3AHSA

Crystal structure of ustilago sphaerogena ribonuclease u2b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
CDIPQSTNCGGNVYSNDDINTAIQGALDDVAGDRPDNYPHQYYDEASEDITLCCGSGPWSEFPLVYNGPYYSSRDNYVSPGPDRVIYQTNTGEFCATVTHTGAASYDGFTQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease U2
publication title Structural changes induced by the deamidation and isomerization of asparagine revealed by the crystal structure of Ustilago sphaerogena ribonuclease U2B
pubmed doi rcsb
total genus 26
structure length 113
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 3.1.27.4: Transferred entry: 4.6.1.20.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3ahsA00
1BRSA 1BOXA 1HYFA 1BU4A 3KCHA 3AHSA 1B2SA 7GSPA 2KF6A 3HOHA 5RNTA 1AY7A 1RMSA 2AADA 5BIRA 2SARA 1RGAA 2RNTA 1RGLA 2KAAA 1BGSA 1BSCA 1DETA 4RNTA 5GSPA 7RNTA 1GOUA 1R4YA 1B2XA 3WHOA 1I2FA 1X1UA 4HOHA 1B2MA 1LRAA 1RSNA 1UCLA 1B21A 2F4YA 1PY3A 2KF4A 1UCJA 1RGGA 1G02A 1C54A 1BRNL 4J5GA 1BNGA 2ZA4A 3AGOA 1TRPA 1BSAA 1RLSA 1T2IA 4BU4A 1B27A 1I0VA 1BRJA 2BU4A 1GMQA 1UCKA 3A5EA 1B20A 1LOVA 1T2HA 3DH2A 4GHOA 3D5IA 1HZ1A 1BRIA 5HOHA 3BU4A 3D4AA 1I8VA 1RN4A 1I3FA 1BSBA 4J5KA 1I2GA 2F56A 1LNIA 1GSPA 2BIRA 1JBRA 1X1WA 1BNJA 1I0XA 2KF3A 3SYUA 1BNFA 6RNTA 1X1XA 1BSDA 3URPA 1FUTA 1BNRA 1DE3A 1RNBA 1X1YA 1LOWA 1RHLA 1AQZA 1YVSA 8RNTA 1B2ZA 1BVIA 1BRGA 3RNTA 5BU4A 1JBTA 1IYYA 3AGNA 1GOYA 1PYLA 1GMPA 3D5GA 1ZGXA 3Q3FA 1I70A 1SARA 2F5WA 1FYSA 4HAAA 4BIRA 1I2EA 1FUSA 1MGRA 1CH0A 4GSPA 1UCIA 1Q9EA 1BRHA 1RGCA 2GSPA 6GSPA 1JBSA 1LOYA 1BNSA 2C4BA 2F5MA 1BIRA 2AAEA 1RCLA 3GSPA 1A2PA 1BANA 1GOVA 1BSEA 3AHWA 1RDSA 2HOHA 1TTOA 1BNEA 1RGFA 3DGYA 9RNTA 1B3SA 1RTUA 1FZUA 1MGWA 1RCKA 2KF5A 1RNTA 1TRQA 1I3IA 1BAOA 3WR2A 1RGHA 1YNVX 1BUJA 1BNIA 1RGEA 2RBIA 3BIRA 1B2UA 1RGKA 1RN1A 1BRKA 1YGWA 1FW7A 1GMRA
chains in the Genus database with same CATH superfamily
2W56B 1VQL3 2A15A 3LOYA 1OGXA 1BOXA 2WOHA 4BL2A 1AVLA 1YJW3 4LSOA 1HKXA 5IG5A 3O8YA 3HOHA 1QAKA 5A0OB 1RMSA 1GD4A 2AADA 3CD63 3ZG0A 1M9GA 2XSOB 3NQZA 3PYJA 4LEHA 3X3YA 1FGQA 1Q7HA 2J8XB 2STDA 3CCQ3 2W6JH 2KAAA 1MWTA 2CFWA 2GXFA 3NUVA 1UUVB 4RNTA 3EN1B 2OOVA 3WOFB 1R4YA 4X2HA 4EC6A 1B2XA 3MSOA 2RFRA 1WNHA 1X1UA 5LC6A 1TFOA 1RSNA 1UCLA 1B21A 1O7HB 1OCVA 3HZPA 1MNLA 2BMOB 4HM5B 1E3VA 1OGZA 4O2HA 2IUKA 1JNQA 2Z77A 3DMCA 3AMOB 2OTJ3 2CG1A 2OQEA 3BLZA 1C54A 4BTWA 1N9JA 5FGOA 1C7HA 1QAFA 1YI23 3GZXB 4WFOA 4HBRA 3PZWA 4HM0B 1RLSA 3QK9A 4N6V0 4WWUC 3X41A 4CJNA 1VQM3 2KCDA 1BRJA 3NHXA 3EE1A 5AIIA 1B20A 3TDGA 1LOVA 3DH2A 4GHOA 3CC23 1BRIA 3BU4A 2OWPA 3LH4A 3T0UA 5G2GA 4IT7A 2XGNA 2HMKB 3IPTA 4XBTA 1MWUA 1UUWB 5CF1A 2F56A 1W01A 3QRDA 1YIJ3 1NO3A 1OF5B 3CCJ3 1O7WB 3LZAA 1VQQA 2K54A 3F9SA 2BIRA 4DKIA 1OHPA 4TX4A 2Z6BA 3HI7A 2QIYA 1BNJA 5AYRB 3OWSA 1OPYA 1BNFA 1Q864 3CCV3 2HMMB 4KFFA 1BSDA 2HMLB 3URPA 3J7Yd 2CG0A 4HM7B 1DE3A 1GD3A 3I563 2W9QA 1JN5B 1MWRA 3LYGA 1W6YA 1AQZA 8RNTA 4N3VA 1JBTA 1BUQA 3CMA3 3OWUA 1IYYA 1W7CA 4R9LA 3V98A 2MC8A 2CIUA 3D5GA 3BB9A 1ZX2A 1ZGXA 2E2VA 3F7SA 1I70A 3NM7A 1SARA 3NX0A 1L5GB 2XEPA 3GZYB 1VZZA 4BIRA 1I2EA 1MGRA 4GSPA 1UCIA 1DYUA 1JB4A 2HMOB 4L8OA 1D6ZA 1RGCA 4I4KA 3SOAA 4FMBA 4KFEA 1YGEA 1O7NB 3H3HA 1M1XB 2F5MA 2AAEA 1V57A 2CWVA 3GSPA 3CC43 4STDA 4LZIA 1US1A 3K5TA 5JPPA 1A2PA 3EJVA 1BANA 3LTBA 4J9AA 3V99A 3UL5A 1T5YA 3ALAA 3FGYA 4H3UA 4XBXA 9RNTA 2CWTA 3BNDA 1CYVA 1EEJA 3MG2A 3NV0B 3DZLA 2IYJA 2K3DA 1SPUA 1TRQA 1TU5A 1M1K4 1UDII 1OUNA 1BAOA 4N6UA 1S723 4IIAA 2WGOA 3PXMA 1N8QA 4MMZB 1BUJA 1FUWA 3BIRA 1EA2A 2ZDJA 1RGKA 2CX1A 2OCTA 2B1XB 1OHOA 1KD14 1A90A 1Q7Y4 3LTCA 4XDWA 1BRSA 3NM2A 4RBNA 3NBRA 3KCHA 1BU4A 3FG4A 2Y73A 3AHSA 3I0YA 7GSPA 2I9WA 1Q814 4HM8B 2CHCA 2P09A 1STDA 4K1VA 1O7MB 5BIRA 1FGRA 3SXXA 8CHOA 2FNQA 2XFTA 3SVAA 1E97A 3RGRA 3F7XA 1BGSA 1LQMB 4KFDA 1DETA 3L0RA 1CEWI 4AKYA 1IV7A 3WODG 4FMCA 5EVHA 3VF1A 1FGTA 5LC7A 3S5CA 2Y74A 1AV4A 3HX8A 1VQ83 1LRAA 3S28A 4ORLA 3MG1A 4XBYA 4CPKA 4K1UA 3DGOA 2QGUA 1KSIA 4FCZA 3CNMA 2CW9A 2W0QA 4KZ1A 4H61A 2BMRB 1LNHA 2ZA4A 4HYZA 4JF8A 1JKGB 3NBJA 3CCR3 1K734 2C11A 1RRHA 4HM2B 5AEUB 1UCKA 1OACA 1WMPA 3DGLA 3UNLA 1HZ1A 4R4KA 2QEX3 3B7CA 1VQK3 1U5OA 3D4AA 3CU3A 3CME3 2HMNB 3GAXA 1SJWA 1I8VA 3CNXA 3BNCA 1KC84 1DVDA 7STDA 1TUHA 4N6NB 1VQ63 3SEDA 3HK4A 5IF6A 1ULJB 1YIT3 1A67A 3ER7A 4EYCA 1IT8A 4PEJA 4HJLB 5KP3A 1IT7A 1LNIA 2GU3A 1GSPA 3JUOA 3NBBA 4NPBA 4OK0A 3NXJA 5D83A 3ROBA 4BTXA 1W00A 1I0XA 2KF3A 3X3ZA 1QMAA 5M1AA 5I97A 3M8CA 4RNZA 4XM4A 1NDOB 2E2UA 3EX9A 3KSED 3T8UA 4BTYA 4HM6B 3KZTA 2YX9A 1WMNA 1IVVA 3BNEA 3N54B 3LMLA 3CCM3 4IPBA 3UB1A 1G0TA 1LOWA 1RHLA 1SIHA 3G8ZA 3GZBA 1ZO2A 1BVIA 1NJI4 5BXQA 1NWWA 4OUQA 3AGNA 2LYXA 1JRQA 4I5QA 1GYBA 3Q3FA 3MWZA 1FYSA 2IY2A 5STDA 4BL3A 1VQ53 1IQXA 1GY7A 2CFKA 1QALA 3S29A 6GSPA 3CPW2 3F8HA 1LOYA 2C4BA 5IG3A 2E2TA 1BIRA 2R4IA 4FMAA 1RCLA 1IVXA 3KKGA 1JZOA 1GOVA 3WDGB 1GY6A 1BNEA 1RGFA 2D1WA 1B3SA 3D79A 1QVF2 4AKZA 1FZUA 1AR0A 3ECFA 1PFPA 1K8A4 1IVUA 1T3BA 1GS3A 2BNGA 2PZVA 2XSHB 3F8XA 1RNTA 3Q90A 3WOEB 1QJGA 5IEPA 3CCL3 1RGHA 4KVHA 1NB5I 4LYLB 2RBIA 4NHFA 5ELUA 2QA43 1VQ73 2ML6A 3PCRA 1K28A 1JB5A 4N6MA 1W2B2 4WYKA 1YGWA 3EN8A 1YHQ3 1FW7A 3DGMA 3DGNA 3MHEA 5M18A 4MMXB 3SOYA 2OOVC 1VQ93 2W03A 1J2BA 5JBSA 1D6UA 2BHMA 5EEOA 1DMNA 3UJMA 1DMMA 1UUGB 1W4NA 3CC73 2FGTA 2RNTA 1RGLA 1YJ93 3Q1CA 2JQ5A 5GSPA 3A76A 2SBLA 2KXGA 2XRXB 1EKMA 2W04A 2BO9B 2OQEC 3WHOA 4N6OB 1KWIA 4HOHA 4LGQA 1IQYA 3KSPA 1B2MA 4EBGA 3NQYA 1IV9A 1PY3A 2XR8B 4ILFA 3VSYA 1U8CB 4O02B 4EV2A 5CK6A 1LOXA 2CFLA 3FKAA 1WTHA 1FGOA 4HVNA 2W56A 4J5GA 3AGOA 1VQP3 1TRPA 4LMIA 2BMQB 3X3XA 3UL6A 2F98A 3CPOA 4FR9A 1T2IA 4RZMA 3WA2X 4BU4A 1B27A 1W6CA 1I0VA 5IG4A 1MWSA 1ULIB 1NU3A 1S5AA 2XGLA 3D5IA 2GU1A 3EQQB 4O3VA 3KFQC 4KT3B 4X2OA 5HOHA 1VQ43 2H0GA 3V92A 1OHSA 4R1KA 3LT9A 2O3OA 1I3FA 3PS8A 4O8SA 1BSBA 4J5KA 4OVMA 3FG1A 4WP5A 3D9RA 1V58A 3RGAA 5IEOA 1JJ22 3MKIA 3FCSB 3CCE3 3OV4A 2XF3A 1EG9B 1V74A 1UW1A 1STFI 2CWUA 3AMOA 1JBRA 2P0MA 3DY5A 5CXOA 3SYUA 1NB3I 1M904 4EW5A 6RNTA 1N9EA 1X1XA 1Y4KA 1TJDA 1FUTA 4QWTA 2CX0A 1N5HA 5IERA 3FF0A 1W6GA 2FXTA 1RNBA 1X1YA 4FCMA 1YVSA 2F99A 2ZL8A 4Q53A 2INXA 1LXEA 3D3LA 1BRGA 3IMAB 4CCVA 1VQN3 2Z76A 2CC3A 4L7KA 4MEIA 1GOYA 1PYLA 3DXOA 2H0IA 1UI8A 3N8BA 2RCDA 2B24B 5M19A 2IA7A 2F5WA 1K41A 3K7CA 4FCJA 2WGQA 1D6YA 1DMQA 1HU9A 1OF5A 2CFGA 3EB8A 4MJDA 3ZFZA 1W2ZA 4RNYA 3G713 2GSPA 2UUGC 2GEYA 3OX9A 3H51A 1BNSA 3T8NA 2M7OA 1W02A 5G1KA 5AIGA 3JUMA 3G6E3 3K0ZA 2P0XA 4MMYB 3EC9A 2IUJA 1Q40A 3AHWA 2W2CA 1SQWA 3B4PA 3RDEA 1N8R4 1TTOA 1A2VA 1JN5A 2Z7AA 3DGYA 1W5ZA 5AYSC 4HM4B 1IK3A 1CYUA 1RCKA 3G0KA 2GBXB 3E99A 2KF5A 3LT8A 3JUPA 5D82A 5CF2A 3N9HA 2ZHXB 1ASKA 1RKYA 1KQS2 4GL6A 1YNVX 1RN7A 1ROAA 4ZM8A 1RGEA 3FH1A 4WHAA 4HM3B 3S67A 2LQVA 3PCSA 4R9KA 1RN1A 2K0MA 3JUQA 2GEXA 3FLJA 3BNBA 1GMRA 1Q42A 2UX0A 3FF2A 4K61A 1HYFA 4R80A 1A2KA 4CDLA 3X42A 1RJOA 1B2SA 4NREA 2YFIB 2KF6A 5RNTA 3I553 1AY7A 2HMJB 2L4VA 2SARA 1JV2B 3FZWA 2C10A 2D42A 1RGAA 2L1SA 1O7PB 4JRFA 2OTL3 1BSCA 7RNTA 2JDIH 1GOUA 3NV0A 3MYTA 2F86B 1IVWA 1E3RA 2IMJA 2UGIA 1Q824 1UGHI 1I2FA 1Z1SA 2XH9A 5TGNA 5AIFA 5DRVA 4AEQA 5G1LA 3HIIA 2F4YA 2KF4A 1TFKA 2BT3A 1UCJA 1RGGA 3EBYA 5FW5A 3WMDA 1G02A 2KRTA 1BRNL 1LQGC 1BNGA 2R41A 3FG3A 3OXAA 5KP4A 2WO0A 3KE7A 1BSAA 1Q40B 2WOFA 3WA3A 2BU4A 3S27A 3JVCA 5IG0A 1GMQA 3A5EA 3DM8A 3PGBA 1T2HA 1DVCA 3FSDA 3GWRA 3HIGA 3KIIA 3Q2PA 1MOLA 1RN4A 3EHCA 2CH9A 2MF7A 3G16A 3MG3A 4EV5A 1YJN3 1SIIA 1I2GA 2H0HA 1IQ8A 3GRDA 2XFSA 3MPHA 4GB5A 3U1WA 3B8LA 1VQO3 2RGQA 4L8PA 3VGNA 1TP6A 3CCS3 1UGIA 3KN4A 1QVG2 4EXRA 2PNCA 5D81A 5IENA 3CCU3 1CQSA 5AIHA 2RSXA 1LVNA 5JPUA 4FMDA 1X1WA 1ISKA 1K9M4 1JKGA 2P05A 1JZDA 1BNRA 1O7GB 1F8NA 1WQLB 2Q07A 3GZRA 2CFDA 1FGMA 1NNVA 1ZS7A 3JUNA 3LXUX 4HZ9B 3SX1A 4N6TA 1B2ZA 3RNTA 5BU4A 2P38A 3ZG5A 1N5PA 1FA3A 1GMPA 1WMOA 3EF8A 1PU4A 1RRLA 3EBTA 3U97A 4HKVB 3B4OA 2CKFB 1AVKA 4U13A 2W9PA 4HAAA 1TIJA 2O9UX 1FUSA 1CH0A 1Q9EA 2GBWB 3DUKA 4J8TA 1OH0A 1BRHA 3F40A 3LTDA 4XB5A 2ML5A 3K9MC 2CK3H 4WYKB 3X40A 5IW9A 1JBSA 2YFLB 1IDPA 2YFJB 4K90B 3G4S3 5CLKA 5AEWB 3STDA 3K63A 1EUIC 2V1LA 3OWYA 4XDVA 5DREA 5BVBA 1IU7A 5EQLA 1BSEA 1RDSA 2HOHA 1G96A 3SLUA 1UI7A 1RTUA 1EQKA 1MGWA 3IJEB 4N6LA 6STDA 1I3IA 3WR2A 1GY5A 3CXC2 5HGRA 3OW22 1BNIA 1ROVA 4G1MB 1R4CA 5ELJA 5KP1A 1B2UA 3F14A 1JB2A 1BRKA 4HM1B 5AI1A 4HZBB 1YVBI 3LTAA
chains in the Genus database with same CATH topology
1BRSA 1BOXA 1HYFA 1BU4A 3KCHA 3AHSA 1B2SA 7GSPA 2KF6A 3HOHA 5RNTA 1AY7A 1RMSA 2AADA 5BIRA 2SARA 1RGAA 2RNTA 1RGLA 2KAAA 1BGSA 1BSCA 1DETA 4RNTA 5GSPA 7RNTA 1GOUA 1R4YA 1B2XA 3WHOA 1I2FA 1X1UA 4HOHA 1B2MA 1LRAA 1RSNA 1UCLA 1B21A 2F4YA 1PY3A 2KF4A 1UCJA 1RGGA 1G02A 1C54A 1BRNL 4J5GA 1BNGA 2ZA4A 3AGOA 1TRPA 1BSAA 1RLSA 1T2IA 4BU4A 1B27A 1I0VA 1BRJA 2BU4A 1GMQA 1UCKA 3A5EA 1B20A 1LOVA 1T2HA 3DH2A 4GHOA 3D5IA 1HZ1A 1BRIA 5HOHA 3BU4A 3D4AA 1I8VA 1RN4A 1I3FA 1BSBA 4J5KA 1I2GA 2F56A 1LNIA 1GSPA 2BIRA 1JBRA 1X1WA 1BNJA 1I0XA 2KF3A 3SYUA 1BNFA 6RNTA 1X1XA 1BSDA 3URPA 1FUTA 1BNRA 1DE3A 1RNBA 1X1YA 1LOWA 1RHLA 1AQZA 1YVSA 8RNTA 1B2ZA 1BVIA 1BRGA 3RNTA 5BU4A 1JBTA 1IYYA 3AGNA 1GOYA 1PYLA 1GMPA 3D5GA 1ZGXA 3Q3FA 1I70A 1SARA 2F5WA 1FYSA 4HAAA 4BIRA 1I2EA 1FUSA 1MGRA 1CH0A 4GSPA 1UCIA 1Q9EA 1BRHA 1RGCA 2GSPA 6GSPA 1JBSA 1LOYA 1BNSA 2C4BA 2F5MA 1BIRA 2AAEA 1RCLA 3GSPA 1A2PA 1BANA 1GOVA 1BSEA 3AHWA 1RDSA 2HOHA 1TTOA 1BNEA 1RGFA 3DGYA 9RNTA 1B3SA 1RTUA 1FZUA 1MGWA 1RCKA 2KF5A 1RNTA 1TRQA 1I3IA 1BAOA 3WR2A 1RGHA 1YNVX 1BUJA 1BNIA 1RGEA 2RBIA 3BIRA 1B2UA 1RGKA 1RN1A 1BRKA 1YGWA 1FW7A 1GMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRS A;  1BOX A;  1HYF A;  1BU4 A;  3KCH A;  3AHS A;  1B2S A;  7GSP A;  2KF6 A;  3HOH A;  5RNT A;  1AY7 A;  1RMS A;  2AAD A;  5BIR A;  2SAR A;  1RGA A;  2RNT A;  1RGL A;  2KAA A;  1BGS A;  1BSC A;  1DET A;  4RNT A;  5GSP A;  7RNT A;  1GOU A;  1R4Y A;  1B2X A;  3WHO A;  1I2F A;  1X1U A;  4HOH A;  1B2M A;  1LRA A;  1RSN A;  1UCL A;  1B21 A;  2F4Y A;  1PY3 A;  2KF4 A;  1UCJ A;  1RGG A;  1G02 A;  1C54 A;  1BRN L;  4J5G A;  1BNG A;  2ZA4 A;  3AGO A;  1TRP A;  1BSA A;  1RLS A;  1T2I A;  4BU4 A;  1B27 A;  1I0V A;  1BRJ A;  2BU4 A;  1GMQ A;  1UCK A;  3A5E A;  1B20 A;  1LOV A;  1T2H A;  3DH2 A;  4GHO A;  3D5I A;  1HZ1 A;  1BRI A;  5HOH A;  3BU4 A;  3D4A A;  1I8V A;  1RN4 A;  1I3F A;  1BSB A;  4J5K A;  1I2G A;  2F56 A;  1LNI A;  1GSP A;  2BIR A;  1JBR A;  1X1W A;  1BNJ A;  1I0X A;  2KF3 A;  3SYU A;  1BNF A;  6RNT A;  1X1X A;  1BSD A;  3URP A;  1FUT A;  1BNR A;  1DE3 A;  1RNB A;  1X1Y A;  1LOW A;  1RHL A;  1AQZ A;  1YVS A;  8RNT A;  1B2Z A;  1BVI A;  1BRG A;  3RNT A;  5BU4 A;  1JBT A;  1IYY A;  3AGN A;  1GOY A;  1PYL A;  1GMP A;  3D5G A;  1ZGX A;  3Q3F A;  1I70 A;  1SAR A;  2F5W A;  1FYS A;  4HAA A;  4BIR A;  1I2E A;  1FUS A;  1MGR A;  1CH0 A;  4GSP A;  1UCI A;  1Q9E A;  1BRH A;  1RGC A;  2GSP A;  6GSP A;  1JBS A;  1LOY A;  1BNS A;  2C4B A;  2F5M A;  1BIR A;  2AAE A;  1RCL A;  3GSP A;  1A2P A;  1BAN A;  1GOV A;  1BSE A;  3AHW A;  1RDS A;  2HOH A;  1TTO A;  1BNE A;  1RGF A;  3DGY A;  9RNT A;  1B3S A;  1RTU A;  1FZU A;  1MGW A;  1RCK A;  2KF5 A;  1RNT A;  1TRQ A;  1I3I A;  1BAO A;  3WR2 A;  1RGH A;  1YNV X;  1BUJ A;  1BNI A;  1RGE A;  2RBI A;  3BIR A;  1B2U A;  1RGK A;  1RN1 A;  1BRK A;  1YGW A;  1FW7 A;  1GMR A; 
#chains in the Genus database with same CATH topology
 2W56 B;  1VQL 3;  2A15 A;  3LOY A;  1OGX A;  1BOX A;  2WOH A;  4BL2 A;  1AVL A;  1YJW 3;  4LSO A;  1HKX A;  5IG5 A;  3O8Y A;  3HOH A;  1QAK A;  5A0O B;  1RMS A;  1GD4 A;  2AAD A;  3CD6 3;  3ZG0 A;  1M9G A;  2XSO B;  3NQZ A;  3PYJ A;  4LEH A;  3X3Y A;  1FGQ A;  1Q7H A;  2J8X B;  2STD A;  3CCQ 3;  2W6J H;  2KAA A;  1MWT A;  2CFW A;  2GXF A;  3NUV A;  1UUV B;  4RNT A;  3EN1 B;  2OOV A;  3WOF B;  1R4Y A;  4X2H A;  4EC6 A;  1B2X A;  3MSO A;  2RFR A;  1WNH A;  1X1U A;  5LC6 A;  1TFO A;  1RSN A;  1UCL A;  1B21 A;  1O7H B;  1OCV A;  3HZP A;  1MNL A;  2BMO B;  4HM5 B;  1E3V A;  1OGZ A;  4O2H A;  2IUK A;  1JNQ A;  2Z77 A;  3DMC A;  3AMO B;  2OTJ 3;  2CG1 A;  2OQE A;  3BLZ A;  1C54 A;  4BTW A;  1N9J A;  5FGO A;  1C7H A;  1QAF A;  1YI2 3;  3GZX B;  4WFO A;  4HBR A;  3PZW A;  4HM0 B;  1RLS A;  3QK9 A;  4N6V 0;  4WWU C;  3X41 A;  4CJN A;  1VQM 3;  2KCD A;  1BRJ A;  3NHX A;  3EE1 A;  5AII A;  1B20 A;  3TDG A;  1LOV A;  3DH2 A;  4GHO A;  3CC2 3;  1BRI A;  3BU4 A;  2OWP A;  3LH4 A;  3T0U A;  5G2G A;  4IT7 A;  2XGN A;  2HMK B;  3IPT A;  4XBT A;  1MWU A;  1UUW B;  5CF1 A;  2F56 A;  1W01 A;  3QRD A;  1YIJ 3;  1NO3 A;  1OF5 B;  3CCJ 3;  1O7W B;  3LZA A;  1VQQ A;  2K54 A;  3F9S A;  2BIR A;  4DKI A;  1OHP A;  4TX4 A;  2Z6B A;  3HI7 A;  2QIY A;  1BNJ A;  5AYR B;  3OWS A;  1OPY A;  1BNF A;  1Q86 4;  3CCV 3;  2HMM B;  4KFF A;  1BSD A;  2HML B;  3URP A;  3J7Y d;  2CG0 A;  4HM7 B;  1DE3 A;  1GD3 A;  3I56 3;  2W9Q A;  1JN5 B;  1MWR A;  3LYG A;  1W6Y A;  1AQZ A;  8RNT A;  4N3V A;  1JBT A;  1BUQ A;  3CMA 3;  3OWU A;  1IYY A;  1W7C A;  4R9L A;  3V98 A;  2MC8 A;  2CIU A;  3D5G A;  3BB9 A;  1ZX2 A;  1ZGX A;  2E2V A;  3F7S A;  1I70 A;  3NM7 A;  1SAR A;  3NX0 A;  1L5G B;  2XEP A;  3GZY B;  1VZZ A;  4BIR A;  1I2E A;  1MGR A;  4GSP A;  1UCI A;  1DYU A;  1JB4 A;  2HMO B;  4L8O A;  1D6Z A;  1RGC A;  4I4K A;  3SOA A;  4FMB A;  4KFE A;  1YGE A;  1O7N B;  3H3H A;  1M1X B;  2F5M A;  2AAE A;  1V57 A;  2CWV A;  3GSP A;  3CC4 3;  4STD A;  4LZI A;  1US1 A;  3K5T A;  5JPP A;  1A2P A;  3EJV A;  1BAN A;  3LTB A;  4J9A A;  3V99 A;  3UL5 A;  1T5Y A;  3ALA A;  3FGY A;  4H3U A;  4XBX A;  9RNT A;  2CWT A;  3BND A;  1CYV A;  1EEJ A;  3MG2 A;  3NV0 B;  3DZL A;  2IYJ A;  2K3D A;  1SPU A;  1TRQ A;  1TU5 A;  1M1K 4;  1UDI I;  1OUN A;  1BAO A;  4N6U A;  1S72 3;  4IIA A;  2WGO A;  3PXM A;  1N8Q A;  4MMZ B;  1BUJ A;  1FUW A;  3BIR A;  1EA2 A;  2ZDJ A;  1RGK A;  2CX1 A;  2OCT A;  2B1X B;  1OHO A;  1KD1 4;  1A90 A;  1Q7Y 4;  3LTC A;  4XDW A;  1BRS A;  3NM2 A;  4RBN A;  3NBR A;  3KCH A;  1BU4 A;  3FG4 A;  2Y73 A;  3AHS A;  3I0Y A;  7GSP A;  2I9W A;  1Q81 4;  4HM8 B;  2CHC A;  2P09 A;  1STD A;  4K1V A;  1O7M B;  5BIR A;  1FGR A;  3SXX A;  8CHO A;  2FNQ A;  2XFT A;  3SVA A;  1E97 A;  3RGR A;  3F7X A;  1BGS A;  1LQM B;  4KFD A;  1DET A;  3L0R A;  1CEW I;  4AKY A;  1IV7 A;  3WOD G;  4FMC A;  5EVH A;  3VF1 A;  1FGT A;  5LC7 A;  3S5C A;  2Y74 A;  1AV4 A;  3HX8 A;  1VQ8 3;  1LRA A;  3S28 A;  4ORL A;  3MG1 A;  4XBY A;  4CPK A;  4K1U A;  3DGO A;  2QGU A;  1KSI A;  4FCZ A;  3CNM A;  2CW9 A;  2W0Q A;  4KZ1 A;  4H61 A;  2BMR B;  1LNH A;  2ZA4 A;  4HYZ A;  4JF8 A;  1JKG B;  3NBJ A;  3CCR 3;  1K73 4;  2C11 A;  1RRH A;  4HM2 B;  5AEU B;  1UCK A;  1OAC A;  1WMP A;  3DGL A;  3UNL A;  1HZ1 A;  4R4K A;  2QEX 3;  3B7C A;  1VQK 3;  1U5O A;  3D4A A;  3CU3 A;  3CME 3;  2HMN B;  3GAX A;  1SJW A;  1I8V A;  3CNX A;  3BNC A;  1KC8 4;  1DVD A;  7STD A;  1TUH A;  4N6N B;  1VQ6 3;  3SED A;  3HK4 A;  5IF6 A;  1ULJ B;  1YIT 3;  1A67 A;  3ER7 A;  4EYC A;  1IT8 A;  4PEJ A;  4HJL B;  5KP3 A;  1IT7 A;  1LNI A;  2GU3 A;  1GSP A;  3JUO A;  3NBB A;  4NPB A;  4OK0 A;  3NXJ A;  5D83 A;  3ROB A;  4BTX A;  1W00 A;  1I0X A;  2KF3 A;  3X3Z A;  1QMA A;  5M1A A;  5I97 A;  3M8C A;  4RNZ A;  4XM4 A;  1NDO B;  2E2U A;  3EX9 A;  3KSE D;  3T8U A;  4BTY A;  4HM6 B;  3KZT A;  2YX9 A;  1WMN A;  1IVV A;  3BNE A;  3N54 B;  3LML A;  3CCM 3;  4IPB A;  3UB1 A;  1G0T A;  1LOW A;  1RHL A;  1SIH A;  3G8Z A;  3GZB A;  1ZO2 A;  1BVI A;  1NJI 4;  5BXQ A;  1NWW A;  4OUQ A;  3AGN A;  2LYX A;  1JRQ A;  4I5Q A;  1GYB A;  3Q3F A;  3MWZ A;  1FYS A;  2IY2 A;  5STD A;  4BL3 A;  1VQ5 3;  1IQX A;  1GY7 A;  2CFK A;  1QAL A;  3S29 A;  6GSP A;  3CPW 2;  3F8H A;  1LOY A;  2C4B A;  5IG3 A;  2E2T A;  1BIR A;  2R4I A;  4FMA A;  1RCL A;  1IVX A;  3KKG A;  1JZO A;  1GOV A;  3WDG B;  1GY6 A;  1BNE A;  1RGF A;  2D1W A;  1B3S A;  3D79 A;  1QVF 2;  4AKZ A;  1FZU A;  1AR0 A;  3ECF A;  1PFP A;  1K8A 4;  1IVU A;  1T3B A;  1GS3 A;  2BNG A;  2PZV A;  2XSH B;  3F8X A;  1RNT A;  3Q90 A;  3WOE B;  1QJG A;  5IEP A;  3CCL 3;  1RGH A;  4KVH A;  1NB5 I;  4LYL B;  2RBI A;  4NHF A;  5ELU A;  2QA4 3;  1VQ7 3;  2ML6 A;  3PCR A;  1K28 A;  1JB5 A;  4N6M A;  1W2B 2;  4WYK A;  1YGW A;  3EN8 A;  1YHQ 3;  1FW7 A;  3DGM A;  3DGN A;  3MHE A;  5M18 A;  4MMX B;  3SOY A;  2OOV C;  1VQ9 3;  2W03 A;  1J2B A;  5JBS A;  1D6U A;  2BHM A;  5EEO A;  1DMN A;  3UJM A;  1DMM A;  1UUG B;  1W4N A;  3CC7 3;  2FGT A;  2RNT A;  1RGL A;  1YJ9 3;  3Q1C A;  2JQ5 A;  5GSP A;  3A76 A;  2SBL A;  2KXG A;  2XRX B;  1EKM A;  2W04 A;  2BO9 B;  2OQE C;  3WHO A;  4N6O B;  1KWI A;  4HOH A;  4LGQ A;  1IQY A;  3KSP A;  1B2M A;  4EBG A;  3NQY A;  1IV9 A;  1PY3 A;  2XR8 B;  4ILF A;  3VSY A;  1U8C B;  4O02 B;  4EV2 A;  5CK6 A;  1LOX A;  2CFL A;  3FKA A;  1WTH A;  1FGO A;  4HVN A;  2W56 A;  4J5G A;  3AGO A;  1VQP 3;  1TRP A;  4LMI A;  2BMQ B;  3X3X A;  3UL6 A;  2F98 A;  3CPO A;  4FR9 A;  1T2I A;  4RZM A;  3WA2 X;  4BU4 A;  1B27 A;  1W6C A;  1I0V A;  5IG4 A;  1MWS A;  1ULI B;  1NU3 A;  1S5A A;  2XGL A;  3D5I A;  2GU1 A;  3EQQ B;  4O3V A;  3KFQ C;  4KT3 B;  4X2O A;  5HOH A;  1VQ4 3;  2H0G A;  3V92 A;  1OHS A;  4R1K A;  3LT9 A;  2O3O A;  1I3F A;  3PS8 A;  4O8S A;  1BSB A;  4J5K A;  4OVM A;  3FG1 A;  4WP5 A;  3D9R A;  1V58 A;  3RGA A;  5IEO A;  1JJ2 2;  3MKI A;  3FCS B;  3CCE 3;  3OV4 A;  2XF3 A;  1EG9 B;  1V74 A;  1UW1 A;  1STF I;  2CWU A;  3AMO A;  1JBR A;  2P0M A;  3DY5 A;  5CXO A;  3SYU A;  1NB3 I;  1M90 4;  4EW5 A;  6RNT A;  1N9E A;  1X1X A;  1Y4K A;  1TJD A;  1FUT A;  4QWT A;  2CX0 A;  1N5H A;  5IER A;  3FF0 A;  1W6G A;  2FXT A;  1RNB A;  1X1Y A;  4FCM A;  1YVS A;  2F99 A;  2ZL8 A;  4Q53 A;  2INX A;  1LXE A;  3D3L A;  1BRG A;  3IMA B;  4CCV A;  1VQN 3;  2Z76 A;  2CC3 A;  4L7K A;  4MEI A;  1GOY A;  1PYL A;  3DXO A;  2H0I A;  1UI8 A;  3N8B A;  2RCD A;  2B24 B;  5M19 A;  2IA7 A;  2F5W A;  1K41 A;  3K7C A;  4FCJ A;  2WGQ A;  1D6Y A;  1DMQ A;  1HU9 A;  1OF5 A;  2CFG A;  3EB8 A;  4MJD A;  3ZFZ A;  1W2Z A;  4RNY A;  3G71 3;  2GSP A;  2UUG C;  2GEY A;  3OX9 A;  3H51 A;  1BNS A;  3T8N A;  2M7O A;  1W02 A;  5G1K A;  5AIG A;  3JUM A;  3G6E 3;  3K0Z A;  2P0X A;  4MMY B;  3EC9 A;  2IUJ A;  1Q40 A;  3AHW A;  2W2C A;  1SQW A;  3B4P A;  3RDE A;  1N8R 4;  1TTO A;  1A2V A;  1JN5 A;  2Z7A A;  3DGY A;  1W5Z A;  5AYS C;  4HM4 B;  1IK3 A;  1CYU A;  1RCK A;  3G0K A;  2GBX B;  3E99 A;  2KF5 A;  3LT8 A;  3JUP A;  5D82 A;  5CF2 A;  3N9H A;  2ZHX B;  1ASK A;  1RKY A;  1KQS 2;  4GL6 A;  1YNV X;  1RN7 A;  1ROA A;  4ZM8 A;  1RGE A;  3FH1 A;  4WHA A;  4HM3 B;  3S67 A;  2LQV A;  3PCS A;  4R9K A;  1RN1 A;  2K0M A;  3JUQ A;  2GEX A;  3FLJ A;  3BNB A;  1GMR A;  1Q42 A;  2UX0 A;  3FF2 A;  4K61 A;  1HYF A;  4R80 A;  1A2K A;  4CDL A;  3X42 A;  1RJO A;  1B2S A;  4NRE A;  2YFI B;  2KF6 A;  5RNT A;  3I55 3;  1AY7 A;  2HMJ B;  2L4V A;  2SAR A;  1JV2 B;  3FZW A;  2C10 A;  2D42 A;  1RGA A;  2L1S A;  1O7P B;  4JRF A;  2OTL 3;  1BSC A;  7RNT A;  2JDI H;  1GOU A;  3NV0 A;  3MYT A;  2F86 B;  1IVW A;  1E3R A;  2IMJ A;  2UGI A;  1Q82 4;  1UGH I;  1I2F A;  1Z1S A;  2XH9 A;  5TGN A;  5AIF A;  5DRV A;  4AEQ A;  5G1L A;  3HII A;  2F4Y A;  2KF4 A;  1TFK A;  2BT3 A;  1UCJ A;  1RGG A;  3EBY A;  5FW5 A;  3WMD A;  1G02 A;  2KRT A;  1BRN L;  1LQG C;  1BNG A;  2R41 A;  3FG3 A;  3OXA A;  5KP4 A;  2WO0 A;  3KE7 A;  1BSA A;  1Q40 B;  2WOF A;  3WA3 A;  2BU4 A;  3S27 A;  3JVC A;  5IG0 A;  1GMQ A;  3A5E A;  3DM8 A;  3PGB A;  1T2H A;  1DVC A;  3FSD A;  3GWR A;  3HIG A;  3KII A;  3Q2P A;  1MOL A;  1RN4 A;  3EHC A;  2CH9 A;  2MF7 A;  3G16 A;  3MG3 A;  4EV5 A;  1YJN 3;  1SII A;  1I2G A;  2H0H A;  1IQ8 A;  3GRD A;  2XFS A;  3MPH A;  4GB5 A;  3U1W A;  3B8L A;  1VQO 3;  2RGQ A;  4L8P A;  3VGN A;  1TP6 A;  3CCS 3;  1UGI A;  3KN4 A;  1QVG 2;  4EXR A;  2PNC A;  5D81 A;  5IEN A;  3CCU 3;  1CQS A;  5AIH A;  2RSX A;  1LVN A;  5JPU A;  4FMD A;  1X1W A;  1ISK A;  1K9M 4;  1JKG A;  2P05 A;  1JZD A;  1BNR A;  1O7G B;  1F8N A;  1WQL B;  2Q07 A;  3GZR A;  2CFD A;  1FGM A;  1NNV A;  1ZS7 A;  3JUN A;  3LXU X;  4HZ9 B;  3SX1 A;  4N6T A;  1B2Z A;  3RNT A;  5BU4 A;  2P38 A;  3ZG5 A;  1N5P A;  1FA3 A;  1GMP A;  1WMO A;  3EF8 A;  1PU4 A;  1RRL A;  3EBT A;  3U97 A;  4HKV B;  3B4O A;  2CKF B;  1AVK A;  4U13 A;  2W9P A;  4HAA A;  1TIJ A;  2O9U X;  1FUS A;  1CH0 A;  1Q9E A;  2GBW B;  3DUK A;  4J8T A;  1OH0 A;  1BRH A;  3F40 A;  3LTD A;  4XB5 A;  2ML5 A;  3K9M C;  2CK3 H;  4WYK B;  3X40 A;  5IW9 A;  1JBS A;  2YFL B;  1IDP A;  2YFJ B;  4K90 B;  3G4S 3;  5CLK A;  5AEW B;  3STD A;  3K63 A;  1EUI C;  2V1L A;  3OWY A;  4XDV A;  5DRE A;  5BVB A;  1IU7 A;  5EQL A;  1BSE A;  1RDS A;  2HOH A;  1G96 A;  3SLU A;  1UI7 A;  1RTU A;  1EQK A;  1MGW A;  3IJE B;  4N6L A;  6STD A;  1I3I A;  3WR2 A;  1GY5 A;  3CXC 2;  5HGR A;  3OW2 2;  1BNI A;  1ROV A;  4G1M B;  1R4C A;  5ELJ A;  5KP1 A;  1B2U A;  3F14 A;  1JB2 A;  1BRK A;  4HM1 B;  5AI1 A;  4HZB B;  1YVB I;  3LTA A; 
#chains in the Genus database with same CATH homology
 1BRS A;  1BOX A;  1HYF A;  1BU4 A;  3KCH A;  3AHS A;  1B2S A;  7GSP A;  2KF6 A;  3HOH A;  5RNT A;  1AY7 A;  1RMS A;  2AAD A;  5BIR A;  2SAR A;  1RGA A;  2RNT A;  1RGL A;  2KAA A;  1BGS A;  1BSC A;  1DET A;  4RNT A;  5GSP A;  7RNT A;  1GOU A;  1R4Y A;  1B2X A;  3WHO A;  1I2F A;  1X1U A;  4HOH A;  1B2M A;  1LRA A;  1RSN A;  1UCL A;  1B21 A;  2F4Y A;  1PY3 A;  2KF4 A;  1UCJ A;  1RGG A;  1G02 A;  1C54 A;  1BRN L;  4J5G A;  1BNG A;  2ZA4 A;  3AGO A;  1TRP A;  1BSA A;  1RLS A;  1T2I A;  4BU4 A;  1B27 A;  1I0V A;  1BRJ A;  2BU4 A;  1GMQ A;  1UCK A;  3A5E A;  1B20 A;  1LOV A;  1T2H A;  3DH2 A;  4GHO A;  3D5I A;  1HZ1 A;  1BRI A;  5HOH A;  3BU4 A;  3D4A A;  1I8V A;  1RN4 A;  1I3F A;  1BSB A;  4J5K A;  1I2G A;  2F56 A;  1LNI A;  1GSP A;  2BIR A;  1JBR A;  1X1W A;  1BNJ A;  1I0X A;  2KF3 A;  3SYU A;  1BNF A;  6RNT A;  1X1X A;  1BSD A;  3URP A;  1FUT A;  1BNR A;  1DE3 A;  1RNB A;  1X1Y A;  1LOW A;  1RHL A;  1AQZ A;  1YVS A;  8RNT A;  1B2Z A;  1BVI A;  1BRG A;  3RNT A;  5BU4 A;  1JBT A;  1IYY A;  3AGN A;  1GOY A;  1PYL A;  1GMP A;  3D5G A;  1ZGX A;  3Q3F A;  1I70 A;  1SAR A;  2F5W A;  1FYS A;  4HAA A;  4BIR A;  1I2E A;  1FUS A;  1MGR A;  1CH0 A;  4GSP A;  1UCI A;  1Q9E A;  1BRH A;  1RGC A;  2GSP A;  6GSP A;  1JBS A;  1LOY A;  1BNS A;  2C4B A;  2F5M A;  1BIR A;  2AAE A;  1RCL A;  3GSP A;  1A2P A;  1BAN A;  1GOV A;  1BSE A;  3AHW A;  1RDS A;  2HOH A;  1TTO A;  1BNE A;  1RGF A;  3DGY A;  9RNT A;  1B3S A;  1RTU A;  1FZU A;  1MGW A;  1RCK A;  2KF5 A;  1RNT A;  1TRQ A;  1I3I A;  1BAO A;  3WR2 A;  1RGH A;  1YNV X;  1BUJ A;  1BNI A;  1RGE A;  2RBI A;  3BIR A;  1B2U A;  1RGK A;  1RN1 A;  1BRK A;  1YGW A;  1FW7 A;  1GMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...