1RTUA

Ustilago sphaerogena ribonuclease u2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
113
Chain Sequence
b'CDIPQSTNCGGNVYSNDDINTAIQGALDDVANGDRPDNYPHQYYEASEDITLCCGSGPWSEFPLVYNGPYYSSRDNYVSPGPDRVIYQTNTGEFCATVTHTGAASYDGFTQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE U2
publication title Crystal structure of Ustilago sphaerogena ribonuclease U2 at 1.8 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 29
structure length 113
sequence length 114
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rtuA00
1R4YA 1X1YA 5BU4A 4GSPA 1RGFA 8RNTA 1BRKA 3BIRA 4GHOA 1IYYA 1A2PA 1X1UA 1JBSA 1GOVA 1GOUA 3KCHA 1BGSA 1TRPA 1BAOA 1I3FA 1AY7A 1BRIA 1RGCA 1BRJA 1RN4A 7RNTA 1BNRA 1RNTA 1B27A 3GSPA 1FYSA 1RGEA 1UCLA 3A5EA 1YVSA 2KF4A 1RGLA 3AGNA 2F56A 1B2MA 1Q9EA 1BSCA 1UCKA 2KF3A 4RNTA 4HOHA 1BRGA 1LNIA 4HAAA 2ZA4A 3SYUA 1RN1A 1BSEA 9RNTA 1I8VA 1RGHA 1FUSA 1X1WA 1B2UA 2AADA 1BNSA 1JBTA 1GMPA 2KAAA 1GMQA 3WR2A 5GSPA 2AAEA 5RNTA 1BNFA 3DH2A 1YNVX 1SARA 5HOHA 1FW7A 1I2GA 1LOYA 1B2SA 3AGOA 1I0XA 1RDSA 1RGGA 1GMRA 3RNTA 1BSDA 2HOHA 1PYLA 5BIRA 1BRSA 3AHWA 1B20A 1B21A 2GSPA 1MGWA 1PY3A 1RSNA 3BU4A 1RCKA 3WHOA 2KF5A 1BNEA 1I2EA 1FUTA 1I2FA 1YGWA 2F4YA 1MGRA 3HOHA 1UCJA 1LOWA 3AHSA 1TTOA 1RMSA 1BNJA 1G02A 3DGYA 1B3SA 1T2HA 1BSAA 1BVIA 3URPA 1TRQA 4BIRA 2RBIA 1C54A 1UCIA 1DE3A 2F5MA 1I0VA 1BU4A 1ZGXA 2BIRA 4J5KA 1BNIA 3Q3FA 1DETA 1HZ1A 1T2IA 2RNTA 1I70A 2SARA 1BRHA 1LRAA 1RTUA 3D4AA 1JBRA 1GOYA 2C4BA 1X1XA 1LOVA 1RLSA 3D5IA 1GSPA 4BU4A 1HYFA 1RGAA 1BNGA 1AQZA 1I3IA 1RCLA 1BOXA 2F5WA 1B2XA 1BSBA 1RHLA 1RNBA 1FZUA 6GSPA 1RGKA 6RNTA 1B2ZA 4J5GA 7GSPA 1BRNL 2KF6A 2BU4A 1BIRA 1CH0A 1BANA 3D5GA 1BUJA
chains in the Genus database with same CATH superfamily
1FGRA 2RFRA 4GSPA 4H61A 4EXRA 2W04A 2YFLB 3CC73 3DGMA 4LZIA 8RNTA 1VQ83 3LOYA 4MJDA 2H0IA 3BIRA 4IPBA 4NHFA 4BTWA 1U8CB 3HIIA 4BTYA 1YIJ3 1NO3A 1VQP3 1UI7A 3ALAA 4Q53A 3NV0A 4KFDA 1BGSA 1FGQA 1I3FA 1Q40B 1BUQA 2HMOB 2CFGA 3EC9A 3OWSA 2XFTA 5IEOA 1MWTA 3GSPA 1FYSA 1RGEA 1UCLA 2BO9B 3K63A 1KD14 1RGLA 1VQ93 1VQM3 1QAKA 4L7KA 3LXUX 1NDOB 1BSCA 1ZX2A 2KF3A 4GB5A 4MMZB 5FW5A 4HAAA 1QJGA 1G96A 1Q814 3NBJA 1SPUA 2CX1A 3KZTA 4K90B 1V58A 4TX4A 1NB5I 1ROVA 1BSEA 9RNTA 1S5AA 1FUSA 2FGTA 3UL5A 2K3DA 1HKXA 2ML5A 4O02B 2AADA 4XB5A 1GY7A 2CIUA 1RRHA 1QAFA 3K9MC 3ROBA 3WR2A 5GSPA 4WWUC 2XR8B 1STDA 4G1MB 3UB1A 1FA3A 2CFKA 1FW7A 1OUNA 3FCSB 1GMRA 1K8A4 2HOHA 3DMCA 3KFQC 1UW1A 1UGIA 2UUGC 4XBTA 5D82A 5G2GA 1B21A 1WMOA 2YX9A 3X3ZA 1MGWA 3EBYA 3G713 1QVG2 2CWUA 3FZWA 3CCE3 1PY3A 7STDA 1V57A 4KZ1A 3PCSA 3S29A 2HMMB 2Y74A 3B7CA 1TUHA 2OCTA 1YJ93 2P38A 1O7HB 5CK6A 2MC8A 1BNEA 3FF2A 3MG2A 1I2FA 4NPBA 1YHQ3 1AVKA 3CPW2 3NV0B 1LOWA 1WMPA 3X41A 1RRLA 4HM6B 4MEIA 1RMSA 2QEX3 1N8R4 1YI23 2JDIH 1DMMA 5TGNA 1JN5A 4KT3B 2F98A 3I563 4HM7B 3S5CA 1TIJA 2E2TA 2R41A 1VZZA 1DMQA 4IT7A 3MHEA 4HYZA 1VQK3 1US1A 1VQ43 2OWPA 2O9UX 3V92A 1EG9B 1GY5A 1EUIC 3PGBA 1BRHA 1VQ53 5AEWB 1W6CA 3D4AA 3FKAA 2OOVC 5M19A 3D5IA 5BVBA 3OWYA 1E3RA 1RJOA 3DXOA 5FGOA 3X3XA 3ZG0A 1PU4A 4L8OA 3I0YA 2XGNA 2O3OA 1RCLA 1Y4KA 3D3LA 1TP6A 2CG0A 1VQN3 1EKMA 4EC6A 1LOXA 2B1XB 4N6UA 4XBYA 5M1AA 1RGKA 5IG3A 4KFFA 4MMYB 1OHSA 1MWRA 1UUWB 1Q42A 2XSOB 3CD63 5CF1A 1NJI4 1DYUA 1OHOA 2Q07A 3LT8A 2P0XA 3BB9A 1BUJA 2GEYA 5ELJA 1SIHA 4FR9A 1R4YA 1LXEA 2W2CA 3A76A 3Q90A 5D83A 2HMJB 2CWVA 3WMDA 1CEWI 1BRKA 4BTXA 3F7SA 4N6V0 2P05A 1O7PB 1MOLA 4GHOA 3AMOA 5CXOA 1WTHA 4O3VA 5AIIA 1W6YA 3BLZA 1NU3A 3O8YA 2XF3A 2BMRB 3LZAA 1GOUA 1Q7Y4 2Z76A 1ZO2A 1W4NA 1JN5B 3VSYA 1D6ZA 1F8NA 3BNCA 4ILFA 1B27A 4IIAA 5EEOA 2RGQA 4I5QA 2HMNB 4QWTA 1YVSA 4HM2B 3F8HA 1IK3A 3AGNA 3SVAA 3ER7A 3SOAA 4RNTA 1YVBI 3EJVA 5IG0A 5ELUA 1N8QA 2ZA4A 1Q864 4O2HA 2WO0A 1ROAA 4X2OA 1I8VA 4J9AA 1M9GA 1X1WA 2JQ5A 4STDA 5A0OB 3EHCA 3RGAA 1K41A 4HM1B 2KAAA 2OOVA 3DZLA 4HBRA 3CCV3 3PS8A 3RDEA 2UX0A 1BNFA 2Y73A 1YNVX 1SARA 3DH2A 5HOHA 3UJMA 4KFEA 1RGGA 2GXFA 1PYLA 2WGQA 5BIRA 3AHWA 3GRDA 3NQYA 3CPOA 1TFOA 3GZBA 5M18A 3WOEB 5G1KA 5LC7A 2IY2A 5IG4A 3E99A 1RSNA 3PCRA 3CCU3 1RCKA 2XFSA 1KSIA 3B8LA 1ISKA 1W01A 2IYJA 2KF5A 3MWZA 4N6OB 1I2EA 2CW9A 3AMOB 3WHOA 3WA3A 4WFOA 3FF0A 1W7CA 3CCJ3 1OGXA 1TU5A 1TTOA 4OVMA 2D42A 3QRDA 2CC3A 3MKIA 3JUQA 1B3SA 3ECFA 2CFLA 3K0ZA 3URPA 3PXMA 1JKGA 3Q2PA 1JV2B 1DMNA 1JNQA 2RBIA 2XH9A 1ZS7A 3IPTA 2WOHA 3JUPA 3DY5A 3VGNA 4ZM8A 1YJN3 3NM7A 1WNHA 1A67A 2SARA 1LRAA 4U13A 3FSDA 2GEXA 1CYUA 3UNLA 3VF1A 3CC23 1GOYA 2IUJA 5HGRA 4N6TA 3J7Yd 1GS3A 1HYFA 1RGAA 1BNGA 1ASKA 1NNVA 1AQZA 3NX0A 4HZBB 3DGLA 1RHLA 4BL3A 1W2ZA 3FLJA 4WYKA 3GZRA 3T8UA 1IV7A 2W0QA 3IMAB 1FGMA 1MNLA 2XGLA 3SLUA 4J5GA 4CJNA 7GSPA 1CQSA 2PZVA 2CKFB 5AI1A 4EYCA 3STDA 1LVNA 2BU4A 1BIRA 2IMJA 1KQS2 4EW5A 4XM4A 3OX9A 2F99A 1LQGC 1X1YA 3HI7A 4FCMA 5BU4A 4AKZA 1LNHA 1T5YA 3LYGA 4RNZA 1ULJB 1E3VA 1JJ22 4CPKA 5AYSC 3OV4A 1JB2A 4CCVA 2Z6BA 4AKYA 1IYYA 3NBBA 1X1UA 2IA7A 2J8XB 1SQWA 1MWSA 1J2BA 3OXAA 1GD3A 1JBSA 2YFJB 1GOVA 1RN7A 3KCHA 1JZDA 3EN8A 3ZG5A 2CWTA 1BRIA 1JKGB 1BRJA 1RGCA 2C11A 5EVHA 5KP3A 6STDA 5IG5A 1OHPA 3LMLA 4FCZA 3V99A 7RNTA 1BNRA 1RNTA 3NXJA 4FCJA 1E97A 5I97A 3A5EA 4OK0A 2CFWA 2KF4A 3U97A 2K0MA 5CLKA 1M1K4 1IU7A 1R4CA 2IUKA 1UCKA 3K5TA 1TJDA 4N6LA 1LNIA 1OPYA 4KVHA 1IDPA 3SX1A 3MSOA 3CNMA 2W56A 3WDGB 4O8SA 4HZ9B 3SYUA 1N9JA 3X40A 1V74A 1RGHA 1LQMB 4ORLA 1SIIA 3LTCA 3CMA3 4AEQA 3KN4A 2V1LA 2W9PA 4HM5B 4MMXB 1B2UA 2PNCA 1EEJA 1GMPA 2ML6A 4R1KA 2F86B 2LYXA 4WYKB 1W6GA 1IVUA 1AV4A 2E2UA 5D81A 2BMOB 4N3VA 1LOYA 1B2SA 2OTL3 1RDSA 3RNTA 3LTAA 1CYVA 3CCR3 2XEPA 3EE1A 4EV2A 3SOYA 2GBWB 5JPUA 1B20A 5LC6A 1VQL3 2GSPA 2Z7AA 1C7HA 1JZOA 1DVCA 3FG3A 1YJW3 3EQQB 2P09A 3BNBA 2C10A 3BU4A 4HKVB 3F8XA 2MF7A 4R9KA 3CCS3 1FUTA 2CH9A 1YGWA 1T3BA 3L0RA 3HOHA 1A2VA 1UCJA 3JVCA 3AHSA 3LT9A 4HM8B 5DREA 3GWRA 4BL2A 3HK4A 3KKGA 3MYTA 2I9WA 1D6UA 3NQZA 1BNJA 1G02A 1A2KA 1O7GB 3DGYA 4XBXA 5KP1A 5KP4A 3KE7A 2INXA 3QK9A 3G6E3 1BSAA 1FGTA 4XDWA 1TRQA 4I4KA 3U1WA 4BIRA 1O7WB 3CNXA 1AVLA 3NBRA 1OCVA 1UCIA 2F5MA 1I0VA 1BU4A 1W5ZA 2BIRA 3GZXB 3SEDA 4J5KA 1N5HA 1BNIA 1HZ1A 1T2IA 2RNTA 3DGNA 4FMAA 3IJEB 2P0MA 3D79A 1I70A 4LMIA 2W56B 1IQYA 1IVXA 1QVF2 1QMAA 2BT3A 2OTJ3 3MG1A 1OH0A 3OW22 1X1XA 3UL6A 2UGIA 1DVDA 4HM4B 1FGOA 4HJLB 4BU4A 2FXTA 4N6NB 1PFPA 1BOXA 1JB5A 3V98A 4DKIA 3N8BA 4H3UA 3JUOA 3NUVA 3TDGA 4RZMA 5AIFA 1EQKA 1IV9A 4J8TA 4K61A 4LYLB 6GSPA 1IQXA 3F9SA 3FH1A 1B2ZA 3FG1A 1VQ63 5AIHA 1W00A 1BRNL 2Z77A 5G1LA 5AYRB 1OF5A 2CHCA 4LGQA 1HU9A 1CH0A 1BANA 3LH4A 3D5GA 1IT7A 8CHOA 3DM8A 3B4PA 1STFI 5AIGA 1RGFA 2STDA 2RSXA 5IERA 1SJWA 3SXXA 2KRTA 2XRXB 3G0KA 3FGYA 4JRFA 3CXC2 1VQQA 3GZYB 1A2PA 1M1XB 1N9EA 3PZWA 5JBSA 3EX9A 3WODG 4X2HA 4LEHA 1UI8A 2XSHB 3KIIA 1OGZA 3S27A 1S723 1KWIA 1TRPA 4CDLA 1EA2A 1JRQA 1BAOA 3F14A 3LTDA 1Z1SA 1AY7A 2BMQB 3PYJA 1RN4A 2W6JH 2RCDA 5AEUB 5IEPA 4K1UA 3EB8A 2OQEC 5JPPA 1K734 2E2VA 1O7NB 3K7CA 1RKYA 1YIT3 3H51A 3CCQ3 2F56A 2GBXB 2ZDJA 1B2MA 1Q9EA 1IT8A 2KXGA 4HOHA 3X3YA 2GU3A 1BRGA 1UUGB 1NWWA 3I553 4NREA 3BNDA 3CME3 2ZHXB 2WOFA 3T8NA 3Q1CA 1RN1A 3G8ZA 4FMBA 5CF2A 3ZFZA 1OACA 1UDII 1ULIB 1L5GB 3HIGA 3OWUA 1M904 3KSPA 1BNSA 4FMDA 1JBTA 1KC84 1IQ8A 1U5OA 3CCL3 1GMQA 2CX0A 2L1SA 3N9HA 3JUNA 4RBNA 3N54B 3DUKA 1K28A 2W03A 1TFKA 2AAEA 4N6MA 5RNTA 3MG3A 1I2GA 4GL6A 3AGOA 1W02A 4R9LA 1I0XA 1O7MB 5IW9A 1VQO3 1BSDA 1OF5B 3B4OA 1BRSA 4EBGA 4WHAA 2BHMA 3EBTA 3GAXA 2GU1A 2KCDA 1VQ73 4LSOA 3H3HA 1AR0A 3RGRA 3CCM3 1YGEA 2H0HA 3WA2X 5IENA 4HM3B 2F4YA 1MGRA 3HZPA 1WMNA 4R4KA 3G16A 3MPHA 3WOFB 2D1WA 3DGOA 2W9QA 1GYBA 1Q7HA 2B24B 3D9RA 1N5PA 2ZL8A 2H0GA 3EN1B 3M8CA 5STDA 1T2HA 3T0UA 2CFDA 1Q40A 2BNGA 1BVIA 1IVVA 3FG4A 3S28A 5BXQA 1MWUA 3CU3A 4RNYA 1GD4A 5DRVA 1C54A 1D6YA 4WP5A 1A90A 3EF8A 2QIYA 3G4S3 2M7OA 1DE3A 3BNEA 3NHXA 1UUVB 1ZGXA 1K9M4 3Q3FA 1NB3I 1DETA 4K1VA 1G0TA 3LTBA 2OQEA 4EV5A 2R4IA 1QALA 3X42A 1RTUA 1UGHI 2LQVA 1IVWA 4OUQA 1WQLB 4FMCA 1JBRA 2HMLB 2C4BA 1JB4A 1LOVA 1RLSA 2QGUA 1GSPA 2K54A 2CK3H 3CC43 4L8PA 2F5WA 1I3IA 3KSED 4JF8A 1B2XA 1BSBA 2QA43 2SBLA 2HMKB 3HX8A 3NM2A 1RNBA 2A15A 2WGOA 1FZUA 6RNTA 4R80A 1GY6A 1Q824 2L4VA 1W2B2 1FUWA 4HM0B 3S67A 2CG1A 2KF6A 2YFIB 3JUMA 2FNQA 5EQLA 3F40A 3F7XA 5IF6A 4XDVA 4PEJA 4HVNA
chains in the Genus database with same CATH topology
1R4YA 1X1YA 5BU4A 4GSPA 1RGFA 8RNTA 1BRKA 3BIRA 4GHOA 1IYYA 1A2PA 1X1UA 1JBSA 1GOVA 1GOUA 3KCHA 1BGSA 1TRPA 1BAOA 1I3FA 1AY7A 1BRIA 1RGCA 1BRJA 1RN4A 7RNTA 1BNRA 1RNTA 1B27A 3GSPA 1FYSA 1RGEA 1UCLA 3A5EA 1YVSA 2KF4A 1RGLA 3AGNA 2F56A 1B2MA 1Q9EA 1BSCA 1UCKA 2KF3A 4RNTA 4HOHA 1BRGA 1LNIA 4HAAA 2ZA4A 3SYUA 1RN1A 1BSEA 9RNTA 1I8VA 1RGHA 1FUSA 1X1WA 1B2UA 2AADA 1BNSA 1JBTA 1GMPA 2KAAA 1GMQA 3WR2A 5GSPA 2AAEA 5RNTA 1BNFA 3DH2A 1YNVX 1SARA 5HOHA 1FW7A 1I2GA 1LOYA 1B2SA 3AGOA 1I0XA 1RDSA 1RGGA 1GMRA 3RNTA 1BSDA 2HOHA 1PYLA 5BIRA 1BRSA 3AHWA 1B20A 1B21A 2GSPA 1MGWA 1PY3A 1RSNA 3BU4A 1RCKA 3WHOA 2KF5A 1BNEA 1I2EA 1FUTA 1I2FA 1YGWA 2F4YA 1MGRA 3HOHA 1UCJA 1LOWA 3AHSA 1TTOA 1RMSA 1BNJA 1G02A 3DGYA 1B3SA 1T2HA 1BSAA 1BVIA 3URPA 1TRQA 4BIRA 2RBIA 1C54A 1UCIA 1DE3A 2F5MA 1I0VA 1BU4A 1ZGXA 2BIRA 4J5KA 1BNIA 3Q3FA 1DETA 1HZ1A 1T2IA 2RNTA 1I70A 2SARA 1BRHA 1LRAA 1RTUA 3D4AA 1JBRA 1GOYA 2C4BA 1X1XA 1LOVA 1RLSA 3D5IA 1GSPA 4BU4A 1HYFA 1RGAA 1BNGA 1AQZA 1I3IA 1RCLA 1BOXA 2F5WA 1B2XA 1BSBA 1RHLA 1RNBA 1FZUA 6GSPA 1RGKA 6RNTA 1B2ZA 4J5GA 7GSPA 1BRNL 2KF6A 2BU4A 1BIRA 1CH0A 1BANA 3D5GA 1BUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Y A;  1X1Y A;  5BU4 A;  4GSP A;  1RGF A;  8RNT A;  1BRK A;  3BIR A;  4GHO A;  1IYY A;  1A2P A;  1X1U A;  1JBS A;  1GOV A;  1GOU A;  3KCH A;  1BGS A;  1TRP A;  1BAO A;  1I3F A;  1AY7 A;  1BRI A;  1RGC A;  1BRJ A;  1RN4 A;  7RNT A;  1BNR A;  1RNT A;  1B27 A;  3GSP A;  1FYS A;  1RGE A;  1UCL A;  3A5E A;  1YVS A;  2KF4 A;  1RGL A;  3AGN A;  2F56 A;  1B2M A;  1Q9E A;  1BSC A;  1UCK A;  2KF3 A;  4RNT A;  4HOH A;  1BRG A;  1LNI A;  4HAA A;  2ZA4 A;  3SYU A;  1RN1 A;  1BSE A;  9RNT A;  1I8V A;  1RGH A;  1FUS A;  1X1W A;  1B2U A;  2AAD A;  1BNS A;  1JBT A;  1GMP A;  2KAA A;  1GMQ A;  3WR2 A;  5GSP A;  2AAE A;  5RNT A;  1BNF A;  3DH2 A;  1YNV X;  1SAR A;  5HOH A;  1FW7 A;  1I2G A;  1LOY A;  1B2S A;  3AGO A;  1I0X A;  1RDS A;  1RGG A;  1GMR A;  3RNT A;  1BSD A;  2HOH A;  1PYL A;  5BIR A;  1BRS A;  3AHW A;  1B20 A;  1B21 A;  2GSP A;  1MGW A;  1PY3 A;  1RSN A;  3BU4 A;  1RCK A;  3WHO A;  2KF5 A;  1BNE A;  1I2E A;  1FUT A;  1I2F A;  1YGW A;  2F4Y A;  1MGR A;  3HOH A;  1UCJ A;  1LOW A;  3AHS A;  1TTO A;  1RMS A;  1BNJ A;  1G02 A;  3DGY A;  1B3S A;  1T2H A;  1BSA A;  1BVI A;  3URP A;  1TRQ A;  4BIR A;  2RBI A;  1C54 A;  1UCI A;  1DE3 A;  2F5M A;  1I0V A;  1BU4 A;  1ZGX A;  2BIR A;  4J5K A;  1BNI A;  3Q3F A;  1DET A;  1HZ1 A;  1T2I A;  2RNT A;  1I70 A;  2SAR A;  1BRH A;  1LRA A;  1RTU A;  3D4A A;  1JBR A;  1GOY A;  2C4B A;  1X1X A;  1LOV A;  1RLS A;  3D5I A;  1GSP A;  4BU4 A;  1HYF A;  1RGA A;  1BNG A;  1AQZ A;  1I3I A;  1RCL A;  1BOX A;  2F5W A;  1B2X A;  1BSB A;  1RHL A;  1RNB A;  1FZU A;  6GSP A;  1RGK A;  6RNT A;  1B2Z A;  4J5G A;  7GSP A;  1BRN L;  2KF6 A;  2BU4 A;  1BIR A;  1CH0 A;  1BAN A;  3D5G A;  1BUJ A; 
#chains in the Genus database with same CATH topology
 1FGR A;  2RFR A;  4GSP A;  4H61 A;  4EXR A;  2W04 A;  2YFL B;  3CC7 3;  3DGM A;  4LZI A;  8RNT A;  1VQ8 3;  3LOY A;  4MJD A;  2H0I A;  3BIR A;  4IPB A;  4NHF A;  4BTW A;  1U8C B;  3HII A;  4BTY A;  1YIJ 3;  1NO3 A;  1VQP 3;  1UI7 A;  3ALA A;  4Q53 A;  3NV0 A;  4KFD A;  1BGS A;  1FGQ A;  1I3F A;  1Q40 B;  1BUQ A;  2HMO B;  2CFG A;  3EC9 A;  3OWS A;  2XFT A;  5IEO A;  1MWT A;  3GSP A;  1FYS A;  1RGE A;  1UCL A;  2BO9 B;  3K63 A;  1KD1 4;  1RGL A;  1VQ9 3;  1VQM 3;  1QAK A;  4L7K A;  3LXU X;  1NDO B;  1BSC A;  1ZX2 A;  2KF3 A;  4GB5 A;  4MMZ B;  5FW5 A;  4HAA A;  1QJG A;  1G96 A;  1Q81 4;  3NBJ A;  1SPU A;  2CX1 A;  3KZT A;  4K90 B;  1V58 A;  4TX4 A;  1NB5 I;  1ROV A;  1BSE A;  9RNT A;  1S5A A;  1FUS A;  2FGT A;  3UL5 A;  2K3D A;  1HKX A;  2ML5 A;  4O02 B;  2AAD A;  4XB5 A;  1GY7 A;  2CIU A;  1RRH A;  1QAF A;  3K9M C;  3ROB A;  3WR2 A;  5GSP A;  4WWU C;  2XR8 B;  1STD A;  4G1M B;  3UB1 A;  1FA3 A;  2CFK A;  1FW7 A;  1OUN A;  3FCS B;  1GMR A;  1K8A 4;  2HOH A;  3DMC A;  3KFQ C;  1UW1 A;  1UGI A;  2UUG C;  4XBT A;  5D82 A;  5G2G A;  1B21 A;  1WMO A;  2YX9 A;  3X3Z A;  1MGW A;  3EBY A;  3G71 3;  1QVG 2;  2CWU A;  3FZW A;  3CCE 3;  1PY3 A;  7STD A;  1V57 A;  4KZ1 A;  3PCS A;  3S29 A;  2HMM B;  2Y74 A;  3B7C A;  1TUH A;  2OCT A;  1YJ9 3;  2P38 A;  1O7H B;  5CK6 A;  2MC8 A;  1BNE A;  3FF2 A;  3MG2 A;  1I2F A;  4NPB A;  1YHQ 3;  1AVK A;  3CPW 2;  3NV0 B;  1LOW A;  1WMP A;  3X41 A;  1RRL A;  4HM6 B;  4MEI A;  1RMS A;  2QEX 3;  1N8R 4;  1YI2 3;  2JDI H;  1DMM A;  5TGN A;  1JN5 A;  4KT3 B;  2F98 A;  3I56 3;  4HM7 B;  3S5C A;  1TIJ A;  2E2T A;  2R41 A;  1VZZ A;  1DMQ A;  4IT7 A;  3MHE A;  4HYZ A;  1VQK 3;  1US1 A;  1VQ4 3;  2OWP A;  2O9U X;  3V92 A;  1EG9 B;  1GY5 A;  1EUI C;  3PGB A;  1BRH A;  1VQ5 3;  5AEW B;  1W6C A;  3D4A A;  3FKA A;  2OOV C;  5M19 A;  3D5I A;  5BVB A;  3OWY A;  1E3R A;  1RJO A;  3DXO A;  5FGO A;  3X3X A;  3ZG0 A;  1PU4 A;  4L8O A;  3I0Y A;  2XGN A;  2O3O A;  1RCL A;  1Y4K A;  3D3L A;  1TP6 A;  2CG0 A;  1VQN 3;  1EKM A;  4EC6 A;  1LOX A;  2B1X B;  4N6U A;  4XBY A;  5M1A A;  1RGK A;  5IG3 A;  4KFF A;  4MMY B;  1OHS A;  1MWR A;  1UUW B;  1Q42 A;  2XSO B;  3CD6 3;  5CF1 A;  1NJI 4;  1DYU A;  1OHO A;  2Q07 A;  3LT8 A;  2P0X A;  3BB9 A;  1BUJ A;  2GEY A;  5ELJ A;  1SIH A;  4FR9 A;  1R4Y A;  1LXE A;  2W2C A;  3A76 A;  3Q90 A;  5D83 A;  2HMJ B;  2CWV A;  3WMD A;  1CEW I;  1BRK A;  4BTX A;  3F7S A;  4N6V 0;  2P05 A;  1O7P B;  1MOL A;  4GHO A;  3AMO A;  5CXO A;  1WTH A;  4O3V A;  5AII A;  1W6Y A;  3BLZ A;  1NU3 A;  3O8Y A;  2XF3 A;  2BMR B;  3LZA A;  1GOU A;  1Q7Y 4;  2Z76 A;  1ZO2 A;  1W4N A;  1JN5 B;  3VSY A;  1D6Z A;  1F8N A;  3BNC A;  4ILF A;  1B27 A;  4IIA A;  5EEO A;  2RGQ A;  4I5Q A;  2HMN B;  4QWT A;  1YVS A;  4HM2 B;  3F8H A;  1IK3 A;  3AGN A;  3SVA A;  3ER7 A;  3SOA A;  4RNT A;  1YVB I;  3EJV A;  5IG0 A;  5ELU A;  1N8Q A;  2ZA4 A;  1Q86 4;  4O2H A;  2WO0 A;  1ROA A;  4X2O A;  1I8V A;  4J9A A;  1M9G A;  1X1W A;  2JQ5 A;  4STD A;  5A0O B;  3EHC A;  3RGA A;  1K41 A;  4HM1 B;  2KAA A;  2OOV A;  3DZL A;  4HBR A;  3CCV 3;  3PS8 A;  3RDE A;  2UX0 A;  1BNF A;  2Y73 A;  1YNV X;  1SAR A;  3DH2 A;  5HOH A;  3UJM A;  4KFE A;  1RGG A;  2GXF A;  1PYL A;  2WGQ A;  5BIR A;  3AHW A;  3GRD A;  3NQY A;  3CPO A;  1TFO A;  3GZB A;  5M18 A;  3WOE B;  5G1K A;  5LC7 A;  2IY2 A;  5IG4 A;  3E99 A;  1RSN A;  3PCR A;  3CCU 3;  1RCK A;  2XFS A;  1KSI A;  3B8L A;  1ISK A;  1W01 A;  2IYJ A;  2KF5 A;  3MWZ A;  4N6O B;  1I2E A;  2CW9 A;  3AMO B;  3WHO A;  3WA3 A;  4WFO A;  3FF0 A;  1W7C A;  3CCJ 3;  1OGX A;  1TU5 A;  1TTO A;  4OVM A;  2D42 A;  3QRD A;  2CC3 A;  3MKI A;  3JUQ A;  1B3S A;  3ECF A;  2CFL A;  3K0Z A;  3URP A;  3PXM A;  1JKG A;  3Q2P A;  1JV2 B;  1DMN A;  1JNQ A;  2RBI A;  2XH9 A;  1ZS7 A;  3IPT A;  2WOH A;  3JUP A;  3DY5 A;  3VGN A;  4ZM8 A;  1YJN 3;  3NM7 A;  1WNH A;  1A67 A;  2SAR A;  1LRA A;  4U13 A;  3FSD A;  2GEX A;  1CYU A;  3UNL A;  3VF1 A;  3CC2 3;  1GOY A;  2IUJ A;  5HGR A;  4N6T A;  3J7Y d;  1GS3 A;  1HYF A;  1RGA A;  1BNG A;  1ASK A;  1NNV A;  1AQZ A;  3NX0 A;  4HZB B;  3DGL A;  1RHL A;  4BL3 A;  1W2Z A;  3FLJ A;  4WYK A;  3GZR A;  3T8U A;  1IV7 A;  2W0Q A;  3IMA B;  1FGM A;  1MNL A;  2XGL A;  3SLU A;  4J5G A;  4CJN A;  7GSP A;  1CQS A;  2PZV A;  2CKF B;  5AI1 A;  4EYC A;  3STD A;  1LVN A;  2BU4 A;  1BIR A;  2IMJ A;  1KQS 2;  4EW5 A;  4XM4 A;  3OX9 A;  2F99 A;  1LQG C;  1X1Y A;  3HI7 A;  4FCM A;  5BU4 A;  4AKZ A;  1LNH A;  1T5Y A;  3LYG A;  4RNZ A;  1ULJ B;  1E3V A;  1JJ2 2;  4CPK A;  5AYS C;  3OV4 A;  1JB2 A;  4CCV A;  2Z6B A;  4AKY A;  1IYY A;  3NBB A;  1X1U A;  2IA7 A;  2J8X B;  1SQW A;  1MWS A;  1J2B A;  3OXA A;  1GD3 A;  1JBS A;  2YFJ B;  1GOV A;  1RN7 A;  3KCH A;  1JZD A;  3EN8 A;  3ZG5 A;  2CWT A;  1BRI A;  1JKG B;  1BRJ A;  1RGC A;  2C11 A;  5EVH A;  5KP3 A;  6STD A;  5IG5 A;  1OHP A;  3LML A;  4FCZ A;  3V99 A;  7RNT A;  1BNR A;  1RNT A;  3NXJ A;  4FCJ A;  1E97 A;  5I97 A;  3A5E A;  4OK0 A;  2CFW A;  2KF4 A;  3U97 A;  2K0M A;  5CLK A;  1M1K 4;  1IU7 A;  1R4C A;  2IUK A;  1UCK A;  3K5T A;  1TJD A;  4N6L A;  1LNI A;  1OPY A;  4KVH A;  1IDP A;  3SX1 A;  3MSO A;  3CNM A;  2W56 A;  3WDG B;  4O8S A;  4HZ9 B;  3SYU A;  1N9J A;  3X40 A;  1V74 A;  1RGH A;  1LQM B;  4ORL A;  1SII A;  3LTC A;  3CMA 3;  4AEQ A;  3KN4 A;  2V1L A;  2W9P A;  4HM5 B;  4MMX B;  1B2U A;  2PNC A;  1EEJ A;  1GMP A;  2ML6 A;  4R1K A;  2F86 B;  2LYX A;  4WYK B;  1W6G A;  1IVU A;  1AV4 A;  2E2U A;  5D81 A;  2BMO B;  4N3V A;  1LOY A;  1B2S A;  2OTL 3;  1RDS A;  3RNT A;  3LTA A;  1CYV A;  3CCR 3;  2XEP A;  3EE1 A;  4EV2 A;  3SOY A;  2GBW B;  5JPU A;  1B20 A;  5LC6 A;  1VQL 3;  2GSP A;  2Z7A A;  1C7H A;  1JZO A;  1DVC A;  3FG3 A;  1YJW 3;  3EQQ B;  2P09 A;  3BNB A;  2C10 A;  3BU4 A;  4HKV B;  3F8X A;  2MF7 A;  4R9K A;  3CCS 3;  1FUT A;  2CH9 A;  1YGW A;  1T3B A;  3L0R A;  3HOH A;  1A2V A;  1UCJ A;  3JVC A;  3AHS A;  3LT9 A;  4HM8 B;  5DRE A;  3GWR A;  4BL2 A;  3HK4 A;  3KKG A;  3MYT A;  2I9W A;  1D6U A;  3NQZ A;  1BNJ A;  1G02 A;  1A2K A;  1O7G B;  3DGY A;  4XBX A;  5KP1 A;  5KP4 A;  3KE7 A;  2INX A;  3QK9 A;  3G6E 3;  1BSA A;  1FGT A;  4XDW A;  1TRQ A;  4I4K A;  3U1W A;  4BIR A;  1O7W B;  3CNX A;  1AVL A;  3NBR A;  1OCV A;  1UCI A;  2F5M A;  1I0V A;  1BU4 A;  1W5Z A;  2BIR A;  3GZX B;  3SED A;  4J5K A;  1N5H A;  1BNI A;  1HZ1 A;  1T2I A;  2RNT A;  3DGN A;  4FMA A;  3IJE B;  2P0M A;  3D79 A;  1I70 A;  4LMI A;  2W56 B;  1IQY A;  1IVX A;  1QVF 2;  1QMA A;  2BT3 A;  2OTJ 3;  3MG1 A;  1OH0 A;  3OW2 2;  1X1X A;  3UL6 A;  2UGI A;  1DVD A;  4HM4 B;  1FGO A;  4HJL B;  4BU4 A;  2FXT A;  4N6N B;  1PFP A;  1BOX A;  1JB5 A;  3V98 A;  4DKI A;  3N8B A;  4H3U A;  3JUO A;  3NUV A;  3TDG A;  4RZM A;  5AIF A;  1EQK A;  1IV9 A;  4J8T A;  4K61 A;  4LYL B;  6GSP A;  1IQX A;  3F9S A;  3FH1 A;  1B2Z A;  3FG1 A;  1VQ6 3;  5AIH A;  1W00 A;  1BRN L;  2Z77 A;  5G1L A;  5AYR B;  1OF5 A;  2CHC A;  4LGQ A;  1HU9 A;  1CH0 A;  1BAN A;  3LH4 A;  3D5G A;  1IT7 A;  8CHO A;  3DM8 A;  3B4P A;  1STF I;  5AIG A;  1RGF A;  2STD A;  2RSX A;  5IER A;  1SJW A;  3SXX A;  2KRT A;  2XRX B;  3G0K A;  3FGY A;  4JRF A;  3CXC 2;  1VQQ A;  3GZY B;  1A2P A;  1M1X B;  1N9E A;  3PZW A;  5JBS A;  3EX9 A;  3WOD G;  4X2H A;  4LEH A;  1UI8 A;  2XSH B;  3KII A;  1OGZ A;  3S27 A;  1S72 3;  1KWI A;  1TRP A;  4CDL A;  1EA2 A;  1JRQ A;  1BAO A;  3F14 A;  3LTD A;  1Z1S A;  1AY7 A;  2BMQ B;  3PYJ A;  1RN4 A;  2W6J H;  2RCD A;  5AEU B;  5IEP A;  4K1U A;  3EB8 A;  2OQE C;  5JPP A;  1K73 4;  2E2V A;  1O7N B;  3K7C A;  1RKY A;  1YIT 3;  3H51 A;  3CCQ 3;  2F56 A;  2GBX B;  2ZDJ A;  1B2M A;  1Q9E A;  1IT8 A;  2KXG A;  4HOH A;  3X3Y A;  2GU3 A;  1BRG A;  1UUG B;  1NWW A;  3I55 3;  4NRE A;  3BND A;  3CME 3;  2ZHX B;  2WOF A;  3T8N A;  3Q1C A;  1RN1 A;  3G8Z A;  4FMB A;  5CF2 A;  3ZFZ A;  1OAC A;  1UDI I;  1ULI B;  1L5G B;  3HIG A;  3OWU A;  1M90 4;  3KSP A;  1BNS A;  4FMD A;  1JBT A;  1KC8 4;  1IQ8 A;  1U5O A;  3CCL 3;  1GMQ A;  2CX0 A;  2L1S A;  3N9H A;  3JUN A;  4RBN A;  3N54 B;  3DUK A;  1K28 A;  2W03 A;  1TFK A;  2AAE A;  4N6M A;  5RNT A;  3MG3 A;  1I2G A;  4GL6 A;  3AGO A;  1W02 A;  4R9L A;  1I0X A;  1O7M B;  5IW9 A;  1VQO 3;  1BSD A;  1OF5 B;  3B4O A;  1BRS A;  4EBG A;  4WHA A;  2BHM A;  3EBT A;  3GAX A;  2GU1 A;  2KCD A;  1VQ7 3;  4LSO A;  3H3H A;  1AR0 A;  3RGR A;  3CCM 3;  1YGE A;  2H0H A;  3WA2 X;  5IEN A;  4HM3 B;  2F4Y A;  1MGR A;  3HZP A;  1WMN A;  4R4K A;  3G16 A;  3MPH A;  3WOF B;  2D1W A;  3DGO A;  2W9Q A;  1GYB A;  1Q7H A;  2B24 B;  3D9R A;  1N5P A;  2ZL8 A;  2H0G A;  3EN1 B;  3M8C A;  5STD A;  1T2H A;  3T0U A;  2CFD A;  1Q40 A;  2BNG A;  1BVI A;  1IVV A;  3FG4 A;  3S28 A;  5BXQ A;  1MWU A;  3CU3 A;  4RNY A;  1GD4 A;  5DRV A;  1C54 A;  1D6Y A;  4WP5 A;  1A90 A;  3EF8 A;  2QIY A;  3G4S 3;  2M7O A;  1DE3 A;  3BNE A;  3NHX A;  1UUV B;  1ZGX A;  1K9M 4;  3Q3F A;  1NB3 I;  1DET A;  4K1V A;  1G0T A;  3LTB A;  2OQE A;  4EV5 A;  2R4I A;  1QAL A;  3X42 A;  1RTU A;  1UGH I;  2LQV A;  1IVW A;  4OUQ A;  1WQL B;  4FMC A;  1JBR A;  2HML B;  2C4B A;  1JB4 A;  1LOV A;  1RLS A;  2QGU A;  1GSP A;  2K54 A;  2CK3 H;  3CC4 3;  4L8P A;  2F5W A;  1I3I A;  3KSE D;  4JF8 A;  1B2X A;  1BSB A;  2QA4 3;  2SBL A;  2HMK B;  3HX8 A;  3NM2 A;  1RNB A;  2A15 A;  2WGO A;  1FZU A;  6RNT A;  4R80 A;  1GY6 A;  1Q82 4;  2L4V A;  1W2B 2;  1FUW A;  4HM0 B;  3S67 A;  2CG1 A;  2KF6 A;  2YFI B;  3JUM A;  2FNQ A;  5EQL A;  3F40 A;  3F7X A;  5IF6 A;  4XDV A;  4PEJ A;  4HVN A; 
#chains in the Genus database with same CATH homology
 1R4Y A;  1X1Y A;  5BU4 A;  4GSP A;  1RGF A;  8RNT A;  1BRK A;  3BIR A;  4GHO A;  1IYY A;  1A2P A;  1X1U A;  1JBS A;  1GOV A;  1GOU A;  3KCH A;  1BGS A;  1TRP A;  1BAO A;  1I3F A;  1AY7 A;  1BRI A;  1RGC A;  1BRJ A;  1RN4 A;  7RNT A;  1BNR A;  1RNT A;  1B27 A;  3GSP A;  1FYS A;  1RGE A;  1UCL A;  3A5E A;  1YVS A;  2KF4 A;  1RGL A;  3AGN A;  2F56 A;  1B2M A;  1Q9E A;  1BSC A;  1UCK A;  2KF3 A;  4RNT A;  4HOH A;  1BRG A;  1LNI A;  4HAA A;  2ZA4 A;  3SYU A;  1RN1 A;  1BSE A;  9RNT A;  1I8V A;  1RGH A;  1FUS A;  1X1W A;  1B2U A;  2AAD A;  1BNS A;  1JBT A;  1GMP A;  2KAA A;  1GMQ A;  3WR2 A;  5GSP A;  2AAE A;  5RNT A;  1BNF A;  3DH2 A;  1YNV X;  1SAR A;  5HOH A;  1FW7 A;  1I2G A;  1LOY A;  1B2S A;  3AGO A;  1I0X A;  1RDS A;  1RGG A;  1GMR A;  3RNT A;  1BSD A;  2HOH A;  1PYL A;  5BIR A;  1BRS A;  3AHW A;  1B20 A;  1B21 A;  2GSP A;  1MGW A;  1PY3 A;  1RSN A;  3BU4 A;  1RCK A;  3WHO A;  2KF5 A;  1BNE A;  1I2E A;  1FUT A;  1I2F A;  1YGW A;  2F4Y A;  1MGR A;  3HOH A;  1UCJ A;  1LOW A;  3AHS A;  1TTO A;  1RMS A;  1BNJ A;  1G02 A;  3DGY A;  1B3S A;  1T2H A;  1BSA A;  1BVI A;  3URP A;  1TRQ A;  4BIR A;  2RBI A;  1C54 A;  1UCI A;  1DE3 A;  2F5M A;  1I0V A;  1BU4 A;  1ZGX A;  2BIR A;  4J5K A;  1BNI A;  3Q3F A;  1DET A;  1HZ1 A;  1T2I A;  2RNT A;  1I70 A;  2SAR A;  1BRH A;  1LRA A;  1RTU A;  3D4A A;  1JBR A;  1GOY A;  2C4B A;  1X1X A;  1LOV A;  1RLS A;  3D5I A;  1GSP A;  4BU4 A;  1HYF A;  1RGA A;  1BNG A;  1AQZ A;  1I3I A;  1RCL A;  1BOX A;  2F5W A;  1B2X A;  1BSB A;  1RHL A;  1RNB A;  1FZU A;  6GSP A;  1RGK A;  6RNT A;  1B2Z A;  4J5G A;  7GSP A;  1BRN L;  2KF6 A;  2BU4 A;  1BIR A;  1CH0 A;  1BAN A;  3D5G A;  1BUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...