3AHSA

Crystal structure of ustilago sphaerogena ribonuclease u2b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
CDIPQSTNCGGNVYSNDDINTAIQGALDDVAGDRPDNYPHQYYDEASEDITLCCGSGPWSEFPLVYNGPYYSSRDNYVSPGPDRVIYQTNTGEFCATVTHTGAASYDGFTQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes induced by the deamidation and isomerization of asparagine revealed by the crystal structure of Ustilago sphaerogena ribonuclease U2B
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease U2
total genus 26
structure length 113
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 3.1.27.4: Transferred entry: 4.6.1.20.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3ahsA00
1LOYA 1FYSA 2AADA 4J5KA 2KF3A 3BU4A 5BU4A 1DETA 3DGYA 1I70A 1BRSA 1GOUA 6GSPA 1BNJA 2RBIA 2KF4A 1LNIA 4HAAA 1GMRA 1MGRA 1RNTA 1RDSA 3D4AA 1GOVA 1X1XA 5RNTA 1BSDA 2AAEA 1LRAA 1BRNL 1PYLA 1I2GA 3AHSA 1BNFA 1X1UA 3URPA 1BUJA 1GMPA 1X1WA 4BIRA 1BSCA 1Q9EA 1ZGXA 1DE3A 1FUTA 1BANA 1BAOA 1BNIA 1UCLA 1RN1A 4GSPA 2C4BA 1YVSA 2F56A 1I2EA 2HOHA 4RNTA 4GHOA 1TRPA 3SYUA 1RCKA 5GSPA 1RHLA 2F5MA 4J5GA 1A2PA 6RNTA 1TRQA 3Q3FA 1I3FA 1C54A 1BU4A 1RGLA 1IYYA 2GSPA 1BVIA 1CH0A 1RGEA 1RGGA 1B2SA 1HZ1A 1BIRA 1GMQA 3D5IA 2F4YA 1MGWA 1B2XA 1B2MA 1BSBA 1UCJA 1BNSA 1GSPA 5HOHA 1BGSA 1RGKA 1BNEA 2BIRA 1AY7A 1BSAA 3HOHA 1BNRA 1X1YA 1FW7A 1T2IA 1UCIA 3RNTA 3BIRA 1HYFA 9RNTA 2RNTA 1BSEA 1B21A 1RLSA 1B3SA 1GOYA 1BOXA 3A5EA 1BRHA 1I2FA 1RGCA 7RNTA 4HOHA 1RCLA 1I0XA 1RMSA 1G02A 3DH2A 3GSPA 3KCHA 1RTUA 1RGHA 1RSNA 1BNGA 1YGWA 1B2ZA 1SARA 1JBTA 1YNVX 1UCKA 1BRIA 1FZUA 3AGNA 1B27A 1TTOA 4BU4A 1AQZA 8RNTA 1LOWA 1JBRA 3AGOA 3WR2A 1PY3A 2SARA 2KF5A 1R4YA 3WHOA 2ZA4A 1BRJA 1BRGA 1I3IA 5BIRA 3D5GA 1RNBA 1RGAA 1BRKA 2BU4A 1B20A 1RN4A 1I0VA 7GSPA 1LOVA 1T2HA 1I8VA 2KAAA 2F5WA 1B2UA 1FUSA 2KF6A 1RGFA 1JBSA 3AHWA
chains in the Genus database with same CATH superfamily
1Q814 4L8OA 1FYSA 4J5KA 1FGTA 2OOVC 3BU4A 3HX8A 4KVHA 3ECFA 3ZFZA 3DGYA 3JVCA 2OWPA 3HZPA 3LTAA 4WYKA 4KFDA 1Z1SA 3EN1B 1Q7HA 1O7NB 3Q2PA 2RFRA 2RBIA 1LNIA 3S28A 1MWTA 4XM4A 1EEJA 3EBTA 2OQEA 1PFPA 1NO3A 1JV2B 1GMRA 1KC84 4N3VA 1KWIA 3CNXA 1GOVA 1EQKA 1TP6A 1SIIA 1BSDA 2KRTA 1V57A 3UJMA 1DYUA 1BRNL 1N8R4 3HIIA 5FGOA 3NX0A 3HK4A 1IT8A 2STDA 1K734 1Q40B 3URPA 5D83A 2ZDJA 1TJDA 1VQL3 1FUWA 1BSCA 3EHCA 2WO0A 1IQYA 3F40A 4BL3A 1DE3A 4LMIA 1YHQ3 3MG2A 1O7MB 3JUNA 4GSPA 2L4VA 2C4BA 3IJEB 4GB5A 3CC43 1IV9A 4BTXA 3GWRA 4U13A 4GHOA 5EEOA 1RCKA 2WOHA 1R4CA 5KP1A 5LC6A 2WOFA 2MF7A 3MSOA 4J5GA 5GSPA 4EC6A 1LNHA 2INXA 4K1VA 1IV7A 1JB4A 2P05A 2SBLA 3SLUA 6RNTA 1QVG2 4K1UA 1YGEA 1DMMA 1C54A 1DMQA 4LZIA 3CD63 2GSPA 1CH0A 6STDA 5AIFA 3WOFB 2QIYA 1HZ1A 1BIRA 1LXEA 4HM8B 2XEPA 4FMDA 2P09A 1UI7A 5EQLA 1GYBA 4STDA 1BSBA 2FGTA 3E99A 3KFQC 1YIJ3 1BNSA 1IU7A 5HOHA 4X2HA 1J2BA 1N9EA 1UGHI 1NNVA 4FMAA 1X1YA 1ROVA 5AYRB 4J8TA 2W03A 2E2TA 1A2VA 2F99A 1DVCA 2GBXB 3HI7A 4HZBB 5CF2A 1MOLA 1GOYA 1BOXA 1WNHA 2HMLB 3NM2A 3X42A 1WMOA 1I2FA 1KSIA 2CIUA 2K54A 1RMSA 1I0XA 2RCDA 5G1KA 1G02A 7RNTA 1VQ93 1DMNA 2C10A 3F7SA 4HJLB 4I5QA 3CCL3 4RNZA 2O3OA 3NM7A 4EV5A 5JPUA 1NDOB 2K3DA 3FF2A 3SEDA 1BUQA 4R80A 2CWUA 2QGUA 3KN4A 3FG3A 4LGQA 1NB5I 1OH0A 1TU5A 1JJ22 3OX9A 4EW5A 3X41A 3CCJ3 3NQYA 2W04A 2CKFB 3LTBA 2KF5A 1D6ZA 1I3IA 5DREA 4OUQA 3CPOA 4XDWA 1Q7Y4 3D79A 1NJI4 1UUGB 1RN4A 2B1XB 3CCQ3 1YI23 4FMBA 4GL6A 7GSPA 1QAFA 3F8HA 3FSDA 1LOVA 3N8BA 2LQVA 3X3YA 1QALA 1K9M4 3F8XA 2XSHB 3PCSA 5FW5A 1IQXA 5KP3A 3CU3A 2CWTA 2W9PA 4FR9A 4WFOA 1LOYA 4HZ9B 3WMDA 2KF3A 1M1K4 2GXFA 3DGLA 1OACA 1W5ZA 1MWUA 1K28A 1UI8A 1BRSA 1GOUA 3D9RA 1GD4A 5IEPA 2GBWB 4HYZA 2CG1A 2YFLB 3BLZA 3OV4A 1OUNA 3SX1A 2F98A 1Q42A 3FG1A 2Z6BA 1CYVA 1RNTA 1VQK3 4R9KA 5RNTA 1YJN3 4BTYA 1W2B2 2HMMB 1O7HB 1WQLB 3EE1A 3TDGA 1LRAA 3WODG 1I2GA 4HM1B 1BNFA 2Y74A 5IENA 1W01A 4MJDA 1X1WA 4H3UA 2CFKA 4IIAA 3CC73 2W56A 1Q9EA 3O8YA 1ZGXA 1STDA 2ZHXB 3GZYB 1JN5A 1UDII 4ORLA 5AIHA 1QVF2 1BNIA 3FLJA 3LT8A 1RN1A 3MPHA 3I563 4O8SA 4EXRA 2D1WA 3K0ZA 2HOHA 1ASKA 2XR8B 5ELUA 1LQGC 1LOXA 1RHLA 4HVNA 2W56B 4JRFA 4EYCA 2Y73A 2PZVA 1UGIA 3LMLA 2XGLA 1W02A 1IYYA 5STDA 5I97A 5M19A 1AR0A 1B2SA 2XFSA 1GMQA 4N6UA 1VQM3 2OOVA 1N5HA 3L0RA 1IVVA 1T5YA 5BVBA 5JPPA 1Y4KA 1HKXA 4PEJA 1RGKA 3PS8A 3QRDA 3H51A 1GY5A 1FGQA 2IA7A 1AY7A 1BSAA 2IMJA 3HOHA 4O2HA 2UUGC 4FCMA 3LT9A 4NREA 2MC8A 1M904 2BT3A 3FCSB 1FW7A 1W00A 3DXOA 1YIT3 3WA3A 1VQ83 3WDGB 3CMA3 3VGNA 1A90A 1W2ZA 2W6JH 2H0GA 2V1LA 1VQ53 4HM6B 2QEX3 5IF6A 3SXXA 3AMOA 1UW1A 3JUMA 3NV0B 3JUQA 4HOHA 4K61A 3Q90A 5D82A 2CH9A 3DH2A 3GSPA 4J9AA 1RTUA 3CCR3 3EBYA 5JBSA 1YGWA 1JBTA 3PXMA 3ER7A 1FZUA 3SOYA 3KE7A 1QMAA 1AQZA 4BU4A 3G8ZA 4AKZA 3AGOA 4HM3B 3WR2A 1FGMA 2HMOB 3DGOA 2CFLA 1IQ8A 2ML6A 2OQEC 2ZA4A 3I553 5LC7A 5BIRA 4JF8A 1RGAA 1BRKA 2K0MA 3M8CA 3MKIA 1S723 1SQWA 3DUKA 2CFDA 3WOEB 1T2HA 1QJGA 1W6GA 3DZLA 3FZWA 3KSPA 1Q864 3STDA 4DKIA 1V74A 2WGQA 2KXGA 3MYTA 4RNYA 1B2UA 3BNCA 4NHFA 5M1AA 5IG5A 3EF8A 1FUSA 4XB5A 1C7HA 2YX9A 3GZXB 1YJ93 3EC9A 1VZZA 1JBSA 4RBNA 2C11A 1SIHA 1MWSA 2IUKA 2AADA 2RSXA 2XF3A 4FCJA 3NXJA 3FF0A 3SVAA 1TUHA 5BU4A 1AVLA 2RGQA 3CCS3 2GEYA 2W2CA 1I70A 3KSED 5IG3A 6GSPA 5CLKA 3G6E3 1BNJA 2FNQA 2W9QA 1NU3A 1AVKA 1MGRA 3GAXA 5IW9A 1ZS7A 4L8PA 2JQ5A 4N6LA 1RDSA 1M1XB 3D3LA 4MMZB 4WHAA 1YJW3 1OHOA 1OPYA 3FH1A 1JB2A 3OXAA 1OHPA 1PYLA 1OGXA 5D81A 4HM2B 3X40A 3AHSA 3G4S3 1G96A 3CME3 1X1UA 3LH4A 3LXUX 5BXQA 2ZL8A 1GMPA 4BIRA 1O7WB 1ULIB 2Q07A 2BMOB 1BAOA 3DM8A 1L5GB 2P0MA 1T3BA 3HIGA 4HM0B 5AEUB 2JDIH 2OTL3 4L7KA 1YVSA 2F56A 1ULJB 3GZRA 3K5TA 1Q824 4KFFA 4FMCA 2A15A 1TRPA 3Q1CA 3UL5A 3CCM3 1EKMA 3LTCA 4HKVB 1UUWB 1A2PA 1W4NA 1MNLA 4EV2A 3V99A 2CC3A 2Z76A 1W6YA 1N8QA 2UGIA 3N9HA 3F14A 1RGEA 1GY6A 1RGGA 2CX1A 3EB8A 3D5IA 2XSOB 2F4YA 4FCZA 2R41A 4R4KA 1MGWA 1B2XA 1Q40A 4CDLA 2Z7AA 1LQMB 4KFEA 1W7CA 1LVNA 2IY2A 2BMQB 3MWZA 2HMNB 1UCJA 3I0YA 2CG0A 2CFWA 1BNRA 2BHMA 3AMOB 1GD3A 1T2IA 3BNEA 3NV0A 1EUIC 2YFJB 3RNTA 3U97A 1VQ73 3BNBA 3IMAB 3BIRA 1HYFA 4CPKA 3EJVA 4WYKB 4LEHA 4H61A 1OGZA 1IK3A 2IUJA 3RGRA 1VQN3 3DMCA 4HBRA 1S5AA 3A5EA 1BRHA 3BB9A 3FGYA 1D6YA 1VQQA 1VQO3 2FXTA 3BNDA 5IG0A 3CCE3 1V58A 2HMJB 1ZO2A 3KCHA 3V92A 1HU9A 3T8NA 5A0OB 5KP4A 1BNGA 4ZM8A 2BO9B 2P38A 1UCKA 3G0KA 3NHXA 1JKGB 1O7PB 2XH9A 1B27A 3AGNA 3GRDA 1TTOA 3K63A 1IT7A 2CFGA 3NBJA 1AV4A 3S29A 5M18A 8RNTA 1LOWA 1IVUA 1JBRA 1DVDA 1GS3A 2SARA 5EVHA 3V98A 2CWVA 5G1LA 3WHOA 2GU3A 2H0IA 2J8XB 3B4PA 1BRJA 1JZOA 1RNBA 3LZAA 2BNGA 1VQ63 1B20A 1US1A 1CEWI 3VF1A 3VSYA 3GZBA 1MWRA 1OF5B 2WGOA 1ZX2A 2R4IA 2KAAA 3ALAA 4TX4A 4WWUC 1JB5A 2CHCA 2F5WA 3H3HA 4BL2A 4BTWA 5G2GA 8CHOA 3RGAA 2KF6A 1D6UA 1RGFA 4WP5A 1E3VA 4XBTA 3RDEA 3AHWA 3F7XA 5CK6A 3OW22 3MG1A 1IVWA 3PCRA 4OVMA 2B24B 3CXC2 5HGRA 1DETA 2E2UA 2YFIB 4N6NB 4O3VA 1PU4A 3CC23 2PNCA 2CW9A 4HM5B 3S5CA 4IPBA 4NPBA 1RJOA 3S27A 1WMNA 2KF4A 2OCTA 3K9MC 4MEIA 5DRVA 3OWUA 1TIJA 3FKAA 4HAAA 3ROBA 2LYXA 4OK0A 1K8A4 2CX0A 3D4AA 1X1XA 1RKYA 2E2VA 1IVXA 2BMRB 1EG9B 2AAEA 3LYGA 1OHSA 3UNLA 3CPW2 4XBXA 2GEXA 3KKGA 4EBGA 2D42A 1RN7A 4N6V0 3G713 5AIGA 1BUJA 3CCU3 4G1MB 3UB1A 3WA2X 3DY5A 3NBBA 5CF1A 1FUTA 1BANA 3DGNA 2H0HA 1K41A 1UCLA 1RRHA 4R9LA 3B8LA 2CK3H 1I2EA 2I9WA 1N5PA 4RNTA 3X3ZA 4O02B 3OWSA 3SYUA 1STFI 3LTDA 3NBRA 2F5MA 2M7OA 1E97A 2KCDA 1TRQA 5AI1A 2XRXB 3Q3FA 1I3FA 1EA2A 1BU4A 2HMKB 3ZG5A 3PZWA 1RGLA 1IDPA 4AKYA 1BVIA 1JNQA 2O9UX 4RZMA 4MMXB 1JZDA 3PYJA 5CXOA 1KQS2 2UX0A 3NQZA 5TGNA 3F9SA 1E3RA 3LOYA 1B2MA 1A67A 1VQ43 3OWYA 1QAKA 3KZTA 1GSPA 4X2OA 1BGSA 1BNEA 2BIRA 1FGOA 3MG3A 3MHEA 3JUPA 1CYUA 4N6MA 3S67A 3QK9A 4XBYA 1UCIA 3NUVA 4LYLB 4XDVA 1FA3A 5ELJA 3T0UA 9RNTA 1WMPA 1TFKA 1WTHA 1F8NA 1U5OA 3JUOA 2RNTA 4KZ1A 1BSEA 4R1KA 1B21A 1RLSA 3UL6A 1VQP3 1YVBI 1B3SA 1GY7A 1JRQA 2W0QA 4HM4B 4ILFA 5AEWB 1RGCA 1RCLA 1O7GB 2QA43 4CJNA 4K90B 3PGBA 4IT7A 5AIIA 4AEQA 1M9GA 2IYJA 3N54B 1RGHA 4Q53A 1RSNA 1SJWA 4QWTA 1OCVA 1B2ZA 1SARA 1YNVX 4MMYB 5IG4A 1BRIA 1G0TA 2XFTA 3T8UA 5IERA 3IPTA 1ROAA 1W6CA 3KIIA 4KT3B 3CCV3 2ML5A 1CQSA 1PY3A 1RRLA 2Z77A 3B4OA 3G16A 2OTJ3 1OF5A 1R4YA 3X3XA 1JN5B 1A2KA 1SPUA 1BRGA 1KD14 3B7CA 3D5GA 1ISKA 1NB3I 3J7Yd 3A76A 2BU4A 3CNMA 4I4KA 3ZG0A 2XGNA 1FGRA 3FG4A 3EX9A 1N9JA 1I0VA 1NWWA 3DGMA 4HM7B 2L1SA 3U1WA 4CCVA 1JKGA 3EN8A 1U8CB 5AYSC 1I8VA 2F86B 4LSOA 5IEOA 3K7CA 1UUVB 4N6TA 3EQQB 4N6OB 2P0XA 3SOAA 7STDA 1TFOA 2GU1A
chains in the Genus database with same CATH topology
1LOYA 1FYSA 2AADA 4J5KA 2KF3A 3BU4A 5BU4A 1DETA 3DGYA 1I70A 1BRSA 1GOUA 6GSPA 1BNJA 2RBIA 2KF4A 1LNIA 4HAAA 1GMRA 1MGRA 1RNTA 1RDSA 3D4AA 1GOVA 1X1XA 5RNTA 1BSDA 2AAEA 1LRAA 1BRNL 1PYLA 1I2GA 3AHSA 1BNFA 1X1UA 3URPA 1BUJA 1GMPA 1X1WA 4BIRA 1BSCA 1Q9EA 1ZGXA 1DE3A 1FUTA 1BANA 1BAOA 1BNIA 1UCLA 1RN1A 4GSPA 2C4BA 1YVSA 2F56A 1I2EA 2HOHA 4RNTA 4GHOA 1TRPA 3SYUA 1RCKA 5GSPA 1RHLA 2F5MA 4J5GA 1A2PA 6RNTA 1TRQA 3Q3FA 1I3FA 1C54A 1BU4A 1RGLA 1IYYA 2GSPA 1BVIA 1CH0A 1RGEA 1RGGA 1B2SA 1HZ1A 1BIRA 1GMQA 3D5IA 2F4YA 1MGWA 1B2XA 1B2MA 1BSBA 1UCJA 1BNSA 1GSPA 5HOHA 1BGSA 1RGKA 1BNEA 2BIRA 1AY7A 1BSAA 3HOHA 1BNRA 1X1YA 1FW7A 1T2IA 1UCIA 3RNTA 3BIRA 1HYFA 9RNTA 2RNTA 1BSEA 1B21A 1RLSA 1B3SA 1GOYA 1BOXA 3A5EA 1BRHA 1I2FA 1RGCA 7RNTA 4HOHA 1RCLA 1I0XA 1RMSA 1G02A 3DH2A 3GSPA 3KCHA 1RTUA 1RGHA 1RSNA 1BNGA 1YGWA 1B2ZA 1SARA 1JBTA 1YNVX 1UCKA 1BRIA 1FZUA 3AGNA 1B27A 1TTOA 4BU4A 1AQZA 8RNTA 1LOWA 1JBRA 3AGOA 3WR2A 1PY3A 2SARA 2KF5A 1R4YA 3WHOA 2ZA4A 1BRJA 1BRGA 1I3IA 5BIRA 3D5GA 1RNBA 1RGAA 1BRKA 2BU4A 1B20A 1RN4A 1I0VA 7GSPA 1LOVA 1T2HA 1I8VA 2KAAA 2F5WA 1B2UA 1FUSA 2KF6A 1RGFA 1JBSA 3AHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOY A;  1FYS A;  2AAD A;  4J5K A;  2KF3 A;  3BU4 A;  5BU4 A;  1DET A;  3DGY A;  1I70 A;  1BRS A;  1GOU A;  6GSP A;  1BNJ A;  2RBI A;  2KF4 A;  1LNI A;  4HAA A;  1GMR A;  1MGR A;  1RNT A;  1RDS A;  3D4A A;  1GOV A;  1X1X A;  5RNT A;  1BSD A;  2AAE A;  1LRA A;  1BRN L;  1PYL A;  1I2G A;  3AHS A;  1BNF A;  1X1U A;  3URP A;  1BUJ A;  1GMP A;  1X1W A;  4BIR A;  1BSC A;  1Q9E A;  1ZGX A;  1DE3 A;  1FUT A;  1BAN A;  1BAO A;  1BNI A;  1UCL A;  1RN1 A;  4GSP A;  2C4B A;  1YVS A;  2F56 A;  1I2E A;  2HOH A;  4RNT A;  4GHO A;  1TRP A;  3SYU A;  1RCK A;  5GSP A;  1RHL A;  2F5M A;  4J5G A;  1A2P A;  6RNT A;  1TRQ A;  3Q3F A;  1I3F A;  1C54 A;  1BU4 A;  1RGL A;  1IYY A;  2GSP A;  1BVI A;  1CH0 A;  1RGE A;  1RGG A;  1B2S A;  1HZ1 A;  1BIR A;  1GMQ A;  3D5I A;  2F4Y A;  1MGW A;  1B2X A;  1B2M A;  1BSB A;  1UCJ A;  1BNS A;  1GSP A;  5HOH A;  1BGS A;  1RGK A;  1BNE A;  2BIR A;  1AY7 A;  1BSA A;  3HOH A;  1BNR A;  1X1Y A;  1FW7 A;  1T2I A;  1UCI A;  3RNT A;  3BIR A;  1HYF A;  9RNT A;  2RNT A;  1BSE A;  1B21 A;  1RLS A;  1B3S A;  1GOY A;  1BOX A;  3A5E A;  1BRH A;  1I2F A;  1RGC A;  7RNT A;  4HOH A;  1RCL A;  1I0X A;  1RMS A;  1G02 A;  3DH2 A;  3GSP A;  3KCH A;  1RTU A;  1RGH A;  1RSN A;  1BNG A;  1YGW A;  1B2Z A;  1SAR A;  1JBT A;  1YNV X;  1UCK A;  1BRI A;  1FZU A;  3AGN A;  1B27 A;  1TTO A;  4BU4 A;  1AQZ A;  8RNT A;  1LOW A;  1JBR A;  3AGO A;  3WR2 A;  1PY3 A;  2SAR A;  2KF5 A;  1R4Y A;  3WHO A;  2ZA4 A;  1BRJ A;  1BRG A;  1I3I A;  5BIR A;  3D5G A;  1RNB A;  1RGA A;  1BRK A;  2BU4 A;  1B20 A;  1RN4 A;  1I0V A;  7GSP A;  1LOV A;  1T2H A;  1I8V A;  2KAA A;  2F5W A;  1B2U A;  1FUS A;  2KF6 A;  1RGF A;  1JBS A;  3AHW A; 
#chains in the Genus database with same CATH topology
 1Q81 4;  4L8O A;  1FYS A;  4J5K A;  1FGT A;  2OOV C;  3BU4 A;  3HX8 A;  4KVH A;  3ECF A;  3ZFZ A;  3DGY A;  3JVC A;  2OWP A;  3HZP A;  3LTA A;  4WYK A;  4KFD A;  1Z1S A;  3EN1 B;  1Q7H A;  1O7N B;  3Q2P A;  2RFR A;  2RBI A;  1LNI A;  3S28 A;  1MWT A;  4XM4 A;  1EEJ A;  3EBT A;  2OQE A;  1PFP A;  1NO3 A;  1JV2 B;  1GMR A;  1KC8 4;  4N3V A;  1KWI A;  3CNX A;  1GOV A;  1EQK A;  1TP6 A;  1SII A;  1BSD A;  2KRT A;  1V57 A;  3UJM A;  1DYU A;  1BRN L;  1N8R 4;  3HII A;  5FGO A;  3NX0 A;  3HK4 A;  1IT8 A;  2STD A;  1K73 4;  1Q40 B;  3URP A;  5D83 A;  2ZDJ A;  1TJD A;  1VQL 3;  1FUW A;  1BSC A;  3EHC A;  2WO0 A;  1IQY A;  3F40 A;  4BL3 A;  1DE3 A;  4LMI A;  1YHQ 3;  3MG2 A;  1O7M B;  3JUN A;  4GSP A;  2L4V A;  2C4B A;  3IJE B;  4GB5 A;  3CC4 3;  1IV9 A;  4BTX A;  3GWR A;  4U13 A;  4GHO A;  5EEO A;  1RCK A;  2WOH A;  1R4C A;  5KP1 A;  5LC6 A;  2WOF A;  2MF7 A;  3MSO A;  4J5G A;  5GSP A;  4EC6 A;  1LNH A;  2INX A;  4K1V A;  1IV7 A;  1JB4 A;  2P05 A;  2SBL A;  3SLU A;  6RNT A;  1QVG 2;  4K1U A;  1YGE A;  1DMM A;  1C54 A;  1DMQ A;  4LZI A;  3CD6 3;  2GSP A;  1CH0 A;  6STD A;  5AIF A;  3WOF B;  2QIY A;  1HZ1 A;  1BIR A;  1LXE A;  4HM8 B;  2XEP A;  4FMD A;  2P09 A;  1UI7 A;  5EQL A;  1GYB A;  4STD A;  1BSB A;  2FGT A;  3E99 A;  3KFQ C;  1YIJ 3;  1BNS A;  1IU7 A;  5HOH A;  4X2H A;  1J2B A;  1N9E A;  1UGH I;  1NNV A;  4FMA A;  1X1Y A;  1ROV A;  5AYR B;  4J8T A;  2W03 A;  2E2T A;  1A2V A;  2F99 A;  1DVC A;  2GBX B;  3HI7 A;  4HZB B;  5CF2 A;  1MOL A;  1GOY A;  1BOX A;  1WNH A;  2HML B;  3NM2 A;  3X42 A;  1WMO A;  1I2F A;  1KSI A;  2CIU A;  2K54 A;  1RMS A;  1I0X A;  2RCD A;  5G1K A;  1G02 A;  7RNT A;  1VQ9 3;  1DMN A;  2C10 A;  3F7S A;  4HJL B;  4I5Q A;  3CCL 3;  4RNZ A;  2O3O A;  3NM7 A;  4EV5 A;  5JPU A;  1NDO B;  2K3D A;  3FF2 A;  3SED A;  1BUQ A;  4R80 A;  2CWU A;  2QGU A;  3KN4 A;  3FG3 A;  4LGQ A;  1NB5 I;  1OH0 A;  1TU5 A;  1JJ2 2;  3OX9 A;  4EW5 A;  3X41 A;  3CCJ 3;  3NQY A;  2W04 A;  2CKF B;  3LTB A;  2KF5 A;  1D6Z A;  1I3I A;  5DRE A;  4OUQ A;  3CPO A;  4XDW A;  1Q7Y 4;  3D79 A;  1NJI 4;  1UUG B;  1RN4 A;  2B1X B;  3CCQ 3;  1YI2 3;  4FMB A;  4GL6 A;  7GSP A;  1QAF A;  3F8H A;  3FSD A;  1LOV A;  3N8B A;  2LQV A;  3X3Y A;  1QAL A;  1K9M 4;  3F8X A;  2XSH B;  3PCS A;  5FW5 A;  1IQX A;  5KP3 A;  3CU3 A;  2CWT A;  2W9P A;  4FR9 A;  4WFO A;  1LOY A;  4HZ9 B;  3WMD A;  2KF3 A;  1M1K 4;  2GXF A;  3DGL A;  1OAC A;  1W5Z A;  1MWU A;  1K28 A;  1UI8 A;  1BRS A;  1GOU A;  3D9R A;  1GD4 A;  5IEP A;  2GBW B;  4HYZ A;  2CG1 A;  2YFL B;  3BLZ A;  3OV4 A;  1OUN A;  3SX1 A;  2F98 A;  1Q42 A;  3FG1 A;  2Z6B A;  1CYV A;  1RNT A;  1VQK 3;  4R9K A;  5RNT A;  1YJN 3;  4BTY A;  1W2B 2;  2HMM B;  1O7H B;  1WQL B;  3EE1 A;  3TDG A;  1LRA A;  3WOD G;  1I2G A;  4HM1 B;  1BNF A;  2Y74 A;  5IEN A;  1W01 A;  4MJD A;  1X1W A;  4H3U A;  2CFK A;  4IIA A;  3CC7 3;  2W56 A;  1Q9E A;  3O8Y A;  1ZGX A;  1STD A;  2ZHX B;  3GZY B;  1JN5 A;  1UDI I;  4ORL A;  5AIH A;  1QVF 2;  1BNI A;  3FLJ A;  3LT8 A;  1RN1 A;  3MPH A;  3I56 3;  4O8S A;  4EXR A;  2D1W A;  3K0Z A;  2HOH A;  1ASK A;  2XR8 B;  5ELU A;  1LQG C;  1LOX A;  1RHL A;  4HVN A;  2W56 B;  4JRF A;  4EYC A;  2Y73 A;  2PZV A;  1UGI A;  3LML A;  2XGL A;  1W02 A;  1IYY A;  5STD A;  5I97 A;  5M19 A;  1AR0 A;  1B2S A;  2XFS A;  1GMQ A;  4N6U A;  1VQM 3;  2OOV A;  1N5H A;  3L0R A;  1IVV A;  1T5Y A;  5BVB A;  5JPP A;  1Y4K A;  1HKX A;  4PEJ A;  1RGK A;  3PS8 A;  3QRD A;  3H51 A;  1GY5 A;  1FGQ A;  2IA7 A;  1AY7 A;  1BSA A;  2IMJ A;  3HOH A;  4O2H A;  2UUG C;  4FCM A;  3LT9 A;  4NRE A;  2MC8 A;  1M90 4;  2BT3 A;  3FCS B;  1FW7 A;  1W00 A;  3DXO A;  1YIT 3;  3WA3 A;  1VQ8 3;  3WDG B;  3CMA 3;  3VGN A;  1A90 A;  1W2Z A;  2W6J H;  2H0G A;  2V1L A;  1VQ5 3;  4HM6 B;  2QEX 3;  5IF6 A;  3SXX A;  3AMO A;  1UW1 A;  3JUM A;  3NV0 B;  3JUQ A;  4HOH A;  4K61 A;  3Q90 A;  5D82 A;  2CH9 A;  3DH2 A;  3GSP A;  4J9A A;  1RTU A;  3CCR 3;  3EBY A;  5JBS A;  1YGW A;  1JBT A;  3PXM A;  3ER7 A;  1FZU A;  3SOY A;  3KE7 A;  1QMA A;  1AQZ A;  4BU4 A;  3G8Z A;  4AKZ A;  3AGO A;  4HM3 B;  3WR2 A;  1FGM A;  2HMO B;  3DGO A;  2CFL A;  1IQ8 A;  2ML6 A;  2OQE C;  2ZA4 A;  3I55 3;  5LC7 A;  5BIR A;  4JF8 A;  1RGA A;  1BRK A;  2K0M A;  3M8C A;  3MKI A;  1S72 3;  1SQW A;  3DUK A;  2CFD A;  3WOE B;  1T2H A;  1QJG A;  1W6G A;  3DZL A;  3FZW A;  3KSP A;  1Q86 4;  3STD A;  4DKI A;  1V74 A;  2WGQ A;  2KXG A;  3MYT A;  4RNY A;  1B2U A;  3BNC A;  4NHF A;  5M1A A;  5IG5 A;  3EF8 A;  1FUS A;  4XB5 A;  1C7H A;  2YX9 A;  3GZX B;  1YJ9 3;  3EC9 A;  1VZZ A;  1JBS A;  4RBN A;  2C11 A;  1SIH A;  1MWS A;  2IUK A;  2AAD A;  2RSX A;  2XF3 A;  4FCJ A;  3NXJ A;  3FF0 A;  3SVA A;  1TUH A;  5BU4 A;  1AVL A;  2RGQ A;  3CCS 3;  2GEY A;  2W2C A;  1I70 A;  3KSE D;  5IG3 A;  6GSP A;  5CLK A;  3G6E 3;  1BNJ A;  2FNQ A;  2W9Q A;  1NU3 A;  1AVK A;  1MGR A;  3GAX A;  5IW9 A;  1ZS7 A;  4L8P A;  2JQ5 A;  4N6L A;  1RDS A;  1M1X B;  3D3L A;  4MMZ B;  4WHA A;  1YJW 3;  1OHO A;  1OPY A;  3FH1 A;  1JB2 A;  3OXA A;  1OHP A;  1PYL A;  1OGX A;  5D81 A;  4HM2 B;  3X40 A;  3AHS A;  3G4S 3;  1G96 A;  3CME 3;  1X1U A;  3LH4 A;  3LXU X;  5BXQ A;  2ZL8 A;  1GMP A;  4BIR A;  1O7W B;  1ULI B;  2Q07 A;  2BMO B;  1BAO A;  3DM8 A;  1L5G B;  2P0M A;  1T3B A;  3HIG A;  4HM0 B;  5AEU B;  2JDI H;  2OTL 3;  4L7K A;  1YVS A;  2F56 A;  1ULJ B;  3GZR A;  3K5T A;  1Q82 4;  4KFF A;  4FMC A;  2A15 A;  1TRP A;  3Q1C A;  3UL5 A;  3CCM 3;  1EKM A;  3LTC A;  4HKV B;  1UUW B;  1A2P A;  1W4N A;  1MNL A;  4EV2 A;  3V99 A;  2CC3 A;  2Z76 A;  1W6Y A;  1N8Q A;  2UGI A;  3N9H A;  3F14 A;  1RGE A;  1GY6 A;  1RGG A;  2CX1 A;  3EB8 A;  3D5I A;  2XSO B;  2F4Y A;  4FCZ A;  2R41 A;  4R4K A;  1MGW A;  1B2X A;  1Q40 A;  4CDL A;  2Z7A A;  1LQM B;  4KFE A;  1W7C A;  1LVN A;  2IY2 A;  2BMQ B;  3MWZ A;  2HMN B;  1UCJ A;  3I0Y A;  2CG0 A;  2CFW A;  1BNR A;  2BHM A;  3AMO B;  1GD3 A;  1T2I A;  3BNE A;  3NV0 A;  1EUI C;  2YFJ B;  3RNT A;  3U97 A;  1VQ7 3;  3BNB A;  3IMA B;  3BIR A;  1HYF A;  4CPK A;  3EJV A;  4WYK B;  4LEH A;  4H61 A;  1OGZ A;  1IK3 A;  2IUJ A;  3RGR A;  1VQN 3;  3DMC A;  4HBR A;  1S5A A;  3A5E A;  1BRH A;  3BB9 A;  3FGY A;  1D6Y A;  1VQQ A;  1VQO 3;  2FXT A;  3BND A;  5IG0 A;  3CCE 3;  1V58 A;  2HMJ B;  1ZO2 A;  3KCH A;  3V92 A;  1HU9 A;  3T8N A;  5A0O B;  5KP4 A;  1BNG A;  4ZM8 A;  2BO9 B;  2P38 A;  1UCK A;  3G0K A;  3NHX A;  1JKG B;  1O7P B;  2XH9 A;  1B27 A;  3AGN A;  3GRD A;  1TTO A;  3K63 A;  1IT7 A;  2CFG A;  3NBJ A;  1AV4 A;  3S29 A;  5M18 A;  8RNT A;  1LOW A;  1IVU A;  1JBR A;  1DVD A;  1GS3 A;  2SAR A;  5EVH A;  3V98 A;  2CWV A;  5G1L A;  3WHO A;  2GU3 A;  2H0I A;  2J8X B;  3B4P A;  1BRJ A;  1JZO A;  1RNB A;  3LZA A;  2BNG A;  1VQ6 3;  1B20 A;  1US1 A;  1CEW I;  3VF1 A;  3VSY A;  3GZB A;  1MWR A;  1OF5 B;  2WGO A;  1ZX2 A;  2R4I A;  2KAA A;  3ALA A;  4TX4 A;  4WWU C;  1JB5 A;  2CHC A;  2F5W A;  3H3H A;  4BL2 A;  4BTW A;  5G2G A;  8CHO A;  3RGA A;  2KF6 A;  1D6U A;  1RGF A;  4WP5 A;  1E3V A;  4XBT A;  3RDE A;  3AHW A;  3F7X A;  5CK6 A;  3OW2 2;  3MG1 A;  1IVW A;  3PCR A;  4OVM A;  2B24 B;  3CXC 2;  5HGR A;  1DET A;  2E2U A;  2YFI B;  4N6N B;  4O3V A;  1PU4 A;  3CC2 3;  2PNC A;  2CW9 A;  4HM5 B;  3S5C A;  4IPB A;  4NPB A;  1RJO A;  3S27 A;  1WMN A;  2KF4 A;  2OCT A;  3K9M C;  4MEI A;  5DRV A;  3OWU A;  1TIJ A;  3FKA A;  4HAA A;  3ROB A;  2LYX A;  4OK0 A;  1K8A 4;  2CX0 A;  3D4A A;  1X1X A;  1RKY A;  2E2V A;  1IVX A;  2BMR B;  1EG9 B;  2AAE A;  3LYG A;  1OHS A;  3UNL A;  3CPW 2;  4XBX A;  2GEX A;  3KKG A;  4EBG A;  2D42 A;  1RN7 A;  4N6V 0;  3G71 3;  5AIG A;  1BUJ A;  3CCU 3;  4G1M B;  3UB1 A;  3WA2 X;  3DY5 A;  3NBB A;  5CF1 A;  1FUT A;  1BAN A;  3DGN A;  2H0H A;  1K41 A;  1UCL A;  1RRH A;  4R9L A;  3B8L A;  2CK3 H;  1I2E A;  2I9W A;  1N5P A;  4RNT A;  3X3Z A;  4O02 B;  3OWS A;  3SYU A;  1STF I;  3LTD A;  3NBR A;  2F5M A;  2M7O A;  1E97 A;  2KCD A;  1TRQ A;  5AI1 A;  2XRX B;  3Q3F A;  1I3F A;  1EA2 A;  1BU4 A;  2HMK B;  3ZG5 A;  3PZW A;  1RGL A;  1IDP A;  4AKY A;  1BVI A;  1JNQ A;  2O9U X;  4RZM A;  4MMX B;  1JZD A;  3PYJ A;  5CXO A;  1KQS 2;  2UX0 A;  3NQZ A;  5TGN A;  3F9S A;  1E3R A;  3LOY A;  1B2M A;  1A67 A;  1VQ4 3;  3OWY A;  1QAK A;  3KZT A;  1GSP A;  4X2O A;  1BGS A;  1BNE A;  2BIR A;  1FGO A;  3MG3 A;  3MHE A;  3JUP A;  1CYU A;  4N6M A;  3S67 A;  3QK9 A;  4XBY A;  1UCI A;  3NUV A;  4LYL B;  4XDV A;  1FA3 A;  5ELJ A;  3T0U A;  9RNT A;  1WMP A;  1TFK A;  1WTH A;  1F8N A;  1U5O A;  3JUO A;  2RNT A;  4KZ1 A;  1BSE A;  4R1K A;  1B21 A;  1RLS A;  3UL6 A;  1VQP 3;  1YVB I;  1B3S A;  1GY7 A;  1JRQ A;  2W0Q A;  4HM4 B;  4ILF A;  5AEW B;  1RGC A;  1RCL A;  1O7G B;  2QA4 3;  4CJN A;  4K90 B;  3PGB A;  4IT7 A;  5AII A;  4AEQ A;  1M9G A;  2IYJ A;  3N54 B;  1RGH A;  4Q53 A;  1RSN A;  1SJW A;  4QWT A;  1OCV A;  1B2Z A;  1SAR A;  1YNV X;  4MMY B;  5IG4 A;  1BRI A;  1G0T A;  2XFT A;  3T8U A;  5IER A;  3IPT A;  1ROA A;  1W6C A;  3KII A;  4KT3 B;  3CCV 3;  2ML5 A;  1CQS A;  1PY3 A;  1RRL A;  2Z77 A;  3B4O A;  3G16 A;  2OTJ 3;  1OF5 A;  1R4Y A;  3X3X A;  1JN5 B;  1A2K A;  1SPU A;  1BRG A;  1KD1 4;  3B7C A;  3D5G A;  1ISK A;  1NB3 I;  3J7Y d;  3A76 A;  2BU4 A;  3CNM A;  4I4K A;  3ZG0 A;  2XGN A;  1FGR A;  3FG4 A;  3EX9 A;  1N9J A;  1I0V A;  1NWW A;  3DGM A;  4HM7 B;  2L1S A;  3U1W A;  4CCV A;  1JKG A;  3EN8 A;  1U8C B;  5AYS C;  1I8V A;  2F86 B;  4LSO A;  5IEO A;  3K7C A;  1UUV B;  4N6T A;  3EQQ B;  4N6O B;  2P0X A;  3SOA A;  7STD A;  1TFO A;  2GU1 A; 
#chains in the Genus database with same CATH homology
 1LOY A;  1FYS A;  2AAD A;  4J5K A;  2KF3 A;  3BU4 A;  5BU4 A;  1DET A;  3DGY A;  1I70 A;  1BRS A;  1GOU A;  6GSP A;  1BNJ A;  2RBI A;  2KF4 A;  1LNI A;  4HAA A;  1GMR A;  1MGR A;  1RNT A;  1RDS A;  3D4A A;  1GOV A;  1X1X A;  5RNT A;  1BSD A;  2AAE A;  1LRA A;  1BRN L;  1PYL A;  1I2G A;  3AHS A;  1BNF A;  1X1U A;  3URP A;  1BUJ A;  1GMP A;  1X1W A;  4BIR A;  1BSC A;  1Q9E A;  1ZGX A;  1DE3 A;  1FUT A;  1BAN A;  1BAO A;  1BNI A;  1UCL A;  1RN1 A;  4GSP A;  2C4B A;  1YVS A;  2F56 A;  1I2E A;  2HOH A;  4RNT A;  4GHO A;  1TRP A;  3SYU A;  1RCK A;  5GSP A;  1RHL A;  2F5M A;  4J5G A;  1A2P A;  6RNT A;  1TRQ A;  3Q3F A;  1I3F A;  1C54 A;  1BU4 A;  1RGL A;  1IYY A;  2GSP A;  1BVI A;  1CH0 A;  1RGE A;  1RGG A;  1B2S A;  1HZ1 A;  1BIR A;  1GMQ A;  3D5I A;  2F4Y A;  1MGW A;  1B2X A;  1B2M A;  1BSB A;  1UCJ A;  1BNS A;  1GSP A;  5HOH A;  1BGS A;  1RGK A;  1BNE A;  2BIR A;  1AY7 A;  1BSA A;  3HOH A;  1BNR A;  1X1Y A;  1FW7 A;  1T2I A;  1UCI A;  3RNT A;  3BIR A;  1HYF A;  9RNT A;  2RNT A;  1BSE A;  1B21 A;  1RLS A;  1B3S A;  1GOY A;  1BOX A;  3A5E A;  1BRH A;  1I2F A;  1RGC A;  7RNT A;  4HOH A;  1RCL A;  1I0X A;  1RMS A;  1G02 A;  3DH2 A;  3GSP A;  3KCH A;  1RTU A;  1RGH A;  1RSN A;  1BNG A;  1YGW A;  1B2Z A;  1SAR A;  1JBT A;  1YNV X;  1UCK A;  1BRI A;  1FZU A;  3AGN A;  1B27 A;  1TTO A;  4BU4 A;  1AQZ A;  8RNT A;  1LOW A;  1JBR A;  3AGO A;  3WR2 A;  1PY3 A;  2SAR A;  2KF5 A;  1R4Y A;  3WHO A;  2ZA4 A;  1BRJ A;  1BRG A;  1I3I A;  5BIR A;  3D5G A;  1RNB A;  1RGA A;  1BRK A;  2BU4 A;  1B20 A;  1RN4 A;  1I0V A;  7GSP A;  1LOV A;  1T2H A;  1I8V A;  2KAA A;  2F5W A;  1B2U A;  1FUS A;  2KF6 A;  1RGF A;  1JBS A;  3AHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...