1RTUA

Ustilago sphaerogena ribonuclease u2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
113
Chain Sequence
CDIPQSTNCGGNVYSNDDINTAIQGALDDVANGDRPDNYPHQYYEASEDITLCCGSGPWSEFPLVYNGPYYSSRDNYVSPGPDRVIYQTNTGEFCATVTHTGAASYDGFTQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE U2
publication title Crystal structure of Ustilago sphaerogena ribonuclease U2 at 1.8 A resolution.
pubmed doi rcsb
total genus 29
structure length 113
sequence length 114
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rtuA00
1GOYA 1RLSA 4J5GA 3AHWA 1YNVX 1B2SA 1FUTA 4BIRA 2BIRA 1BRHA 1B27A 1SARA 1BNFA 5BU4A 1T2HA 2C4BA 1RN4A 1X1WA 1GOUA 1B2ZA 1YGWA 1FW7A 1JBRA 1BRIA 1I0VA 1RSNA 1JBSA 1B21A 3D4AA 1BGSA 1RGLA 1RGCA 1HYFA 1UCJA 2KF6A 1GSPA 1DE3A 1RGKA 1FZUA 1LRAA 5GSPA 7RNTA 1BUJA 1DETA 1BSEA 1TTOA 2KF5A 2RNTA 1BVIA 2KF3A 1BRNL 2GSPA 1BU4A 2BU4A 3D5IA 5RNTA 1BOXA 4GSPA 1MGWA 2SARA 2HOHA 1BSAA 1RHLA 1TRPA 1B2UA 2KF4A 6GSPA 1I0XA 4HOHA 3GSPA 1BSDA 1PY3A 1LOYA 3RNTA 3DH2A 1BNJA 3AHSA 4HAAA 1I3IA 1B2MA 1RNBA 8RNTA 3HOHA 2ZA4A 6RNTA 3A5EA 1I2GA 1BRGA 1BRSA 1FUSA 1BIRA 1I8VA 1G02A 1AY7A 1X1UA 1BSBA 1RMSA 1BNEA 1IYYA 1T2IA 3WR2A 1JBTA 2F5WA 1BRJA 5BIRA 1BRKA 1C54A 1I2EA 1B2XA 1BNGA 1HZ1A 4J5KA 1B20A 2AAEA 1BNSA 1RGAA 1A2PA 1RGGA 1RCLA 3SYUA 3DGYA 1AQZA 1GMQA 3WHOA 4BU4A 1B3SA 1PYLA 3AGNA 1BAOA 1BSCA 3KCHA 1LNIA 1GMRA 3AGOA 1RCKA 1UCLA 1I70A 1I3FA 1I2FA 1RTUA 3URPA 1BANA 7GSPA 3BIRA 1RDSA 4GHOA 4RNTA 1RGHA 1RN1A 1R4YA 3D5GA 1BNRA 2AADA 5HOHA 1UCKA 1GMPA 1MGRA 1BNIA 1LOWA 2F56A 1ZGXA 2F5MA 3BU4A 2F4YA 1UCIA 9RNTA 1X1YA 1TRQA 1RGFA 1CH0A 1Q9EA 1YVSA 2RBIA 3Q3FA 1LOVA 1X1XA 2KAAA 1FYSA 1RNTA 1GOVA 1RGEA
chains in the Genus database with same CATH superfamily
1CEWI 1VQ43 1GOYA 1RLSA 1ROVA 5STDA 5M19A 3JUQA 1D6ZA 1FUTA 3VGNA 1LOXA 4BIRA 3B7CA 3GZXB 1OHPA 1ISKA 1SARA 3GZRA 3FKAA 2C4BA 4WYKB 5CF1A 1VQ63 1RN4A 3LMLA 1GOUA 2YFLB 1O7PB 2M7OA 3GRDA 4FMBA 1RSNA 4LSOA 2H0HA 3F40A 3MG2A 4MEIA 5IEPA 1FGRA 3O8YA 3NBBA 2E2UA 2KF6A 1DE3A 1QAFA 3IJEB 5ELUA 5CK6A 3EN1B 1BUJA 1EQKA 2CKFB 4RBNA 4KFEA 5AIIA 2RNTA 2OOVA 1A2VA 5CF2A 3OW22 3CCV3 3D79A 1VQL3 3BNEA 1BVIA 2KF3A 2YX9A 4N6MA 2JQ5A 3TDGA 2GSPA 4EYCA 5D83A 2FXTA 1GD3A 3F7XA 3D5IA 1Q40B 3CPW2 3F8XA 3QRDA 2GU3A 1TIJA 3E99A 1C7HA 3FF2A 1ULIB 2XF3A 3FH1A 4HM1B 1JJ22 1MWUA 3CNXA 1BSAA 4BTWA 2CG0A 3BNDA 3HIIA 3I553 3CCS3 3S28A 2INXA 1RHLA 1U8CB 1OUNA 1STFI 1I0XA 1Q824 1E97A 2A15A 4HJLB 2ZDJA 4N6NB 1YHQ3 1PY3A 2F86B 5EEOA 7STDA 1S5AA 3RNTA 5JPUA 4XBXA 3T0UA 4HAAA 1K28A 3CXC2 1W5ZA 3HZPA 4R4KA 3I563 1MWTA 8RNTA 2H0IA 3X3YA 3V98A 6RNTA 3A5EA 1I2GA 1GYBA 3LZAA 5A0OB 1K734 3CC43 1I8VA 1JV2B 1V74A 3BB9A 3G4S3 1BSBA 1RMSA 1IQXA 1OACA 4IT7A 3NXJA 2CWVA 3ZG0A 2F5WA 1SPUA 1VZZA 3EJVA 4EV5A 1E3VA 4RZMA 1C54A 3DUKA 3K9MC 4LYLB 2CFGA 2GBWB 1NB3I 1QMAA 3NV0B 4J5KA 4R9KA 1YIJ3 2HMKB 3DXOA 4R9LA 3HK4A 1W6GA 3JUOA 3BNCA 3WHOA 1OCVA 1DYUA 2GEYA 1EUIC 1PYLA 1EKMA 3EBYA 5CLKA 3WMDA 1V57A 1OPYA 2XGNA 4O2HA 1LNIA 2XFTA 3GWRA 4HM2B 1GD4A 1RKYA 1UI7A 1E3RA 3WODG 3U1WA 3FZWA 1LVNA 4O3VA 4FMAA 4CPKA 5G1KA 1R4YA 2P05A 3EHCA 1VQK3 2Q07A 5HOHA 1UCKA 1GMPA 2CX0A 3G8ZA 5KP3A 3UL5A 1YJW3 2E2VA 3I0YA 1LQGC 4OUQA 1MWSA 1LQMB 3FF0A 2F4YA 1DVDA 2MF7A 1TRQA 1RGFA 1YVSA 1Q9EA 2IUJA 2BHMA 3Q3FA 3NX0A 1TFKA 1JNQA 3F7SA 3SOYA 1RNTA 4LEHA 1GOVA 4BTYA 1AVKA 1K8A4 1TU5A 4J5GA 5AYRB 5AIGA 5FW5A 1W6CA 2WO0A 3CCE3 1UDII 2R4IA 3EN8A 2XGLA 1KWIA 2KCDA 2GU1A 1FGTA 2YFIB 3MSOA 5BU4A 1WMNA 3CCR3 1MOLA 2W6JH 1PU4A 1JBSA 1ULJB 5D82A 2CIUA 2KRTA 3S67A 1OF5A 1MNLA 1JKGB 1A2KA 1RGLA 1RGCA 3EQQB 1GSPA 3JUPA 3NM7A 1UGIA 5GSPA 4CCVA 2QEX3 1JN5A 1GY7A 3AMOA 1DETA 1TTOA 3U97A 1IU7A 4MMXB 3LT9A 2RSXA 3OXAA 1OH0A 3NQZA 1IK3A 3S27A 5IERA 1N9EA 1R4CA 4G1MB 1WQLB 2V1LA 3X42A 2D1WA 4K1UA 3IPTA 1LXEA 1L5GB 2MC8A 2LQVA 4XDVA 4Q53A 2SARA 3CCL3 3SLUA 2HOHA 3ECFA 2W56A 4HVNA 4K1VA 1DMQA 2Z7AA 4HM3B 4HM7B 2W03A 4XDWA 1VQN3 1O7MB 1TRPA 1CYUA 3T8NA 3GSPA 1BSDA 1LOYA 3CCQ3 1O7WB 3DH2A 1CYVA 3AHSA 3V92A 1B2MA 1ROAA 2HMOB 3BNBA 4J9AA 1UGHI 1N5HA 3OWUA 3X41A 2OTJ3 2O3OA 2ZA4A 4IIAA 1MWRA 1W6YA 2P0MA 4HKVB 3PCSA 1STDA 2BMQB 3CCM3 3STDA 1BNEA 2KXGA 2QA43 2K0MA 2ZHXB 3K5TA 4J8TA 3EF8A 3WR2A 2XEPA 4WWUC 3G713 1WMPA 1WTHA 3MPHA 2OWPA 3CU3A 2BO9B 5BVBA 2D42A 1QVF2 1BNSA 3CC23 2GEXA 1WMOA 2L1SA 2XSHB 1OHOA 1Q42A 5FGOA 5CXOA 4N3VA 1FGOA 3SEDA 2Y74A 1N5PA 2CFKA 3NUVA 2Z76A 1M904 1BAOA 4EC6A 4KVHA 2WGOA 3WDGB 1TUHA 3JUMA 1UCLA 3HIGA 1D6YA 1I70A 4L8PA 5AYSC 2BT3A 3SX1A 3LYGA 1S723 1JZDA 3CNMA 3URPA 1YJN3 1BANA 1IVVA 2JDIH 4MMZB 4N6UA 4ORLA 4DKIA 2GBXB 1PFPA 2HMNB 1TP6A 3Q1CA 4RNTA 3FG1A 1RN1A 3H3HA 4N6OB 3PXMA 1AVLA 4WFOA 5AEUB 1BNRA 4ILFA 2QGUA 3KKGA 1UW1A 2WOFA 2F56A 2OQEC 1A90A 2F5MA 2W2CA 5ELJA 4EBGA 2K3DA 2CFLA 4X2HA 4XBTA 1YVBI 3LTAA 1SIHA 1LOVA 5G2GA 4NPBA 2CG1A 1D6UA 2XRXB 4IPBA 3AHWA 4BTXA 1T3BA 1YNVX 4ZM8A 4HM8B 1B2SA 1IT7A 2BIRA 1W7CA 1BRHA 5HGRA 5KP1A 5TGNA 1T2HA 1JB4A 3WA3A 3FCSB 3ROBA 1UI8A 1JB5A 3CC73 1FW7A 1BRIA 1NU3A 1B21A 2RCDA 4KT3B 3FGYA 4HM5B 1BGSA 2Z6BA 1M1XB 1F8NA 1RRHA 2HMJB 3FG4A 1UCJA 1U5OA 1FZUA 1LRAA 5AIFA 7RNTA 4BL2A 1BSEA 1OHSA 5IG4A 2KF5A 1SIIA 2BMRB 5AEWB 2F98A 3LH4A 3LT8A 5IG0A 2STDA 4R80A 1EG9B 4OVMA 4FCZA 1QALA 3KN4A 2HMMB 4OK0A 4WYKA 1LNHA 4PEJA 8CHOA 5RNTA 2H0GA 3LOYA 3PYJA 4K61A 4R1KA 1BOXA 4GSPA 2BMOB 1WNHA 1DMNA 3CCU3 1EA2A 2CX1A 4K90B 5G1LA 4MJDA 1B2UA 4AKZA 6GSPA 2W9QA 1ZS7A 2WOHA 4HOHA 3MHEA 3PGBA 4N6TA 3M8CA 1DMMA 1ASKA 2P09A 5M1AA 1VQP3 1KSIA 5KP4A 1I3IA 3DGNA 3F9SA 5IEOA 4WHAA 1RNBA 1YIT3 2C11A 6STDA 1FA3A 1Q40A 2O9UX 3G0KA 4KFDA 2IY2A 3DY5A 4H61A 1BRGA 1QAKA 1BIRA 1T5YA 5IG3A 2W9PA 1AY7A 5LC6A 1YJ93 1O7NB 3CMA3 3NBRA 4I4KA 1T2IA 2R41A 1GS3A 2P38A 2HMLB 1JBTA 1BRJA 5BIRA 1BRKA 1B2XA 1UUVB 4JRFA 3KE7A 1AR0A 1IV9A 1JBRA 4L8OA 1RGAA 1A2PA 4HZBB 1RCLA 1N8QA 1GMQA 1KQS2 2I9WA 2OTL3 4CDLA 1OGXA 4RNYA 4BU4A 5DRVA 3MWZA 1G0TA 3PCRA 1NNVA 2K54A 2Z77A 3N9HA 1N9JA 3S5CA 1G96A 2ML6A 2F99A 4FR9A 3UB1A 1YI23 4NREA 1FGQA 3CME3 4AEQA 3UJMA 3DGLA 1RTUA 2CK3H 3BLZA 3DM8A 1KC84 2LYXA 3MG1A 2W0QA 1W2B2 1Q864 3GAXA 3H51A 5BXQA 1IVUA 3D5GA 3CPOA 2CFDA 1O7HB 3NV0A 2CFWA 1MGRA 2FNQA 3ALAA 4QWTA 3G16A 4BL3A 2YFJB 1BNIA 1VQO3 4U13A 4X2OA 3LTDA 2RFRA 3V99A 3PS8A 1UCIA 1OF5B 3ZFZA 1VQ93 3CD63 1KD14 2W04A 1JB2A 3L0RA 2RBIA 4KFFA 1VQQA 4MMYB 1M9GA 3DZLA 2OQEA 3Q90A 1JN5B 3LTBA 1X1XA 3A76A 3AMOB 1K9M4 3Q2PA 3QK9A 3EX9A 2IA7A 4I5QA 1CQSA 3K63A 2CW9A 3SXXA 3SOAA 3F14A 4RNZA 1B27A 1EEJA 1BNFA 3JVCA 1TFOA 2SBLA 1YGEA 4FMCA 1J2BA 3EBTA 3SVAA 1X1WA 1B2ZA 1YGWA 5JBSA 2OCTA 4FCMA 1I0VA 4LMIA 4TX4A 4H3UA 4XBYA 5AIHA 3X3ZA 2XR8B 3B8LA 3IMAB 3GZBA 3RGRA 2FGTA 1QJGA 2OOVC 2W56B 3D4AA 2ML5A 1HYFA 1DVCA 3FLJA 3HI7A 2UX0A 1RGKA 1IVXA 3UL6A 5IENA 3KSED 1GY6A 1JZOA 1Q7HA 4AKYA 2IUKA 2Y73A 3B4PA 4GB5A 1ZX2A 1O7GB 3G6E3 1SJWA 3GZYB 4EV2A 1AV4A 4KZ1A 1BRNL 5M18A 1BU4A 4STDA 2BU4A 3WOFB 4HBRA 3OWSA 2PNCA 1NB5I 3WA2X 3EB8A 2CH9A 1RJOA 2XFSA 1Z1SA 2CWUA 1V58A 1FGMA 1MGWA 5D81A 1NJI4 1NDOB 3LXUX 4N6LA 3X40A 5IG5A 1BUQA 1JKGA 1US1A 4EW5A 3MKIA 3KFQC 3HX8A 3KSPA 3B4OA 2KF4A 2XH9A 3OV4A 2L4VA 2CWTA 5AI1A 5IW9A 1IVWA 5EQLA 1TJDA 3PZWA 1FUWA 1IT8A 3CCJ3 1BNJA 2C10A 1IV7A 3FSDA 2E2TA 3K0ZA 3DGMA 2ZL8A 4LGQA 3EE1A 3KZTA 4EXRA 3HOHA 5DREA 1NO3A 1RRLA 3UNLA 5JPPA 4HM0B 1VQ53 1BRSA 3NM2A 1FUSA 1M1K4 2GXFA 3FG3A 4JF8A 1A67A 1G02A 3OX9A 1X1UA 2XSOB 2J8XB 1W01A 1Q814 3S29A 1IYYA 1UUWB 3ZG5A 4LZIA 2P0XA 3MYTA 1RN7A 3LTCA 1I2EA 3VSYA 1BNGA 5I97A 1VQ83 3RGAA 1HZ1A 4XB5A 1B20A 2AAEA 4FMDA 4HYZA 1RGGA 1HU9A 1N8R4 3SYUA 3DGYA 1AQZA 3DGOA 3WOEB 2UUGC 1OGZA 1VQM3 4XM4A 3N8BA 3K7CA 1B3SA 3AGNA 3OWYA 3N54B 3NQYA 4L7KA 1BSCA 2B1XB 1IQYA 2IMJA 1K41A 3KCHA 3NBJA 4FCJA 3RDEA 3VF1A 4HM4B 2B24B 4HZ9B 1GMRA 4N6V0 3AGOA 1RCKA 2CC3A 1IDPA 2IYJA 3ER7A 3MG3A 1UUGB 5EVHA 3J7Yd 3F8HA 1I3FA 1I2FA 1VQ73 1QVG2 1W02A 1SQWA 1W00A 1IQ8A 2RGQA 2WGQA 3D9RA 1HKXA 1W4NA 3BIRA 1GY5A 1JRQA 3EC9A 4HM6B 4CJNA 1RDSA 7GSPA 4GHOA 1RGHA 5IF6A 1W2ZA 2AADA 3X3XA 3DMCA 4GL6A 4O02B 3KIIA 4O8SA 1LOWA 3NHXA 2UGIA 1ZGXA 1ZO2A 4WP5A 1Y4KA 3BU4A 9RNTA 3JUNA 1X1YA 1CH0A 2QIYA 2CHCA 2PZVA 3D3LA 1Q7Y4 3T8UA 5LC7A 1NWWA 2BNGA 2KAAA 4NHFA 1FYSA 1RGEA
chains in the Genus database with same CATH topology
1GOYA 1RLSA 4J5GA 3AHWA 1YNVX 1B2SA 1FUTA 4BIRA 2BIRA 1BRHA 1B27A 1SARA 1BNFA 5BU4A 1T2HA 2C4BA 1RN4A 1X1WA 1GOUA 1B2ZA 1YGWA 1FW7A 1JBRA 1BRIA 1I0VA 1RSNA 1JBSA 1B21A 3D4AA 1BGSA 1RGLA 1RGCA 1HYFA 1UCJA 2KF6A 1GSPA 1DE3A 1RGKA 1FZUA 1LRAA 5GSPA 7RNTA 1BUJA 1DETA 1BSEA 1TTOA 2KF5A 2RNTA 1BVIA 2KF3A 1BRNL 2GSPA 1BU4A 2BU4A 3D5IA 5RNTA 1BOXA 4GSPA 1MGWA 2SARA 2HOHA 1BSAA 1RHLA 1TRPA 1B2UA 2KF4A 6GSPA 1I0XA 4HOHA 3GSPA 1BSDA 1PY3A 1LOYA 3RNTA 3DH2A 1BNJA 3AHSA 4HAAA 1I3IA 1B2MA 1RNBA 8RNTA 3HOHA 2ZA4A 6RNTA 3A5EA 1I2GA 1BRGA 1BRSA 1FUSA 1BIRA 1I8VA 1G02A 1AY7A 1X1UA 1BSBA 1RMSA 1BNEA 1IYYA 1T2IA 3WR2A 1JBTA 2F5WA 1BRJA 5BIRA 1BRKA 1C54A 1I2EA 1B2XA 1BNGA 1HZ1A 4J5KA 1B20A 2AAEA 1BNSA 1RGAA 1A2PA 1RGGA 1RCLA 3SYUA 3DGYA 1AQZA 1GMQA 3WHOA 4BU4A 1B3SA 1PYLA 3AGNA 1BAOA 1BSCA 3KCHA 1LNIA 1GMRA 3AGOA 1RCKA 1UCLA 1I70A 1I3FA 1I2FA 1RTUA 3URPA 1BANA 7GSPA 3BIRA 1RDSA 4GHOA 4RNTA 1RGHA 1RN1A 1R4YA 3D5GA 1BNRA 2AADA 5HOHA 1UCKA 1GMPA 1MGRA 1BNIA 1LOWA 2F56A 1ZGXA 2F5MA 3BU4A 2F4YA 1UCIA 9RNTA 1X1YA 1TRQA 1RGFA 1CH0A 1Q9EA 1YVSA 2RBIA 3Q3FA 1LOVA 1X1XA 2KAAA 1FYSA 1RNTA 1GOVA 1RGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOY A;  1RLS A;  4J5G A;  3AHW A;  1YNV X;  1B2S A;  1FUT A;  4BIR A;  2BIR A;  1BRH A;  1B27 A;  1SAR A;  1BNF A;  5BU4 A;  1T2H A;  2C4B A;  1RN4 A;  1X1W A;  1GOU A;  1B2Z A;  1YGW A;  1FW7 A;  1JBR A;  1BRI A;  1I0V A;  1RSN A;  1JBS A;  1B21 A;  3D4A A;  1BGS A;  1RGL A;  1RGC A;  1HYF A;  1UCJ A;  2KF6 A;  1GSP A;  1DE3 A;  1RGK A;  1FZU A;  1LRA A;  5GSP A;  7RNT A;  1BUJ A;  1DET A;  1BSE A;  1TTO A;  2KF5 A;  2RNT A;  1BVI A;  2KF3 A;  1BRN L;  2GSP A;  1BU4 A;  2BU4 A;  3D5I A;  5RNT A;  1BOX A;  4GSP A;  1MGW A;  2SAR A;  2HOH A;  1BSA A;  1RHL A;  1TRP A;  1B2U A;  2KF4 A;  6GSP A;  1I0X A;  4HOH A;  3GSP A;  1BSD A;  1PY3 A;  1LOY A;  3RNT A;  3DH2 A;  1BNJ A;  3AHS A;  4HAA A;  1I3I A;  1B2M A;  1RNB A;  8RNT A;  3HOH A;  2ZA4 A;  6RNT A;  3A5E A;  1I2G A;  1BRG A;  1BRS A;  1FUS A;  1BIR A;  1I8V A;  1G02 A;  1AY7 A;  1X1U A;  1BSB A;  1RMS A;  1BNE A;  1IYY A;  1T2I A;  3WR2 A;  1JBT A;  2F5W A;  1BRJ A;  5BIR A;  1BRK A;  1C54 A;  1I2E A;  1B2X A;  1BNG A;  1HZ1 A;  4J5K A;  1B20 A;  2AAE A;  1BNS A;  1RGA A;  1A2P A;  1RGG A;  1RCL A;  3SYU A;  3DGY A;  1AQZ A;  1GMQ A;  3WHO A;  4BU4 A;  1B3S A;  1PYL A;  3AGN A;  1BAO A;  1BSC A;  3KCH A;  1LNI A;  1GMR A;  3AGO A;  1RCK A;  1UCL A;  1I70 A;  1I3F A;  1I2F A;  1RTU A;  3URP A;  1BAN A;  7GSP A;  3BIR A;  1RDS A;  4GHO A;  4RNT A;  1RGH A;  1RN1 A;  1R4Y A;  3D5G A;  1BNR A;  2AAD A;  5HOH A;  1UCK A;  1GMP A;  1MGR A;  1BNI A;  1LOW A;  2F56 A;  1ZGX A;  2F5M A;  3BU4 A;  2F4Y A;  1UCI A;  9RNT A;  1X1Y A;  1TRQ A;  1RGF A;  1CH0 A;  1Q9E A;  1YVS A;  2RBI A;  3Q3F A;  1LOV A;  1X1X A;  2KAA A;  1FYS A;  1RNT A;  1GOV A;  1RGE A; 
#chains in the Genus database with same CATH topology
 1CEW I;  1VQ4 3;  1GOY A;  1RLS A;  1ROV A;  5STD A;  5M19 A;  3JUQ A;  1D6Z A;  1FUT A;  3VGN A;  1LOX A;  4BIR A;  3B7C A;  3GZX B;  1OHP A;  1ISK A;  1SAR A;  3GZR A;  3FKA A;  2C4B A;  4WYK B;  5CF1 A;  1VQ6 3;  1RN4 A;  3LML A;  1GOU A;  2YFL B;  1O7P B;  2M7O A;  3GRD A;  4FMB A;  1RSN A;  4LSO A;  2H0H A;  3F40 A;  3MG2 A;  4MEI A;  5IEP A;  1FGR A;  3O8Y A;  3NBB A;  2E2U A;  2KF6 A;  1DE3 A;  1QAF A;  3IJE B;  5ELU A;  5CK6 A;  3EN1 B;  1BUJ A;  1EQK A;  2CKF B;  4RBN A;  4KFE A;  5AII A;  2RNT A;  2OOV A;  1A2V A;  5CF2 A;  3OW2 2;  3CCV 3;  3D79 A;  1VQL 3;  3BNE A;  1BVI A;  2KF3 A;  2YX9 A;  4N6M A;  2JQ5 A;  3TDG A;  2GSP A;  4EYC A;  5D83 A;  2FXT A;  1GD3 A;  3F7X A;  3D5I A;  1Q40 B;  3CPW 2;  3F8X A;  3QRD A;  2GU3 A;  1TIJ A;  3E99 A;  1C7H A;  3FF2 A;  1ULI B;  2XF3 A;  3FH1 A;  4HM1 B;  1JJ2 2;  1MWU A;  3CNX A;  1BSA A;  4BTW A;  2CG0 A;  3BND A;  3HII A;  3I55 3;  3CCS 3;  3S28 A;  2INX A;  1RHL A;  1U8C B;  1OUN A;  1STF I;  1I0X A;  1Q82 4;  1E97 A;  2A15 A;  4HJL B;  2ZDJ A;  4N6N B;  1YHQ 3;  1PY3 A;  2F86 B;  5EEO A;  7STD A;  1S5A A;  3RNT A;  5JPU A;  4XBX A;  3T0U A;  4HAA A;  1K28 A;  3CXC 2;  1W5Z A;  3HZP A;  4R4K A;  3I56 3;  1MWT A;  8RNT A;  2H0I A;  3X3Y A;  3V98 A;  6RNT A;  3A5E A;  1I2G A;  1GYB A;  3LZA A;  5A0O B;  1K73 4;  3CC4 3;  1I8V A;  1JV2 B;  1V74 A;  3BB9 A;  3G4S 3;  1BSB A;  1RMS A;  1IQX A;  1OAC A;  4IT7 A;  3NXJ A;  2CWV A;  3ZG0 A;  2F5W A;  1SPU A;  1VZZ A;  3EJV A;  4EV5 A;  1E3V A;  4RZM A;  1C54 A;  3DUK A;  3K9M C;  4LYL B;  2CFG A;  2GBW B;  1NB3 I;  1QMA A;  3NV0 B;  4J5K A;  4R9K A;  1YIJ 3;  2HMK B;  3DXO A;  4R9L A;  3HK4 A;  1W6G A;  3JUO A;  3BNC A;  3WHO A;  1OCV A;  1DYU A;  2GEY A;  1EUI C;  1PYL A;  1EKM A;  3EBY A;  5CLK A;  3WMD A;  1V57 A;  1OPY A;  2XGN A;  4O2H A;  1LNI A;  2XFT A;  3GWR A;  4HM2 B;  1GD4 A;  1RKY A;  1UI7 A;  1E3R A;  3WOD G;  3U1W A;  3FZW A;  1LVN A;  4O3V A;  4FMA A;  4CPK A;  5G1K A;  1R4Y A;  2P05 A;  3EHC A;  1VQK 3;  2Q07 A;  5HOH A;  1UCK A;  1GMP A;  2CX0 A;  3G8Z A;  5KP3 A;  3UL5 A;  1YJW 3;  2E2V A;  3I0Y A;  1LQG C;  4OUQ A;  1MWS A;  1LQM B;  3FF0 A;  2F4Y A;  1DVD A;  2MF7 A;  1TRQ A;  1RGF A;  1YVS A;  1Q9E A;  2IUJ A;  2BHM A;  3Q3F A;  3NX0 A;  1TFK A;  1JNQ A;  3F7S A;  3SOY A;  1RNT A;  4LEH A;  1GOV A;  4BTY A;  1AVK A;  1K8A 4;  1TU5 A;  4J5G A;  5AYR B;  5AIG A;  5FW5 A;  1W6C A;  2WO0 A;  3CCE 3;  1UDI I;  2R4I A;  3EN8 A;  2XGL A;  1KWI A;  2KCD A;  2GU1 A;  1FGT A;  2YFI B;  3MSO A;  5BU4 A;  1WMN A;  3CCR 3;  1MOL A;  2W6J H;  1PU4 A;  1JBS A;  1ULJ B;  5D82 A;  2CIU A;  2KRT A;  3S67 A;  1OF5 A;  1MNL A;  1JKG B;  1A2K A;  1RGL A;  1RGC A;  3EQQ B;  1GSP A;  3JUP A;  3NM7 A;  1UGI A;  5GSP A;  4CCV A;  2QEX 3;  1JN5 A;  1GY7 A;  3AMO A;  1DET A;  1TTO A;  3U97 A;  1IU7 A;  4MMX B;  3LT9 A;  2RSX A;  3OXA A;  1OH0 A;  3NQZ A;  1IK3 A;  3S27 A;  5IER A;  1N9E A;  1R4C A;  4G1M B;  1WQL B;  2V1L A;  3X42 A;  2D1W A;  4K1U A;  3IPT A;  1LXE A;  1L5G B;  2MC8 A;  2LQV A;  4XDV A;  4Q53 A;  2SAR A;  3CCL 3;  3SLU A;  2HOH A;  3ECF A;  2W56 A;  4HVN A;  4K1V A;  1DMQ A;  2Z7A A;  4HM3 B;  4HM7 B;  2W03 A;  4XDW A;  1VQN 3;  1O7M B;  1TRP A;  1CYU A;  3T8N A;  3GSP A;  1BSD A;  1LOY A;  3CCQ 3;  1O7W B;  3DH2 A;  1CYV A;  3AHS A;  3V92 A;  1B2M A;  1ROA A;  2HMO B;  3BNB A;  4J9A A;  1UGH I;  1N5H A;  3OWU A;  3X41 A;  2OTJ 3;  2O3O A;  2ZA4 A;  4IIA A;  1MWR A;  1W6Y A;  2P0M A;  4HKV B;  3PCS A;  1STD A;  2BMQ B;  3CCM 3;  3STD A;  1BNE A;  2KXG A;  2QA4 3;  2K0M A;  2ZHX B;  3K5T A;  4J8T A;  3EF8 A;  3WR2 A;  2XEP A;  4WWU C;  3G71 3;  1WMP A;  1WTH A;  3MPH A;  2OWP A;  3CU3 A;  2BO9 B;  5BVB A;  2D42 A;  1QVF 2;  1BNS A;  3CC2 3;  2GEX A;  1WMO A;  2L1S A;  2XSH B;  1OHO A;  1Q42 A;  5FGO A;  5CXO A;  4N3V A;  1FGO A;  3SED A;  2Y74 A;  1N5P A;  2CFK A;  3NUV A;  2Z76 A;  1M90 4;  1BAO A;  4EC6 A;  4KVH A;  2WGO A;  3WDG B;  1TUH A;  3JUM A;  1UCL A;  3HIG A;  1D6Y A;  1I70 A;  4L8P A;  5AYS C;  2BT3 A;  3SX1 A;  3LYG A;  1S72 3;  1JZD A;  3CNM A;  3URP A;  1YJN 3;  1BAN A;  1IVV A;  2JDI H;  4MMZ B;  4N6U A;  4ORL A;  4DKI A;  2GBX B;  1PFP A;  2HMN B;  1TP6 A;  3Q1C A;  4RNT A;  3FG1 A;  1RN1 A;  3H3H A;  4N6O B;  3PXM A;  1AVL A;  4WFO A;  5AEU B;  1BNR A;  4ILF A;  2QGU A;  3KKG A;  1UW1 A;  2WOF A;  2F56 A;  2OQE C;  1A90 A;  2F5M A;  2W2C A;  5ELJ A;  4EBG A;  2K3D A;  2CFL A;  4X2H A;  4XBT A;  1YVB I;  3LTA A;  1SIH A;  1LOV A;  5G2G A;  4NPB A;  2CG1 A;  1D6U A;  2XRX B;  4IPB A;  3AHW A;  4BTX A;  1T3B A;  1YNV X;  4ZM8 A;  4HM8 B;  1B2S A;  1IT7 A;  2BIR A;  1W7C A;  1BRH A;  5HGR A;  5KP1 A;  5TGN A;  1T2H A;  1JB4 A;  3WA3 A;  3FCS B;  3ROB A;  1UI8 A;  1JB5 A;  3CC7 3;  1FW7 A;  1BRI A;  1NU3 A;  1B21 A;  2RCD A;  4KT3 B;  3FGY A;  4HM5 B;  1BGS A;  2Z6B A;  1M1X B;  1F8N A;  1RRH A;  2HMJ B;  3FG4 A;  1UCJ A;  1U5O A;  1FZU A;  1LRA A;  5AIF A;  7RNT A;  4BL2 A;  1BSE A;  1OHS A;  5IG4 A;  2KF5 A;  1SII A;  2BMR B;  5AEW B;  2F98 A;  3LH4 A;  3LT8 A;  5IG0 A;  2STD A;  4R80 A;  1EG9 B;  4OVM A;  4FCZ A;  1QAL A;  3KN4 A;  2HMM B;  4OK0 A;  4WYK A;  1LNH A;  4PEJ A;  8CHO A;  5RNT A;  2H0G A;  3LOY A;  3PYJ A;  4K61 A;  4R1K A;  1BOX A;  4GSP A;  2BMO B;  1WNH A;  1DMN A;  3CCU 3;  1EA2 A;  2CX1 A;  4K90 B;  5G1L A;  4MJD A;  1B2U A;  4AKZ A;  6GSP A;  2W9Q A;  1ZS7 A;  2WOH A;  4HOH A;  3MHE A;  3PGB A;  4N6T A;  3M8C A;  1DMM A;  1ASK A;  2P09 A;  5M1A A;  1VQP 3;  1KSI A;  5KP4 A;  1I3I A;  3DGN A;  3F9S A;  5IEO A;  4WHA A;  1RNB A;  1YIT 3;  2C11 A;  6STD A;  1FA3 A;  1Q40 A;  2O9U X;  3G0K A;  4KFD A;  2IY2 A;  3DY5 A;  4H61 A;  1BRG A;  1QAK A;  1BIR A;  1T5Y A;  5IG3 A;  2W9P A;  1AY7 A;  5LC6 A;  1YJ9 3;  1O7N B;  3CMA 3;  3NBR A;  4I4K A;  1T2I A;  2R41 A;  1GS3 A;  2P38 A;  2HML B;  1JBT A;  1BRJ A;  5BIR A;  1BRK A;  1B2X A;  1UUV B;  4JRF A;  3KE7 A;  1AR0 A;  1IV9 A;  1JBR A;  4L8O A;  1RGA A;  1A2P A;  4HZB B;  1RCL A;  1N8Q A;  1GMQ A;  1KQS 2;  2I9W A;  2OTL 3;  4CDL A;  1OGX A;  4RNY A;  4BU4 A;  5DRV A;  3MWZ A;  1G0T A;  3PCR A;  1NNV A;  2K54 A;  2Z77 A;  3N9H A;  1N9J A;  3S5C A;  1G96 A;  2ML6 A;  2F99 A;  4FR9 A;  3UB1 A;  1YI2 3;  4NRE A;  1FGQ A;  3CME 3;  4AEQ A;  3UJM A;  3DGL A;  1RTU A;  2CK3 H;  3BLZ A;  3DM8 A;  1KC8 4;  2LYX A;  3MG1 A;  2W0Q A;  1W2B 2;  1Q86 4;  3GAX A;  3H51 A;  5BXQ A;  1IVU A;  3D5G A;  3CPO A;  2CFD A;  1O7H B;  3NV0 A;  2CFW A;  1MGR A;  2FNQ A;  3ALA A;  4QWT A;  3G16 A;  4BL3 A;  2YFJ B;  1BNI A;  1VQO 3;  4U13 A;  4X2O A;  3LTD A;  2RFR A;  3V99 A;  3PS8 A;  1UCI A;  1OF5 B;  3ZFZ A;  1VQ9 3;  3CD6 3;  1KD1 4;  2W04 A;  1JB2 A;  3L0R A;  2RBI A;  4KFF A;  1VQQ A;  4MMY B;  1M9G A;  3DZL A;  2OQE A;  3Q90 A;  1JN5 B;  3LTB A;  1X1X A;  3A76 A;  3AMO B;  1K9M 4;  3Q2P A;  3QK9 A;  3EX9 A;  2IA7 A;  4I5Q A;  1CQS A;  3K63 A;  2CW9 A;  3SXX A;  3SOA A;  3F14 A;  4RNZ A;  1B27 A;  1EEJ A;  1BNF A;  3JVC A;  1TFO A;  2SBL A;  1YGE A;  4FMC A;  1J2B A;  3EBT A;  3SVA A;  1X1W A;  1B2Z A;  1YGW A;  5JBS A;  2OCT A;  4FCM A;  1I0V A;  4LMI A;  4TX4 A;  4H3U A;  4XBY A;  5AIH A;  3X3Z A;  2XR8 B;  3B8L A;  3IMA B;  3GZB A;  3RGR A;  2FGT A;  1QJG A;  2OOV C;  2W56 B;  3D4A A;  2ML5 A;  1HYF A;  1DVC A;  3FLJ A;  3HI7 A;  2UX0 A;  1RGK A;  1IVX A;  3UL6 A;  5IEN A;  3KSE D;  1GY6 A;  1JZO A;  1Q7H A;  4AKY A;  2IUK A;  2Y73 A;  3B4P A;  4GB5 A;  1ZX2 A;  1O7G B;  3G6E 3;  1SJW A;  3GZY B;  4EV2 A;  1AV4 A;  4KZ1 A;  1BRN L;  5M18 A;  1BU4 A;  4STD A;  2BU4 A;  3WOF B;  4HBR A;  3OWS A;  2PNC A;  1NB5 I;  3WA2 X;  3EB8 A;  2CH9 A;  1RJO A;  2XFS A;  1Z1S A;  2CWU A;  1V58 A;  1FGM A;  1MGW A;  5D81 A;  1NJI 4;  1NDO B;  3LXU X;  4N6L A;  3X40 A;  5IG5 A;  1BUQ A;  1JKG A;  1US1 A;  4EW5 A;  3MKI A;  3KFQ C;  3HX8 A;  3KSP A;  3B4O A;  2KF4 A;  2XH9 A;  3OV4 A;  2L4V A;  2CWT A;  5AI1 A;  5IW9 A;  1IVW A;  5EQL A;  1TJD A;  3PZW A;  1FUW A;  1IT8 A;  3CCJ 3;  1BNJ A;  2C10 A;  1IV7 A;  3FSD A;  2E2T A;  3K0Z A;  3DGM A;  2ZL8 A;  4LGQ A;  3EE1 A;  3KZT A;  4EXR A;  3HOH A;  5DRE A;  1NO3 A;  1RRL A;  3UNL A;  5JPP A;  4HM0 B;  1VQ5 3;  1BRS A;  3NM2 A;  1FUS A;  1M1K 4;  2GXF A;  3FG3 A;  4JF8 A;  1A67 A;  1G02 A;  3OX9 A;  1X1U A;  2XSO B;  2J8X B;  1W01 A;  1Q81 4;  3S29 A;  1IYY A;  1UUW B;  3ZG5 A;  4LZI A;  2P0X A;  3MYT A;  1RN7 A;  3LTC A;  1I2E A;  3VSY A;  1BNG A;  5I97 A;  1VQ8 3;  3RGA A;  1HZ1 A;  4XB5 A;  1B20 A;  2AAE A;  4FMD A;  4HYZ A;  1RGG A;  1HU9 A;  1N8R 4;  3SYU A;  3DGY A;  1AQZ A;  3DGO A;  3WOE B;  2UUG C;  1OGZ A;  1VQM 3;  4XM4 A;  3N8B A;  3K7C A;  1B3S A;  3AGN A;  3OWY A;  3N54 B;  3NQY A;  4L7K A;  1BSC A;  2B1X B;  1IQY A;  2IMJ A;  1K41 A;  3KCH A;  3NBJ A;  4FCJ A;  3RDE A;  3VF1 A;  4HM4 B;  2B24 B;  4HZ9 B;  1GMR A;  4N6V 0;  3AGO A;  1RCK A;  2CC3 A;  1IDP A;  2IYJ A;  3ER7 A;  3MG3 A;  1UUG B;  5EVH A;  3J7Y d;  3F8H A;  1I3F A;  1I2F A;  1VQ7 3;  1QVG 2;  1W02 A;  1SQW A;  1W00 A;  1IQ8 A;  2RGQ A;  2WGQ A;  3D9R A;  1HKX A;  1W4N A;  3BIR A;  1GY5 A;  1JRQ A;  3EC9 A;  4HM6 B;  4CJN A;  1RDS A;  7GSP A;  4GHO A;  1RGH A;  5IF6 A;  1W2Z A;  2AAD A;  3X3X A;  3DMC A;  4GL6 A;  4O02 B;  3KII A;  4O8S A;  1LOW A;  3NHX A;  2UGI A;  1ZGX A;  1ZO2 A;  4WP5 A;  1Y4K A;  3BU4 A;  9RNT A;  3JUN A;  1X1Y A;  1CH0 A;  2QIY A;  2CHC A;  2PZV A;  3D3L A;  1Q7Y 4;  3T8U A;  5LC7 A;  1NWW A;  2BNG A;  2KAA A;  4NHF A;  1FYS A;  1RGE A; 
#chains in the Genus database with same CATH homology
 1GOY A;  1RLS A;  4J5G A;  3AHW A;  1YNV X;  1B2S A;  1FUT A;  4BIR A;  2BIR A;  1BRH A;  1B27 A;  1SAR A;  1BNF A;  5BU4 A;  1T2H A;  2C4B A;  1RN4 A;  1X1W A;  1GOU A;  1B2Z A;  1YGW A;  1FW7 A;  1JBR A;  1BRI A;  1I0V A;  1RSN A;  1JBS A;  1B21 A;  3D4A A;  1BGS A;  1RGL A;  1RGC A;  1HYF A;  1UCJ A;  2KF6 A;  1GSP A;  1DE3 A;  1RGK A;  1FZU A;  1LRA A;  5GSP A;  7RNT A;  1BUJ A;  1DET A;  1BSE A;  1TTO A;  2KF5 A;  2RNT A;  1BVI A;  2KF3 A;  1BRN L;  2GSP A;  1BU4 A;  2BU4 A;  3D5I A;  5RNT A;  1BOX A;  4GSP A;  1MGW A;  2SAR A;  2HOH A;  1BSA A;  1RHL A;  1TRP A;  1B2U A;  2KF4 A;  6GSP A;  1I0X A;  4HOH A;  3GSP A;  1BSD A;  1PY3 A;  1LOY A;  3RNT A;  3DH2 A;  1BNJ A;  3AHS A;  4HAA A;  1I3I A;  1B2M A;  1RNB A;  8RNT A;  3HOH A;  2ZA4 A;  6RNT A;  3A5E A;  1I2G A;  1BRG A;  1BRS A;  1FUS A;  1BIR A;  1I8V A;  1G02 A;  1AY7 A;  1X1U A;  1BSB A;  1RMS A;  1BNE A;  1IYY A;  1T2I A;  3WR2 A;  1JBT A;  2F5W A;  1BRJ A;  5BIR A;  1BRK A;  1C54 A;  1I2E A;  1B2X A;  1BNG A;  1HZ1 A;  4J5K A;  1B20 A;  2AAE A;  1BNS A;  1RGA A;  1A2P A;  1RGG A;  1RCL A;  3SYU A;  3DGY A;  1AQZ A;  1GMQ A;  3WHO A;  4BU4 A;  1B3S A;  1PYL A;  3AGN A;  1BAO A;  1BSC A;  3KCH A;  1LNI A;  1GMR A;  3AGO A;  1RCK A;  1UCL A;  1I70 A;  1I3F A;  1I2F A;  1RTU A;  3URP A;  1BAN A;  7GSP A;  3BIR A;  1RDS A;  4GHO A;  4RNT A;  1RGH A;  1RN1 A;  1R4Y A;  3D5G A;  1BNR A;  2AAD A;  5HOH A;  1UCK A;  1GMP A;  1MGR A;  1BNI A;  1LOW A;  2F56 A;  1ZGX A;  2F5M A;  3BU4 A;  2F4Y A;  1UCI A;  9RNT A;  1X1Y A;  1TRQ A;  1RGF A;  1CH0 A;  1Q9E A;  1YVS A;  2RBI A;  3Q3F A;  1LOV A;  1X1X A;  2KAA A;  1FYS A;  1RNT A;  1GOV A;  1RGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...