NX0 A;  1JV2 B;  2Y73 A;  3AMO A;  4EW5 A;  5IG3 A;  2WO0 A;  4RZM A;  2BNG A;  1Z1S A;  2CKF B;  2GU3 A;  5A0O B;  3OV4 A;  1EKM A;  2YX9 A;  2L1S A;  1HZ1 A;  3D9R A;  3F14 A;  4MMY B;  4XBX A;  3KFQ C;  3X42 A;  1UCI A;  4O2H A;  1US1 A;  3DUK A;  1TRQ A;  3NBJ A;  1UW1 A;  1V58 A;  5EVH A;  5M19 A;  3CPO A;  4LYL B;  4WP5 A;  3JUO A;  2CW9 A;  3MWZ A;  1HYF A;  2ZA4 A;  5ELU A;  1GMQ A;  1YVS A;  4ZM8 A;  5IG4 A;  5AEU B;  1RCL A;  1EQK A;  1B3S A;  2IUK A;  1KD1 4;  1BRI A;  4RNZ A;  2P0X A;  4HOH A;  1GOV A;  3URP A;  3EB8 A;  3CXC 2;  3NXJ A;  3SVA A;  4N3V A;  3WA2 X;  1STD A;  1IQY A;  2BT3 A;  1BOX A;  3EN8 A;  1VQ6 3;  2IUJ A;  1T3B A;  3CCE 3;  1M9G A;  4FR9 A;  2AAE A;  4CPK A;  3UJM A;  1JZO A;  1NU3 A;  1FW7 A;  3FGY A;  2KF5 A;  1OGX A;  1RSN A;  1HU9 A;  1WQL B;  5CLK A;  2ZHX B;  5CXO A;  1O7N B;  2BMR B;  2OQE A;  1D6U A;  3STD A;  1RKY A;  1NB5 I;  2WOH A;  1E97 A;  1MNL A;  1IQX A;  1RHL A;  5AI1 A;  2IYJ A;  1LOX A;  5D82 A;  1C7H A;  2CFK A;  4RNY A;  1JN5 A;  1D6Y A;  4LMI A;  5JPP A;  1LXE A;  1RGF A;  2OTL 3;  3OW2 2;  1G96 A;  2P09 A;  1Q7H A;  1MWT A;  3CNM A;  5EQL A;  5IEO A;  1K9M 4;  2KF3 A;  4BTW A;  1M1K 4;  1BRN L;  1OHS A;  4AKZ A;  3SOA A;  2C4B A;  1YGW A;  1PU4 A;  2XSH B;  3BND A;  1W7C A;  3D79 A;  3K9M C;  3SYU A;  2W9Q A;  3CU3 A;  3EE1 A;  3U97 A;  3CME 3;  3WMD A;  1L5G B;  2BU4 A;  2UX0 A;  1R4C A;  2Y74 A;  3A5E A;  5IG5 A;  3CD6 3;  1BUQ A;  4NHF A;  3QRD A;  2YFJ B;  1Y4K A;  2CG0 A;  1NDO B;  3Q90 A;  2GSP A;  3FSD A;  1VQQ A;  1W4N A;  1Q86 4;  3EN1 B;  3AHS A;  1JBT A;  3QK9 A;  2QA4 3;  2P0M A;  4CJN A;  1B2M A;  2PNC A;  3PCR A;  4IPB A;  1UUV B;  1PFP A;  3RGR A;  6RNT A;  2RFR A;  3SX1 A;  1AV4 A;  2Z6B A;  3K5T A;  3GZY B;  2K54 A;  4EYC A;  1OCV A;  3OWU A;  2P05 A;  2YFI B;  5DRV A;  1OUN A;  1W6G A;  3OWY A;  5IG0 A;  2MF7 A;  1BNI A;  2GBX B;  4IIA A;  1X1U A;  2XFT A;  3AGN A;  4NPB A;  5TGN A;  1SQW A;  1FGR A;  2GU1 A;  2W56 B;  2XRX B;  1GSP A;  3IPT A;  2OOV C;  5CF2 A;  3S28 A;  3ECF A;  4O3V A;  3EC9 A;  3PZW A;  3G71 3;  2BMQ B;  1B27 A;  3MHE A;  1RGG A;  1UGH I;  3CCM 3;  1O7H B;  3I56 3;  4N6O B;  4XDV A;  2K0M A;  3BNC A;  5STD A;  2CFW A;  3WA3 A;  1GD3 A;  1YIT 3;  1OAC A;  3CCR 3;  4HM3 B;  5BVB A;  2HMO B;  1ROA A;  4H3U A;  1T2H A;  1TIJ A;  2E2T A;  2W2C A;  3MG3 A;  1M90 4;  1AR0 A;  3X40 A;  1T5Y A;  2HMK B;  2XF3 A;  3DMC A;  3NV0 B;  1WMO A;  4HM0 B;  1JB4 A;  2D42 A;  3NQY A;  3LT8 A;  4FCZ A;  4FMA A;  1VQ5 3;  1UCL A;  3GAX A;  2LYX A;  3LTB A;  3CMA 3;  1NO3 A;  5LC7 A;  2SBL A;  3ALA A;  1VQ9 3;  3F7X A;  1AVL A;  4N6V 0;  3B4O A;  3X3X A;  3CCL 3;  1DE3 A;  1IQ8 A;  1VQ7 3;  1G02 A;  1FZU A;  3EJV A;  3B8L A;  1JNQ A;  1DVD A;  1FGT A;  3S29 A;  3BU4 A;  3DZL A;  1ULI B;  2B24 B;  1ROV A;  3NV0 A;  3OWS A;  1YI2 3;  1RCK A;  3PXM A;  1ZO2 A;  2BHM A;  4RBN A;  8CHO A;  5AYR B;  1BAO A;  2GBW B;  3F8X A;  4HYZ A;  1V57 A;  4Q53 A;  4J8T A;  2RCD A;  3PGB A;  5AIF A;  1QAK A;  3GZX B;  1JZD A;  1O7W B;  1I2G A;  4HBR A;  1RGC A;  1YNV X;  3VF1 A;  3H3H A;  4K1V A;  1SPU A;  3EBY A;  2JDI H;  1B2S A;  1TTO A;  1N8Q A;  1NWW A;  4N6T A;  1N9J A;  3ZG0 A;  1U8C B;  2QIY A;  1UDI I;  3PCS A;  5ELJ A;  3DGY A;  3VGN A;  4HAA A;  1Q7Y 4;  4HM4 B;  8RNT A;  3LT9 A;  3RNT A;  4BU4 A;  1SAR A;  1FUW A;  1I0V A;  1BSD A;  3UL6 A;  1BSE A;  1BRJ A;  1IYY A;  1RRH A;  1AVK A;  2KRT A;  1A2K A;  1RRL A;  3BNB A;  4LGQ A;  4TX4 A;  1LQG C;  3G6E 3;  4NRE A;  1N9E A;  2SAR A;  3LTC A;  4N6L A;  4XDW A;  4GHO A;  1IVW A;  5I97 A;  4FCM A;  3Q2P A;  1BGS A;  1GY6 A;  2FXT A;  1IT7 A;  1DMM A;  4R1K A;  2Q07 A;  3RGA A;  4EBG A;  4X2O A;  5D81 A;  3X41 A;  1Q42 A;  1BNG A;  1PYL A;  3HII A;  2L4V A;  1UUG B;  4LSO A;  1UCK A;  1K8A 4;  3NM2 A;  4O02 B;  1B2X A;  3LOY A;  1YJW 3;  1RJO A;  1I2E A;  3MPH A;  5G1L A;  3LTD A;  1GS3 A;  1S72 3;  1R4Y A;  1G0T A;  3MG2 A;  1VZZ A;  2F5W A;  4EV2 A;  4FMC A;  4R4K A;  3BIR A;  1NJI 4;  3WHO A;  3OX9 A;  1F8N A;  3EBT A;  2H0I A;  3UNL A;  3KN4 A;  1DVC A;  1YJN 3;  1E3V A;  1BNS A;  1B20 A;  3D3L A;  3DGM A;  1EA2 A;  1NB3 I;  1OHO A;  1BRH A;  1ULJ B;  3S5C A;  5M18 A;  3E99 A;  1ASK A;  1X1W A;  1JJ2 2;  2I9W A;  3H51 A;  1DMQ A;  3KZT A;  5BXQ A;  1JB5 A;  1QVF 2;  4WWU C;  1IV7 A;  1BNJ A;  3NBB A;  3D5G A;  1VQP 3;  3ZFZ A;  3G8Z A;  4KFF A;  2M7O A;  1FUS A;  1BNF A;  2ML5 A;  3B4P A;  3JUQ A;  4ILF A;  5D83 A;  2C10 A;  2OOV A;  1QVG 2;  5HGR A;  3CCJ 3;  4I5Q A;  2A15 A;  5IW9 A;  4HM1 B;  1C54 A;  1VQN 3;  1IK3 A;  3UB1 A;  1OGZ A;  2B1X B;  1FGM A;  3WOD G;  3CCV 3;  2CWT A;  2RNT A;  4N6U A;  4G1M B;  2IA7 A;  4EC6 A;  1VQL 3;  2F56 A;  3CC2 3;  2FGT A;  4GB5 A;  2P38 A;  4BL3 A;  1AY7 A;  4K90 B;  3JUP A;  3GRD A;  3GZR A;  1CQS A;  1K41 A; 
#chains in the Genus database with same CATH homology
 5EEO A;  3A76 A;  2MC8 A;  1TP6 A;  2W9P A;  2W04 A;  1J2B A;  4L8O A;  1RN7 A;  3KSP A;  5CK6 A;  5IEP A;  1W00 A;  4L7K A;  1W5Z A;  2WOF A;  2CWU A;  3EHC A;  5KP4 A;  1N5P A;  3T8N A;  3LZA A;  3BNE A;  7STD A;  2QGU A;  5AEW B;  1WMP A;  1LVN A;  1Q81 4;  1KC8 4;  1OH0 A;  4AEQ A;  4X2H A;  2XR8 B;  1KSI A;  4HM5 B;  3V92 A;  4HM7 B;  2GEX A;  2Z76 A;  4BTY A;  3EQQ B;  2W03 A;  3DGN A;  3F40 A;  3NM7 A;  5KP1 A;  2QEX 3;  2W56 A;  3G0K A;  4MJD A;  2CIU A;  4MMZ B;  1YHQ 3;  4XBT A;  1IDP A;  1MOL A;  2FNQ A;  2XFS A;  1JB2 A;  3NBR A;  4WFO A;  1DYU A;  1K73 4;  2CFG A;  2BO9 B;  3LML A;  4HJL B;  1JKG B;  1YIJ 3;  4L8P A;  3K7C A;  1A90 A;  2RGQ A;  3SLU A;  3UL5 A;  2E2U A;  2O9U X;  1D6Z A;  2XH9 A;  3DXO A;  4MEI A;  4HM2 B;  1GY5 A;  5IF6 A;  1VQM 3;  3HIG A;  4JF8 A;  3CCQ 3;  1KWI A;  3L0R A;  4KVH A;  5AIG A;  2O3O A;  1A2V A;  3JUM A;  1JKG A;  1TFO A;  3ER7 A;  2WGO A;  3M8C A;  3LTA A;  3T0U A;  1OF5 B;  1O7P B;  3S27 A;  4K61 A;  3X3Y A;  1LNH A;  2Z7A A;  3KII A;  2F86 B;  3WDG B;  4OVM A;  3K0Z A;  1W6C A;  1JRQ A;  3G16 A;  1M1X B;  1Q82 4;  4U13 A;  2BMO B;  2CFL A;  2HMN B;  3IJE B;  1K28 A;  2W6J H;  2Z77 A;  3PS8 A;  4BTX A;  1OF5 A;  4EV5 A;  3CCU 3;  3CC4 3;  3FF0 A;  3FLJ A;  2OWP A;  5AYS C;  1U5O A;  3CPW 2;  3EX9 A;  3FG3 A;  3IMA B;  3LH4 A;  3FG4 A;  3N9H A;  4FCJ A;  1VQO 3;  1N8R 4;  1E3R A;  2CC3 A;  2ZDJ A;  3SXX A;  2JQ5 A;  3CNX A;  4LEH A;  1QAF A;  1VQ4 3;  4OK0 A;  2KXG A;  3FF2 A;  4N6N B;  4QWT A;  1JN5 B;  5IER A;  3GWR A;  1ZX2 A;  4HVN A;  1GY7 A;  4WYK B;  3DGL A;  2R4I A;  2YFL B;  1W01 A;  1FGO A;  1IV9 A;  4FMB A;  4H61 A;  3OXA A;  4PEJ A;  1UI8 A;  3N54 B;  1TFK A;  3KKG A;  1OHP A;  3Q1C A;  1IVU A;  4LZI A;  3V98 A;  2GXF A;  1VQK 3;  2IMJ A;  5JPU A;  5JBS A;  1QMA A;  1Q40 B;  3NQZ A;  4WYK A;  3HZP A;  3N8B A;  3X3Z A;  4MMX B;  5FGO A;  2CG1 A;  1WNH A;  4EXR A;  4KFE A;  3HK4 A;  3MSO A;  3S67 A;  1SJW A;  1V74 A;  3HX8 A;  3BB9 A;  4R9K A;  4GL6 A;  3MG1 A;  4R80 A;  3VSY A;  1VQ8 3;  2GEY A;  1CYU A;  2HMJ B;  2OQE C;  3DM8 A;  4STD A;  2KCD A;  1Q40 A;  2CWV A;  1O7M B;  2F98 A;  5KP3 A;  2V1L A;  3NUV A;  2RSX A;  5G2G A;  3FH1 A;  2F99 A;  4IT7 A;  3O8Y A;  3CC7 3;  2ZL8 A;  3F8H A;  4HZB B;  4XBY A;  2CH9 A;  3F9S A;  1TUH A;  3I55 3;  3K63 A;  1W6Y A;  3KE7 A;  4JRF A;  1CEW I;  1YJ9 3;  2CK3 H;  4O8S A;  1IVX A;  1HKX A;  1UI7 A;  3JVC A;  2PZV A;  3HI7 A;  2HML B;  3PYJ A;  1STF I;  2OCT A;  1EG9 B;  4HZ9 B;  1FGQ A;  3EF8 A;  3SOY A;  4ORL A;  3SED A;  4HKV B;  1QAL A;  3WOF B;  3KSE D;  3F7S A;  3FCS B;  5AII A;  4KFD A;  3WOE B;  1YGE A;  4HM8 B;  4CDL A;  2C11 A;  1W2B 2;  1UUW B;  3CCS 3;  2LQV A;  5DRE A;  2ML6 A;  3FKA A;  1QJG A;  3MYT A;  3RDE A;  4FMD A;  1WTH A;  1OPY A;  2STD A;  3ROB A;  2OTJ 3;  3T8U A;  1SIH A;  2CHC A;  6STD A;  5LC6 A;  3TDG A;  2XSO B;  3G4S 3;  1W02 A;  3DGO A;  2D1W A;  3J7Y d;  1TU5 A;  4J9A A;  1IVV A;  2CFD A;  4N6M A;  4XB5 A;  3V99 A;  1CYV A;  1N5H A;  3I0Y A;  1O7G B;  5AIH A;  1A67 A;  4CCV A;  4OUQ A;  4HM6 B;  3FZW A;  1YVB I;  3LYG A;  4AKY A;  1FA3 A;  4KZ1 A;  3AMO B;  2XEP A;  3FG1 A;  2INX A;  3GZB A;  3NHX A;  3U1W A;  3BLZ A;  2E2V A;  1KQS 2;  3B7C A;  5CF1 A;  1ISK A;  2HMM B;  1WMN A;  4K1U A;  2XGN A;  4R9L A;  1DMN A;  2W0Q A;  1IU7 A;  1GYB A;  1SII A;  3DY5 A;  1IT8 A;  3JUN A;  1GD4 A;  3LXU X;  1W2Z A;  4I4K A;  4WHA A;  2XGL A;  5IEN A;  1S5A A;  2WGQ A;  5FW5 A;  4XM4 A;  3NX0 A;  3MKI A;  1JV2 B;  2Y73 A;  3AMO A;  5IG3 A;  2WO0 A;  4RZM A;  2BNG A;  1Z1S A;  2CKF B;  2GU3 A;  5A0O B;  3OV4 A;  1EKM A;  2YX9 A;  3D9R A;  3F14 A;  4MMY B;  4XBX A;  3KFQ C;  3X42 A;  4O2H A;  1US1 A;  3DUK A;  3NBJ A;  5EVH A;  1UW1 A;  3CPO A;  4WP5 A;  3JUO A;  2CW9 A;  3MWZ A;  5ELU A;  4ZM8 A;  5IG4 A;  5AEU B;  1EQK A;  2IUK A;  1KD1 4;  4RNZ A;  2P0X A;  3EB8 A;  3CXC 2;  3NXJ A;  3SVA A;  4N3V A;  3WA2 X;  1STD A;  1IQY A;  2BT3 A;  3EN8 A;  1VQ6 3;  2IUJ A;  3CCE 3;  1M9G A;  4FR9 A;  3UJM A;  1NU3 A;  3FGY A;  1OGX A;  1WQL B;  1HU9 A;  5CXO A;  5CLK A;  2OQE A;  1O7N B;  2BMR B;  1D6U A;  3STD A;  1RKY A;  1NB5 I;  2WOH A;  1E97 A;  1MNL A;  1IQX A;  5AI1 A;  1LOX A;  5D82 A;  1C7H A;  2CFK A;  4RNY A;  1JN5 A;  1D6Y A;  4LMI A;  5JPP A;  1LXE A;  2OTL 3;  3OW2 2;  1G96 A;  2P09 A;  5IEO A;  3CNM A;  5EQL A;  1K9M 4;  4BTW A;  1M1K 4;  1OHS A;  4AKZ A;  3SOA A;  1PU4 A;  2XSH B;  3BND A;  1W7C A;  3K9M C;  2W9Q A;  3CU3 A;  3EE1 A;  3U97 A;  3CME 3;  3WMD A;  1L5G B;  2UX0 A;  1R4C A;  2Y74 A;  5IG5 A;  3CD6 3;  1BUQ A;  4NHF A;  3QRD A;  2YFJ B;  1Y4K A;  2CG0 A;  1NDO B;  3Q90 A;  3FSD A;  1W4N A;  1Q86 4;  3EN1 B;  3QK9 A;  2QA4 3;  2P0M A;  2PNC A;  3PCR A;  4IPB A;  1UUV B;  1PFP A;  3RGR A;  2RFR A;  3SX1 A;  1AV4 A;  2Z6B A;  3K5T A;  3GZY B;  2K54 A;  4EYC A;  1OCV A;  3OWU A;  2P05 A;  2YFI B;  5DRV A;  1OUN A;  1W6G A;  3OWY A;  5IG0 A;  2MF7 A;  2GBX B;  4IIA A;  2XFT A;  5TGN A;  1SQW A;  1FGR A;  2GU1 A;  2W56 B;  2XRX B;  3IPT A;  2OOV C;  5CF2 A;  3S28 A;  3ECF A;  4O3V A;  3EC9 A;  3PZW A;  3G71 3;  2BMQ B;  3MHE A;  3CCM 3;  1O7H B;  3I56 3;  4N6O B;  4XDV A;  2K0M A;  3BNC A;  5STD A;  2CFW A;  3WA3 A;  1GD3 A;  1YIT 3;  1OAC A;  3CCR 3;  4HM3 B;  5BVB A;  2HMO B;  1ROA A;  4H3U A;  1TIJ A;  2E2T A;  2W2C A;  3MG3 A;  1M90 4;  1AR0 A;  3X40 A;  1T5Y A;  2HMK B;  2XF3 A;  3DMC A;  3NV0 B;  1WMO A;  4HM0 B;  1JB4 A;  2D42 A;  3NQY A;  3LT8 A;  4FCZ A;  4FMA A;  1VQ5 3;  3LTB A;  3GAX A;  2LYX A;  3CMA 3;  1NO3 A;  5LC7 A;  2SBL A;  3ALA A;  1VQ9 3;  3F7X A;  1AVL A;  4N6V 0;  3B4O A;  3X3X A;  3CCL 3;  1IQ8 A;  1VQ7 3;  3EJV A;  3B8L A;  1JNQ A;  1DVD A;  1FGT A;  3S29 A;  3DZL A;  1ULI B;  2B24 B;  1ROV A;  3NV0 A;  3OWS A;  1YI2 3;  3PXM A;  1ZO2 A;  2BHM A;  4RBN A;  8CHO A;  5AYR B;  2GBW B;  3F8X A;  4HYZ A;  4Q53 A;  4J8T A;  2RCD A;  3PGB A;  5AIF A;  1QAK A;  3GZX B;  1O7W B;  4HBR A;  3VF1 A;  3H3H A;  4K1V A;  1SPU A;  3EBY A;  2JDI H;  1N8Q A;  1NWW A;  4N6T A;  1N9J A;  1U8C B;  2QIY A;  3PCS A;  5ELJ A;  3VGN A;  1Q7Y 4;  4HM4 B;  3LT9 A;  1FUW A;  3UL6 A;  1RRH A;  1AVK A;  2KRT A;  1A2K A;  1RRL A;  3BNB A;  4LGQ A;  4TX4 A;  3G6E 3;  4NRE A;  1N9E A;  3LTC A;  4N6L A;  4XDW A;  1IVW A;  5I97 A;  4FCM A;  3Q2P A;  1GY6 A;  2FXT A;  3RGA A;  1IT7 A;  1DMM A;  4R1K A;  2Q07 A;  4EBG A;  4X2O A;  5D81 A;  3X41 A;  1Q42 A;  3HII A;  2L4V A;  4LSO A;  1K8A 4;  3NM2 A;  4O02 B;  3LOY A;  1YJW 3;  1RJO A;  3MPH A;  3LTD A;  1GS3 A;  1S72 3;  3MG2 A;  1VZZ A;  4EV2 A;  4FMC A;  4R4K A;  1NJI 4;  3OX9 A;  1F8N A;  3EBT A;  3UNL A;  3KN4 A;  1DVC A;  1YJN 3;  1E3V A;  3D3L A;  3DGM A;  1EA2 A;  1NB3 I;  1OHO A;  1ULJ B;  3S5C A;  3E99 A;  1ASK A;  1JJ2 2;  2I9W A;  3H51 A;  1DMQ A;  3KZT A;  5BXQ A;  1JB5 A;  1QVF 2;  4WWU C;  1IV7 A;  3NBB A;  1VQP 3;  3G8Z A;  4KFF A;  2M7O A;  2ML5 A;  3B4P A;  3JUQ A;  2OOV A;  5D83 A;  2C10 A;  1QVG 2;  5HGR A;  3CCJ 3;  2A15 A;  5IW9 A;  4HM1 B;  1VQN 3;  1IK3 A;  3UB1 A;  1OGZ A;  2B1X B;  1FGM A;  3WOD G;  3CCV 3;  2CWT A;  4N6U A;  4G1M B;  2IA7 A;  4EC6 A;  1VQL 3;  3CC2 3;  2FGT A;  4GB5 A;  2P38 A;  4K90 B;  3JUP A;  3GRD A;  3GZR A;  1CQS A;  1K41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...