1RTUA

Ustilago sphaerogena ribonuclease u2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
113
Chain Sequence
b'CDIPQSTNCGGNVYSNDDINTAIQGALDDVANGDRPDNYPHQYYEASEDITLCCGSGPWSEFPLVYNGPYYSSRDNYVSPGPDRVIYQTNTGEFCATVTHTGAASYDGFTQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE U2
molecule tags Hydrolase
publication title Crystal structure of Ustilago sphaerogena ribonuclease U2 at 1.8 A resolution.
pubmed doi rcsb
total genus 29
structure length 113
sequence length 114
ec nomenclature
pdb deposition date 1995-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rtuA00
1B2XA 1BIRA 1B21A 1CH0A 1BSAA 2KF4A 4BIRA 1GOUA 1I2FA 1I2GA 2AADA 4J5KA 1BNJA 1X1WA 1R4YA 1BAOA 3DH2A 1RNTA 1YNVX 2GSPA 3D5GA 4GHOA 1BNEA 1GMRA 4HAAA 1I8VA 1YVSA 1Q9EA 1JBRA 3DGYA 2BU4A 1DETA 1G02A 6RNTA 3AHSA 1BRKA 1UCLA 4GSPA 4J5GA 3WR2A 4HOHA 7RNTA 1RNBA 3GSPA 1B2UA 1LOWA 1BRSA 1B3SA 1HZ1A 1PYLA 1GSPA 1MGRA 1BUJA 1I2EA 5BIRA 1BRGA 5GSPA 1RCLA 2C4BA 1X1YA 2RNTA 1BNFA 3WHOA 1BRNL 1TRPA 1BANA 1RMSA 1FZUA 1B2MA 1RGLA 1AQZA 1B27A 1RGKA 1RSNA 1IYYA 2HOHA 1UCIA 9RNTA 1YGWA 1LRAA 1T2HA 1RGFA 1RGHA 2BIRA 1FW7A 1UCJA 1X1UA 1I70A 3HOHA 1RDSA 8RNTA 1BSBA 1B2ZA 2KF6A 1JBSA 1LOYA 1C54A 1I0VA 3BIRA 1AY7A 2F56A 1TTOA 3D5IA 3A5EA 1B2SA 1GOVA 1GOYA 1RN1A 3SYUA 5RNTA 3BU4A 2ZA4A 5BU4A 1JBTA 2F4YA 1BU4A 1FUTA 1UCKA 7GSPA 2KAAA 2KF5A 2F5MA 1BSCA 1ZGXA 1RGGA 1T2IA 3RNTA 1I0XA 6GSPA 1BNSA 1BNGA 3D4AA 1I3FA 1B20A 1A2PA 2AAEA 5HOHA 3AHWA 1I3IA 1BNIA 1RTUA 1BSDA 1HYFA 1GMPA 3AGNA 1PY3A 1SARA 3URPA 2F5WA 4BU4A 1BVIA 2RBIA 2KF3A 1LOVA 3KCHA 1BGSA 1RGAA 1BRJA 3AGOA 1RGEA 1BRIA 1TRQA 1LNIA 1RN4A 2SARA 4RNTA 1FUSA 1FYSA 3Q3FA 1BNRA 1BSEA 1BOXA 1BRHA 1RLSA 1RHLA 1DE3A 1X1XA 1GMQA 1RGCA 1MGWA 1RCKA
chains in the Genus database with same CATH superfamily
2INXA 3LTDA 3NBBA 2IUJA 1B21A 1CH0A 3OWSA 1EA2A 1Q7HA 3CMA3 2HMLB 4BIRA 2HMNB 4MMXB 3LYGA 3MKIA 1X1WA 4KZ1A 1W02A 3CNMA 4XDVA 5AEWB 1BNEA 1GMRA 3UL6A 3OW22 4NPBA 1MWUA 2O9UX 1Q9EA 3L0RA 4STDA 2QA43 3NBJA 2QEX3 3EN8A 5A0OB 1RKYA 5KP1A 1V58A 4O8SA 3DGOA 4HVNA 3F14A 1G02A 4N6TA 3H51A 1CYVA 2M7OA 3AHSA 4FCZA 2O3OA 3LH4A 1UCLA 4GSPA 1DVDA 4EV5A 3OXAA 2Q07A 1JJ22 2W03A 1MWTA 4J8TA 4HOHA 4K1VA 1V57A 5AIHA 5LC7A 1YI23 4O3VA 3F9SA 7RNTA 7STDA 3CXC2 1B2UA 1BRSA 1HZ1A 4DKIA 1BUJA 4H61A 1I2EA 1TUHA 1AR0A 1BRGA 3EF8A 4R9KA 3RGAA 1RCLA 2C4BA 3EQQB 4LYLB 6STDA 3KZTA 2UX0A 3G16A 5CF2A 2CIUA 1ASKA 1IV7A 1L5GB 2ML6A 1MOLA 2XFSA 3A76A 4EV2A 4HM2B 3UNLA 5KP4A 1B2MA 1AQZA 4BTYA 1CYUA 1M1XB 1IYYA 2RFRA 3SX1A 1ROVA 1YGWA 2C10A 1LRAA 3IPTA 3G713 1X1UA 2WOHA 3FCSB 3HOHA 1WNHA 3J7Yd 3PS8A 1B2ZA 2IYJA 4HM7B 3X41A 1VQ73 3MWZA 5IW9A 3KSED 5IG5A 1JV2B 1OHOA 4FMCA 1AY7A 2CW9A 4IIAA 3JUPA 2ML5A 3F8XA 4LEHA 5JPUA 1GOYA 2Z76A 4U13A 4AKYA 4WWUC 1Y4KA 4H3UA 1IVXA 3KKGA 1J2BA 1OHPA 1VQ53 4N3VA 3QRDA 2KRTA 3NM7A 4HYZA 3FGYA 3K63A 2IUKA 1RGGA 1T2IA 2BMRB 5CK6A 3EN1B 6GSPA 1A2VA 5IF6A 5IG3A 4WFOA 4R80A 3SVAA 4HM5B 5FW5A 1QALA 4N6V0 1B20A 2P38A 4O02B 1JN5A 4Q53A 3EX9A 1FUWA 3PCSA 2L1SA 1GS3A 1BNIA 4HJLB 4HM4B 1RTUA 4L7KA 1BSDA 1HYFA 5G1KA 3CCL3 2LQVA 2UGIA 1LQGC 1UI8A 2PZVA 3PCRA 1G96A 2WOFA 2JDIH 4HZ9B 3URPA 1A90A 1LOVA 1UUGB 3WMDA 1BRJA 1OPYA 3AGOA 1RGEA 1JNQA 2WGOA 2P0MA 1YVBI 5CLKA 1TRQA 4XBXA 1JKGB 1LNIA 2R41A 4RNTA 1FUSA 4I5QA 3F7XA 4XDWA 3G0KA 2CFGA 5G1LA 3S27A 2P05A 3CCE3 3HX8A 3I0YA 1LVNA 1NB3I 1VQK3 1MGWA 1RCKA 3S29A 1B2XA 1G0TA 2OQEC 4K1UA 4LZIA 1YJN3 3VSYA 1BSAA 1O7HB 4MJDA 1RJOA 2AADA 1AV4A 5STDA 3DH2A 3KE7A 4RBNA 1RNTA 3RDEA 5M18A 4GHOA 5TGNA 5D82A 4BL2A 3CPW2 1OGZA 1YVSA 1JBRA 4XBTA 2GU1A 3T8UA 1JKGA 2C11A 2Y73A 1OHSA 2I9WA 4GB5A 1TJDA 2H0GA 3DY5A 2MC8A 1ZO2A 1JZOA 2F86B 4L8PA 4TX4A 3NQZA 2CG0A 1O7WB 3MG3A 2B1XB 3WOEB 4XBYA 3N54B 5AYSC 4J5GA 2HMOB 1W4NA 3CME3 3EJVA 1GYBA 3AMOB 3DZLA 3FG3A 3GZRA 4ILFA 1YHQ3 3JUOA 2W04A 1OH0A 3GWRA 1DMQA 3K9MC 1OACA 1E3RA 1OF5A 3VF1A 1U5OA 3I563 3MG1A 5JBSA 2RNTA 1BNFA 1BRNL 3OX9A 4I4KA 3SLUA 4NHFA 2GBXB 1TRPA 1ZS7A 1RMSA 1FZUA 1WMOA 1RGLA 4J9AA 3G4S3 1B27A 1N8R4 3LT8A 3HK4A 2HOHA 9RNTA 3JUMA 1T2HA 1GY5A 1VQQA 1RGHA 3BB9A 3BNCA 4KT3B 1I70A 2CWUA 3SXXA 3LTCA 1JB2A 3CCU3 3DGLA 1NU3A 1YIJ3 1Q814 1C54A 1I0VA 2KXGA 3LTBA 3D79A 3MSOA 1VQ43 2F56A 5IERA 3D5IA 3NX0A 1B2SA 8CHOA 5KP3A 1YGEA 3UL5A 1RN1A 3SYUA 3BU4A 3CU3A 3NV0A 3DXOA 5BU4A 1JBTA 1VZZA 3D3LA 1W01A 1K9M4 3K7CA 2HMMB 1BU4A 4G1MB 3WA2X 4HM6B 1UCKA 1V74A 1W6CA 1N5HA 2CC3A 4BTXA 3TDGA 3ER7A 1M9GA 3F7SA 2F5MA 2W56A 3FF2A 1MWSA 3IJEB 5EVHA 1YIT3 1RRHA 1BSCA 2UUGC 3RGRA 3LTAA 1I0XA 4IPBA 3VGNA 1CEWI 3D4AA 5DRVA 5LC6A 1NWWA 3GZBA 3HIGA 1A2PA 5HOHA 2ZL8A 3PZWA 1JBSA 3JUQA 3AHWA 1AVKA 1I3IA 2F98A 3CC43 3BNEA 1GMPA 3GZXB 4X2HA 3HZPA 2F5WA 4BU4A 2XSOB 3GZYB 3HIIA 1BVIA 1GY6A 1W5ZA 1N8QA 1GD4A 2KF3A 2L4VA 2V1LA 3MPHA 1PU4A 5M1AA 1IDPA 2H0IA 4ORLA 1BRIA 2H0HA 2XRXB 3GAXA 3NQYA 3UJMA 3HI7A 3EB8A 3JUNA 1NB5I 1DVCA 2SARA 3MYTA 4EYCA 1FYSA 1US1A 3EE1A 3Q3FA 4HM1B 2RSXA 4HZBB 1ISKA 3X40A 3F40A 3CCV3 1VQM3 2BT3A 1FGOA 1Q42A 3ALAA 2K3DA 5AI1A 4HM0B 1A67A 3LXUX 5AIIA 1K41A 1EG9B 4K90B 3K5TA 3PGBA 1BIRA 3T0UA 4L8OA 4N6OB 3CCQ3 1OCVA 2RGQA 2KF4A 4CJNA 2FNQA 4JF8A 3I553 1I2GA 1W2ZA 1UUVB 2OOVC 1R4YA 4N6LA 3FG1A 1M904 2GSPA 3D5GA 1JZDA 2LYXA 4HAAA 1YJ93 2F99A 4IT7A 4FMDA 1NJI4 1ULJB 3B8LA 3DGYA 2BU4A 4ZM8A 3Q2PA 3EC9A 3X3YA 3SOAA 2W9QA 3FKAA 3KIIA 4QWTA 2J8XB 2GEXA 1BRKA 3FZWA 6RNTA 2E2TA 4EBGA 1UDII 1W6YA 3WR2A 2OQEA 1IVVA 2B24B 3CD63 1BUQA 4LSOA 1W2B2 2CWTA 3OWYA 1RNBA 2D42A 4RNZA 1SJWA 3N9HA 1GSPA 2YX9A 1N9EA 2D1WA 1QAFA 1KC84 3ECFA 1QMAA 2BMOB 4WYKA 1C7HA 3EBTA 1X1YA 2IA7A 2XEPA 1TFOA 2CK3H 5DREA 3GRDA 2XF3A 1HKXA 3SEDA 3V99A 2W0QA 1YJW3 4AEQA 1O7PB 1N5PA 4RZMA 2OOVA 1CQSA 1ROAA 1UCIA 4EC6A 4LMIA 3K0ZA 3PXMA 1RGFA 3BNBA 1DMMA 3LT9A 5IENA 2BIRA 1KQS2 3FLJA 1RDSA 8RNTA 1IQYA 4R9LA 1BSBA 1Q864 5D83A 3AMOA 1SPUA 3BIRA 4AKZA 2BMQB 1TTOA 2CFKA 2CFDA 2CX1A 3S28A 1QVF2 3DGNA 3IMAB 2CH9A 3CNXA 1GOVA 1EQKA 1OF5B 3CCM3 2XR8B 4WYKB 4O2HA 2CFWA 3U97A 3PYJA 4FR9A 1FGQA 5ELJA 1UI7A 3OV4A 1W6GA 1O7MB 4KFEA 7GSPA 1LXEA 1N9JA 2KAAA 1Z1SA 2KCDA 2KF5A 4OVMA 4XM4A 3WOFB 2GBWB 2SBLA 3MG2A 4LGQA 4HKVB 2WGQA 3G6E3 4HM8B 3RNTA 4PEJA 2QGUA 1RN7A 1WQLB 3KSPA 4WHAA 1BNSA 1BNGA 2CKFB 4GL6A 1STFI 2CX0A 3B4PA 2YFLB 4FMBA 1R4CA 1EKMA 4FCJA 3SOYA 5ELUA 3V92A 1E3VA 3BLZA 2OTL3 1SIIA 1KWIA 1RRLA 3S5CA 2QIYA 2W9PA 1D6ZA 3BNDA 1PY3A 1SARA 3FF0A 1TIJA 2OWPA 4HM3B 4N6UA 3DUKA 3NV0B 5IG4A 2FGTA 2RBIA 3FG4A 4R4KA 1BGSA 1RGAA 2XFTA 4N6MA 1M1K4 2ZDJA 3EHCA 4BTWA 1HU9A 1RN4A 4KFFA 1DMNA 5AYRB 2W56B 5BVBA 1OGXA 1BNRA 1LOXA 1K28A 3X42A 4KFDA 1KSIA 2CHCA 4CCVA 5EQLA 1S5AA 1OUNA 1BRHA 1RLSA 1RHLA 3LZAA 5HGRA 4K61A 4MMYB 2WO0A 3B7CA 1RGCA 5AIGA 3WODG 1IK3A 2XGLA 2W2CA 3CCR3 3V98A 2K54A 3ZFZA 1AVLA 1EEJA 1VQ83 1IVUA 2GU3A 1IQXA 1VQP3 2XSHB 1GOUA 1I2FA 3KFQC 1EUIC 3N8BA 3NUVA 1BNJA 3QK9A 4J5KA 1BAOA 2Y74A 4HBRA 1JRQA 1A2KA 1YNVX 2GEYA 1I8VA 3OWUA 1LNHA 3NM2A 3DMCA 1IV9A 3WDGB 3FH1A 1VQ93 2Z7AA 1FGMA 1TP6A 2HMJB 5D81A 1Q824 3CPOA 1UGHI 1DETA 1PFPA 1S723 2A15A 4R1KA 3CC73 1MWRA 2BHMA 4NREA 1VQN3 3CC23 1GY7A 1NNVA 1E97A 1WTHA 5EEOA 2K0MA 3H3HA 5JPPA 3D9RA 3NHXA 3GSPA 1LOWA 2Z6BA 3Q1CA 5CXOA 2JQ5A 3CCS3 1B3SA 1PYLA 2FXTA 1MGRA 2HMKB 3T8NA 1VQL3 2E2VA 1FGTA 5BIRA 1FGRA 2E2UA 1FA3A 4JRFA 5GSPA 1STDA 4XB5A 3WHOA 4OUQA 3NBRA 1VQ63 2OCTA 3U1WA 4BL3A 1ZX2A 2MF7A 2OTJ3 1BANA 2P09A 1Q7Y4 1RGKA 1RSNA 2BO9B 4EW5A 4OK0A 3EBYA 3STDA 2XH9A 5AEUB 1FW7A 1UCJA 1MNLA 1GD3A 3S67A 1U8CB 1Q40A 1SIHA 1WMPA 2P0XA 2Z77A 2KF6A 1LOYA 5AIFA 1JN5B 4MMZB 1UW1A 1WMNA 3UB1A 1QAKA 3A5EA 2CFLA 1QVG2 2GXFA 3CCJ3 3FSDA 5RNTA 2ZA4A 1NO3A 4WP5A 3X3XA 4FMAA 1DYUA 1K8A4 2IMJA 2F4YA 1FUTA 5CF1A 1D6YA 2YFJB 1UGIA 2BNGA 1D6UA 1K734 1KD14 3LMLA 3MHEA 1IVWA 3B4OA 3Q90A 1ZGXA 2CG1A 2PNCA 1O7NB 1W7CA 3JVCA 4EXRA 5M19A 3WA3A 1TFKA 1Q40B 4CDLA 1I3FA 1NDOB 5I97A 1O7GB 2STDA 2AAEA 4N6NB 2YFIB 5IEOA 1JB5A 1ULIB 2IY2A 1JB4A 4RNYA 3ZG0A 4X2OA 3AGNA 4CPKA 3O8YA 3ZG5A 1UUWB 2CWVA 1IU7A 1SQWA 5IEPA 4FCMA 1IT7A 3KCHA 1IT8A 5FGOA 2RCDA 3KN4A 3DM8A 1T3BA 1QJGA 2R4IA 1LQMB 2XGNA 2ZHXB 3M8CA 4KVHA 1TU5A 1VQO3 1IQ8A 1BSEA 1BOXA 3LOYA 3ROBA 1DE3A 5G2GA 1X1XA 3DGMA 3NXJA 3F8HA 4MEIA 3G8ZA 5IG0A 5BXQA 1W00A 3E99A 1GMQA 1T5YA 2W6JH 1F8NA 3X3ZA
chains in the Genus database with same CATH topology
1B2XA 1BIRA 1B21A 1CH0A 1BSAA 2KF4A 4BIRA 1GOUA 1I2FA 1I2GA 2AADA 4J5KA 1BNJA 1X1WA 1R4YA 1BAOA 3DH2A 1RNTA 1YNVX 2GSPA 3D5GA 4GHOA 1BNEA 1GMRA 4HAAA 1I8VA 1YVSA 1Q9EA 1JBRA 3DGYA 2BU4A 1DETA 1G02A 6RNTA 3AHSA 1BRKA 1UCLA 4GSPA 4J5GA 3WR2A 4HOHA 7RNTA 1RNBA 3GSPA 1B2UA 1LOWA 1BRSA 1B3SA 1HZ1A 1PYLA 1GSPA 1MGRA 1BUJA 1I2EA 5BIRA 1BRGA 5GSPA 1RCLA 2C4BA 1X1YA 2RNTA 1BNFA 3WHOA 1BRNL 1TRPA 1BANA 1RMSA 1FZUA 1B2MA 1RGLA 1AQZA 1B27A 1RGKA 1RSNA 1IYYA 2HOHA 1UCIA 9RNTA 1YGWA 1LRAA 1T2HA 1RGFA 1RGHA 2BIRA 1FW7A 1UCJA 1X1UA 1I70A 3HOHA 1RDSA 8RNTA 1BSBA 1B2ZA 2KF6A 1JBSA 1LOYA 1C54A 1I0VA 3BIRA 1AY7A 2F56A 1TTOA 3D5IA 3A5EA 1B2SA 1GOVA 1GOYA 1RN1A 3SYUA 5RNTA 3BU4A 2ZA4A 5BU4A 1JBTA 2F4YA 1BU4A 1FUTA 1UCKA 7GSPA 2KAAA 2KF5A 2F5MA 1BSCA 1ZGXA 1RGGA 1T2IA 3RNTA 1I0XA 6GSPA 1BNSA 1BNGA 3D4AA 1I3FA 1B20A 1A2PA 2AAEA 5HOHA 3AHWA 1I3IA 1BNIA 1RTUA 1BSDA 1HYFA 1GMPA 3AGNA 1PY3A 1SARA 3URPA 2F5WA 4BU4A 1BVIA 2RBIA 2KF3A 1LOVA 3KCHA 1BGSA 1RGAA 1BRJA 3AGOA 1RGEA 1BRIA 1TRQA 1LNIA 1RN4A 2SARA 4RNTA 1FUSA 1FYSA 3Q3FA 1BNRA 1BSEA 1BOXA 1BRHA 1RLSA 1RHLA 1DE3A 1X1XA 1GMQA 1RGCA 1MGWA 1RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2X A;  1BIR A;  1B21 A;  1CH0 A;  1BSA A;  2KF4 A;  4BIR A;  1GOU A;  1I2F A;  1I2G A;  2AAD A;  4J5K A;  1BNJ A;  1X1W A;  1R4Y A;  1BAO A;  3DH2 A;  1RNT A;  1YNV X;  2GSP A;  3D5G A;  4GHO A;  1BNE A;  1GMR A;  4HAA A;  1I8V A;  1YVS A;  1Q9E A;  1JBR A;  3DGY A;  2BU4 A;  1DET A;  1G02 A;  6RNT A;  3AHS A;  1BRK A;  1UCL A;  4GSP A;  4J5G A;  3WR2 A;  4HOH A;  7RNT A;  1RNB A;  3GSP A;  1B2U A;  1LOW A;  1BRS A;  1B3S A;  1HZ1 A;  1PYL A;  1GSP A;  1MGR A;  1BUJ A;  1I2E A;  5BIR A;  1BRG A;  5GSP A;  1RCL A;  2C4B A;  1X1Y A;  2RNT A;  1BNF A;  3WHO A;  1BRN L;  1TRP A;  1BAN A;  1RMS A;  1FZU A;  1B2M A;  1RGL A;  1AQZ A;  1B27 A;  1RGK A;  1RSN A;  1IYY A;  2HOH A;  1UCI A;  9RNT A;  1YGW A;  1LRA A;  1T2H A;  1RGF A;  1RGH A;  2BIR A;  1FW7 A;  1UCJ A;  1X1U A;  1I70 A;  3HOH A;  1RDS A;  8RNT A;  1BSB A;  1B2Z A;  2KF6 A;  1JBS A;  1LOY A;  1C54 A;  1I0V A;  3BIR A;  1AY7 A;  2F56 A;  1TTO A;  3D5I A;  3A5E A;  1B2S A;  1GOV A;  1GOY A;  1RN1 A;  3SYU A;  5RNT A;  3BU4 A;  2ZA4 A;  5BU4 A;  1JBT A;  2F4Y A;  1BU4 A;  1FUT A;  1UCK A;  7GSP A;  2KAA A;  2KF5 A;  2F5M A;  1BSC A;  1ZGX A;  1RGG A;  1T2I A;  3RNT A;  1I0X A;  6GSP A;  1BNS A;  1BNG A;  3D4A A;  1I3F A;  1B20 A;  1A2P A;  2AAE A;  5HOH A;  3AHW A;  1I3I A;  1BNI A;  1RTU A;  1BSD A;  1HYF A;  1GMP A;  3AGN A;  1PY3 A;  1SAR A;  3URP A;  2F5W A;  4BU4 A;  1BVI A;  2RBI A;  2KF3 A;  1LOV A;  3KCH A;  1BGS A;  1RGA A;  1BRJ A;  3AGO A;  1RGE A;  1BRI A;  1TRQ A;  1LNI A;  1RN4 A;  2SAR A;  4RNT A;  1FUS A;  1FYS A;  3Q3F A;  1BNR A;  1BSE A;  1BOX A;  1BRH A;  1RLS A;  1RHL A;  1DE3 A;  1X1X A;  1GMQ A;  1RGC A;  1MGW A;  1RCK A; 
#chains in the Genus database with same CATH topology
 2INX A;  3LTD A;  3NBB A;  2IUJ A;  1B21 A;  1CH0 A;  3OWS A;  1EA2 A;  1Q7H A;  3CMA 3;  2HML B;  4BIR A;  2HMN B;  4MMX B;  3LYG A;  3MKI A;  1X1W A;  4KZ1 A;  1W02 A;  3CNM A;  4XDV A;  5AEW B;  1BNE A;  1GMR A;  3UL6 A;  3OW2 2;  4NPB A;  1MWU A;  2O9U X;  1Q9E A;  3L0R A;  4STD A;  2QA4 3;  3NBJ A;  2QEX 3;  3EN8 A;  5A0O B;  1RKY A;  5KP1 A;  1V58 A;  4O8S A;  3DGO A;  4HVN A;  3F14 A;  1G02 A;  4N6T A;  3H51 A;  1CYV A;  2M7O A;  3AHS A;  4FCZ A;  2O3O A;  3LH4 A;  1UCL A;  4GSP A;  1DVD A;  4EV5 A;  3OXA A;  2Q07 A;  1JJ2 2;  2W03 A;  1MWT A;  4J8T A;  4HOH A;  4K1V A;  1V57 A;  5AIH A;  5LC7 A;  1YI2 3;  4O3V A;  3F9S A;  7RNT A;  7STD A;  3CXC 2;  1B2U A;  1BRS A;  1HZ1 A;  4DKI A;  1BUJ A;  4H61 A;  1I2E A;  1TUH A;  1AR0 A;  1BRG A;  3EF8 A;  4R9K A;  3RGA A;  1RCL A;  2C4B A;  3EQQ B;  4LYL B;  6STD A;  3KZT A;  2UX0 A;  3G16 A;  5CF2 A;  2CIU A;  1ASK A;  1IV7 A;  1L5G B;  2ML6 A;  1MOL A;  2XFS A;  3A76 A;  4EV2 A;  4HM2 B;  3UNL A;  5KP4 A;  1B2M A;  1AQZ A;  4BTY A;  1CYU A;  1M1X B;  1IYY A;  2RFR A;  3SX1 A;  1ROV A;  1YGW A;  2C10 A;  1LRA A;  3IPT A;  3G71 3;  1X1U A;  2WOH A;  3FCS B;  3HOH A;  1WNH A;  3J7Y d;  3PS8 A;  1B2Z A;  2IYJ A;  4HM7 B;  3X41 A;  1VQ7 3;  3MWZ A;  5IW9 A;  3KSE D;  5IG5 A;  1JV2 B;  1OHO A;  4FMC A;  1AY7 A;  2CW9 A;  4IIA A;  3JUP A;  2ML5 A;  3F8X A;  4LEH A;  5JPU A;  1GOY A;  2Z76 A;  4U13 A;  4AKY A;  4WWU C;  1Y4K A;  4H3U A;  1IVX A;  3KKG A;  1J2B A;  1OHP A;  1VQ5 3;  4N3V A;  3QRD A;  2KRT A;  3NM7 A;  4HYZ A;  3FGY A;  3K63 A;  2IUK A;  1RGG A;  1T2I A;  2BMR B;  5CK6 A;  3EN1 B;  6GSP A;  1A2V A;  5IF6 A;  5IG3 A;  4WFO A;  4R80 A;  3SVA A;  4HM5 B;  5FW5 A;  1QAL A;  4N6V 0;  1B20 A;  2P38 A;  4O02 B;  1JN5 A;  4Q53 A;  3EX9 A;  1FUW A;  3PCS A;  2L1S A;  1GS3 A;  1BNI A;  4HJL B;  4HM4 B;  1RTU A;  4L7K A;  1BSD A;  1HYF A;  5G1K A;  3CCL 3;  2LQV A;  2UGI A;  1LQG C;  1UI8 A;  2PZV A;  3PCR A;  1G96 A;  2WOF A;  2JDI H;  4HZ9 B;  3URP A;  1A90 A;  1LOV A;  1UUG B;  3WMD A;  1BRJ A;  1OPY A;  3AGO A;  1RGE A;  1JNQ A;  2WGO A;  2P0M A;  1YVB I;  5CLK A;  1TRQ A;  4XBX A;  1JKG B;  1LNI A;  2R41 A;  4RNT A;  1FUS A;  4I5Q A;  3F7X A;  4XDW A;  3G0K A;  2CFG A;  5G1L A;  3S27 A;  2P05 A;  3CCE 3;  3HX8 A;  3I0Y A;  1LVN A;  1NB3 I;  1VQK 3;  1MGW A;  1RCK A;  3S29 A;  1B2X A;  1G0T A;  2OQE C;  4K1U A;  4LZI A;  1YJN 3;  3VSY A;  1BSA A;  1O7H B;  4MJD A;  1RJO A;  2AAD A;  1AV4 A;  5STD A;  3DH2 A;  3KE7 A;  4RBN A;  1RNT A;  3RDE A;  5M18 A;  4GHO A;  5TGN A;  5D82 A;  4BL2 A;  3CPW 2;  1OGZ A;  1YVS A;  1JBR A;  4XBT A;  2GU1 A;  3T8U A;  1JKG A;  2C11 A;  2Y73 A;  1OHS A;  2I9W A;  4GB5 A;  1TJD A;  2H0G A;  3DY5 A;  2MC8 A;  1ZO2 A;  1JZO A;  2F86 B;  4L8P A;  4TX4 A;  3NQZ A;  2CG0 A;  1O7W B;  3MG3 A;  2B1X B;  3WOE B;  4XBY A;  3N54 B;  5AYS C;  4J5G A;  2HMO B;  1W4N A;  3CME 3;  3EJV A;  1GYB A;  3AMO B;  3DZL A;  3FG3 A;  3GZR A;  4ILF A;  1YHQ 3;  3JUO A;  2W04 A;  1OH0 A;  3GWR A;  1DMQ A;  3K9M C;  1OAC A;  1E3R A;  1OF5 A;  3VF1 A;  1U5O A;  3I56 3;  3MG1 A;  5JBS A;  2RNT A;  1BNF A;  1BRN L;  3OX9 A;  4I4K A;  3SLU A;  4NHF A;  2GBX B;  1TRP A;  1ZS7 A;  1RMS A;  1FZU A;  1WMO A;  1RGL A;  4J9A A;  3G4S 3;  1B27 A;  1N8R 4;  3LT8 A;  3HK4 A;  2HOH A;  9RNT A;  3JUM A;  1T2H A;  1GY5 A;  1VQQ A;  1RGH A;  3BB9 A;  3BNC A;  4KT3 B;  1I70 A;  2CWU A;  3SXX A;  3LTC A;  1JB2 A;  3CCU 3;  3DGL A;  1NU3 A;  1YIJ 3;  1Q81 4;  1C54 A;  1I0V A;  2KXG A;  3LTB A;  3D79 A;  3MSO A;  1VQ4 3;  2F56 A;  5IER A;  3D5I A;  3NX0 A;  1B2S A;  8CHO A;  5KP3 A;  1YGE A;  3UL5 A;  1RN1 A;  3SYU A;  3BU4 A;  3CU3 A;  3NV0 A;  3DXO A;  5BU4 A;  1JBT A;  1VZZ A;  3D3L A;  1W01 A;  1K9M 4;  3K7C A;  2HMM B;  1BU4 A;  4G1M B;  3WA2 X;  4HM6 B;  1UCK A;  1V74 A;  1W6C A;  1N5H A;  2CC3 A;  4BTX A;  3TDG A;  3ER7 A;  1M9G A;  3F7S A;  2F5M A;  2W56 A;  3FF2 A;  1MWS A;  3IJE B;  5EVH A;  1YIT 3;  1RRH A;  1BSC A;  2UUG C;  3RGR A;  3LTA A;  1I0X A;  4IPB A;  3VGN A;  1CEW I;  3D4A A;  5DRV A;  5LC6 A;  1NWW A;  3GZB A;  3HIG A;  1A2P A;  5HOH A;  2ZL8 A;  3PZW A;  1JBS A;  3JUQ A;  3AHW A;  1AVK A;  1I3I A;  2F98 A;  3CC4 3;  3BNE A;  1GMP A;  3GZX B;  4X2H A;  3HZP A;  2F5W A;  4BU4 A;  2XSO B;  3GZY B;  3HII A;  1BVI A;  1GY6 A;  1W5Z A;  1N8Q A;  1GD4 A;  2KF3 A;  2L4V A;  2V1L A;  3MPH A;  1PU4 A;  5M1A A;  1IDP A;  2H0I A;  4ORL A;  1BRI A;  2H0H A;  2XRX B;  3GAX A;  3NQY A;  3UJM A;  3HI7 A;  3EB8 A;  3JUN A;  1NB5 I;  1DVC A;  2SAR A;  3MYT A;  4EYC A;  1FYS A;  1US1 A;  3EE1 A;  3Q3F A;  4HM1 B;  2RSX A;  4HZB B;  1ISK A;  3X40 A;  3F40 A;  3CCV 3;  1VQM 3;  2BT3 A;  1FGO A;  1Q42 A;  3ALA A;  2K3D A;  5AI1 A;  4HM0 B;  1A67 A;  3LXU X;  5AII A;  1K41 A;  1EG9 B;  4K90 B;  3K5T A;  3PGB A;  1BIR A;  3T0U A;  4L8O A;  4N6O B;  3CCQ 3;  1OCV A;  2RGQ A;  2KF4 A;  4CJN A;  2FNQ A;  4JF8 A;  3I55 3;  1I2G A;  1W2Z A;  1UUV B;  2OOV C;  1R4Y A;  4N6L A;  3FG1 A;  1M90 4;  2GSP A;  3D5G A;  1JZD A;  2LYX A;  4HAA A;  1YJ9 3;  2F99 A;  4IT7 A;  4FMD A;  1NJI 4;  1ULJ B;  3B8L A;  3DGY A;  2BU4 A;  4ZM8 A;  3Q2P A;  3EC9 A;  3X3Y A;  3SOA A;  2W9Q A;  3FKA A;  3KII A;  4QWT A;  2J8X B;  2GEX A;  1BRK A;  3FZW A;  6RNT A;  2E2T A;  4EBG A;  1UDI I;  1W6Y A;  3WR2 A;  2OQE A;  1IVV A;  2B24 B;  3CD6 3;  1BUQ A;  4LSO A;  1W2B 2;  2CWT A;  3OWY A;  1RNB A;  2D42 A;  4RNZ A;  1SJW A;  3N9H A;  1GSP A;  2YX9 A;  1N9E A;  2D1W A;  1QAF A;  1KC8 4;  3ECF A;  1QMA A;  2BMO B;  4WYK A;  1C7H A;  3EBT A;  1X1Y A;  2IA7 A;  2XEP A;  1TFO A;  2CK3 H;  5DRE A;  3GRD A;  2XF3 A;  1HKX A;  3SED A;  3V99 A;  2W0Q A;  1YJW 3;  4AEQ A;  1O7P B;  1N5P A;  4RZM A;  2OOV A;  1CQS A;  1ROA A;  1UCI A;  4EC6 A;  4LMI A;  3K0Z A;  3PXM A;  1RGF A;  3BNB A;  1DMM A;  3LT9 A;  5IEN A;  2BIR A;  1KQS 2;  3FLJ A;  1RDS A;  8RNT A;  1IQY A;  4R9L A;  1BSB A;  1Q86 4;  5D83 A;  3AMO A;  1SPU A;  3BIR A;  4AKZ A;  2BMQ B;  1TTO A;  2CFK A;  2CFD A;  2CX1 A;  3S28 A;  1QVF 2;  3DGN A;  3IMA B;  2CH9 A;  3CNX A;  1GOV A;  1EQK A;  1OF5 B;  3CCM 3;  2XR8 B;  4WYK B;  4O2H A;  2CFW A;  3U97 A;  3PYJ A;  4FR9 A;  1FGQ A;  5ELJ A;  1UI7 A;  3OV4 A;  1W6G A;  1O7M B;  4KFE A;  7GSP A;  1LXE A;  1N9J A;  2KAA A;  1Z1S A;  2KCD A;  2KF5 A;  4OVM A;  4XM4 A;  3WOF B;  2GBW B;  2SBL A;  3MG2 A;  4LGQ A;  4HKV B;  2WGQ A;  3G6E 3;  4HM8 B;  3RNT A;  4PEJ A;  2QGU A;  1RN7 A;  1WQL B;  3KSP A;  4WHA A;  1BNS A;  1BNG A;  2CKF B;  4GL6 A;  1STF I;  2CX0 A;  3B4P A;  2YFL B;  4FMB A;  1R4C A;  1EKM A;  4FCJ A;  3SOY A;  5ELU A;  3V92 A;  1E3V A;  3BLZ A;  2OTL 3;  1SII A;  1KWI A;  1RRL A;  3S5C A;  2QIY A;  2W9P A;  1D6Z A;  3BND A;  1PY3 A;  1SAR A;  3FF0 A;  1TIJ A;  2OWP A;  4HM3 B;  4N6U A;  3DUK A;  3NV0 B;  5IG4 A;  2FGT A;  2RBI A;  3FG4 A;  4R4K A;  1BGS A;  1RGA A;  2XFT A;  4N6M A;  1M1K 4;  2ZDJ A;  3EHC A;  4BTW A;  1HU9 A;  1RN4 A;  4KFF A;  1DMN A;  5AYR B;  2W56 B;  5BVB A;  1OGX A;  1BNR A;  1LOX A;  1K28 A;  3X42 A;  4KFD A;  1KSI A;  2CHC A;  4CCV A;  5EQL A;  1S5A A;  1OUN A;  1BRH A;  1RLS A;  1RHL A;  3LZA A;  5HGR A;  4K61 A;  4MMY B;  2WO0 A;  3B7C A;  1RGC A;  5AIG A;  3WOD G;  1IK3 A;  2XGL A;  2W2C A;  3CCR 3;  3V98 A;  2K54 A;  3ZFZ A;  1AVL A;  1EEJ A;  1VQ8 3;  1IVU A;  2GU3 A;  1IQX A;  1VQP 3;  2XSH B;  1GOU A;  1I2F A;  3KFQ C;  1EUI C;  3N8B A;  3NUV A;  1BNJ A;  3QK9 A;  4J5K A;  1BAO A;  2Y74 A;  4HBR A;  1JRQ A;  1A2K A;  1YNV X;  2GEY A;  1I8V A;  3OWU A;  1LNH A;  3NM2 A;  3DMC A;  1IV9 A;  3WDG B;  3FH1 A;  1VQ9 3;  2Z7A A;  1FGM A;  1TP6 A;  2HMJ B;  5D81 A;  1Q82 4;  3CPO A;  1UGH I;  1DET A;  1PFP A;  1S72 3;  2A15 A;  4R1K A;  3CC7 3;  1MWR A;  2BHM A;  4NRE A;  1VQN 3;  3CC2 3;  1GY7 A;  1NNV A;  1E97 A;  1WTH A;  5EEO A;  2K0M A;  3H3H A;  5JPP A;  3D9R A;  3NHX A;  3GSP A;  1LOW A;  2Z6B A;  3Q1C A;  5CXO A;  2JQ5 A;  3CCS 3;  1B3S A;  1PYL A;  2FXT A;  1MGR A;  2HMK B;  3T8N A;  1VQL 3;  2E2V A;  1FGT A;  5BIR A;  1FGR A;  2E2U A;  1FA3 A;  4JRF A;  5GSP A;  1STD A;  4XB5 A;  3WHO A;  4OUQ A;  3NBR A;  1VQ6 3;  2OCT A;  3U1W A;  4BL3 A;  1ZX2 A;  2MF7 A;  2OTJ 3;  1BAN A;  2P09 A;  1Q7Y 4;  1RGK A;  1RSN A;  2BO9 B;  4EW5 A;  4OK0 A;  3EBY A;  3STD A;  2XH9 A;  5AEU B;  1FW7 A;  1UCJ A;  1MNL A;  1GD3 A;  3S67 A;  1U8C B;  1Q40 A;  1SIH A;  1WMP A;  2P0X A;  2Z77 A;  2KF6 A;  1LOY A;  5AIF A;  1JN5 B;  4MMZ B;  1UW1 A;  1WMN A;  3UB1 A;  1QAK A;  3A5E A;  2CFL A;  1QVG 2;  2GXF A;  3CCJ 3;  3FSD A;  5RNT A;  2ZA4 A;  1NO3 A;  4WP5 A;  3X3X A;  4FMA A;  1DYU A;  1K8A 4;  2IMJ A;  2F4Y A;  1FUT A;  5CF1 A;  1D6Y A;  2YFJ B;  1UGI A;  2BNG A;  1D6U A;  1K73 4;  1KD1 4;  3LML A;  3MHE A;  1IVW A;  3B4O A;  3Q90 A;  1ZGX A;  2CG1 A;  2PNC A;  1O7N B;  1W7C A;  3JVC A;  4EXR A;  5M19 A;  3WA3 A;  1TFK A;  1Q40 B;  4CDL A;  1I3F A;  1NDO B;  5I97 A;  1O7G B;  2STD A;  2AAE A;  4N6N B;  2YFI B;  5IEO A;  1JB5 A;  1ULI B;  2IY2 A;  1JB4 A;  4RNY A;  3ZG0 A;  4X2O A;  3AGN A;  4CPK A;  3O8Y A;  3ZG5 A;  1UUW B;  2CWV A;  1IU7 A;  1SQW A;  5IEP A;  4FCM A;  1IT7 A;  3KCH A;  1IT8 A;  5FGO A;  2RCD A;  3KN4 A;  3DM8 A;  1T3B A;  1QJG A;  2R4I A;  1LQM B;  2XGN A;  2ZHX B;  3M8C A;  4KVH A;  1TU5 A;  1VQO 3;  1IQ8 A;  1BSE A;  1BOX A;  3LOY A;  3ROB A;  1DE3 A;  5G2G A;  1X1X A;  3DGM A;  3NXJ A;  3F8H A;  4MEI A;  3G8Z A;  5IG0 A;  5BXQ A;  1W00 A;  3E99 A;  1GMQ A;  1T5Y A;  2W6J H;  1F8N A;  3X3Z A; 
#chains in the Genus database with same CATH homology
 1B2X A;  1BIR A;  1B21 A;  1CH0 A;  1BSA A;  2KF4 A;  4BIR A;  1GOU A;  1I2F A;  1I2G A;  2AAD A;  4J5K A;  1BNJ A;  1X1W A;  1R4Y A;  1BAO A;  3DH2 A;  1RNT A;  1YNV X;  2GSP A;  3D5G A;  4GHO A;  1BNE A;  1GMR A;  4HAA A;  1I8V A;  1YVS A;  1Q9E A;  1JBR A;  3DGY A;  2BU4 A;  1DET A;  1G02 A;  6RNT A;  3AHS A;  1BRK A;  1UCL A;  4GSP A;  4J5G A;  3WR2 A;  4HOH A;  7RNT A;  1RNB A;  3GSP A;  1B2U A;  1LOW A;  1BRS A;  1B3S A;  1HZ1 A;  1PYL A;  1GSP A;  1MGR A;  1BUJ A;  1I2E A;  5BIR A;  1BRG A;  5GSP A;  1RCL A;  2C4B A;  1X1Y A;  2RNT A;  1BNF A;  3WHO A;  1BRN L;  1TRP A;  1BAN A;  1RMS A;  1FZU A;  1B2M A;  1RGL A;  1AQZ A;  1B27 A;  1RGK A;  1RSN A;  1IYY A;  2HOH A;  1UCI A;  9RNT A;  1YGW A;  1LRA A;  1T2H A;  1RGF A;  1RGH A;  2BIR A;  1FW7 A;  1UCJ A;  1X1U A;  1I70 A;  3HOH A;  1RDS A;  8RNT A;  1BSB A;  1B2Z A;  2KF6 A;  1JBS A;  1LOY A;  1C54 A;  1I0V A;  3BIR A;  1AY7 A;  2F56 A;  1TTO A;  3D5I A;  3A5E A;  1B2S A;  1GOV A;  1GOY A;  1RN1 A;  3SYU A;  5RNT A;  3BU4 A;  2ZA4 A;  5BU4 A;  1JBT A;  2F4Y A;  1BU4 A;  1FUT A;  1UCK A;  7GSP A;  2KAA A;  2KF5 A;  2F5M A;  1BSC A;  1ZGX A;  1RGG A;  1T2I A;  3RNT A;  1I0X A;  6GSP A;  1BNS A;  1BNG A;  3D4A A;  1I3F A;  1B20 A;  1A2P A;  2AAE A;  5HOH A;  3AHW A;  1I3I A;  1BNI A;  1RTU A;  1BSD A;  1HYF A;  1GMP A;  3AGN A;  1PY3 A;  1SAR A;  3URP A;  2F5W A;  4BU4 A;  1BVI A;  2RBI A;  2KF3 A;  1LOV A;  3KCH A;  1BGS A;  1RGA A;  1BRJ A;  3AGO A;  1RGE A;  1BRI A;  1TRQ A;  1LNI A;  1RN4 A;  2SAR A;  4RNT A;  1FUS A;  1FYS A;  3Q3F A;  1BNR A;  1BSE A;  1BOX A;  1BRH A;  1RLS A;  1RHL A;  1DE3 A;  1X1X A;  1GMQ A;  1RGC A;  1MGW A;  1RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...