3AHSA

Crystal structure of ustilago sphaerogena ribonuclease u2b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
113
Chain Sequence
b'CDIPQSTNCGGNVYSNDDINTAIQGALDDVAGDRPDNYPHQYYDEASEDITLCCGSGPWSEFPLVYNGPYYSSRDNYVSPGPDRVIYQTNTGEFCATVTHTGAASYDGFTQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease U2
publication title Structural changes induced by the deamidation and isomerization of asparagine revealed by the crystal structure of Ustilago sphaerogena ribonuclease U2B
pubmed doi rcsb
molecule tags Hydrolase
total genus 26
structure length 113
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 3.1.27.4: Transferred entry: 4.6.1.20.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3ahsA00
1BNSA 1I0VA 4GHOA 1BRJA 1FYSA 3AGNA 1BU4A 1BANA 1LOYA 2KF4A 1FUSA 1AY7A 1B2ZA 4HOHA 5BIRA 5RNTA 1BNIA 1RGCA 2BU4A 1I70A 3GSPA 7GSPA 1RGFA 1GSPA 1BNRA 1MGRA 1DETA 1BRIA 1GMQA 3WHOA 1RCKA 1BRSA 1GOYA 1HZ1A 1PYLA 2AAEA 1RTUA 1BAOA 4HAAA 2KF6A 1BRKA 1TRQA 1I3FA 1GOVA 1LOVA 1B2SA 1BNGA 1X1WA 1RGEA 1RCLA 3WR2A 1B21A 1JBSA 1CH0A 1Q9EA 2SARA 1TTOA 3AGOA 6GSPA 1RMSA 3AHSA 9RNTA 1FW7A 1BRNL 1BNJA 4BIRA 1FUTA 1BSEA 1AQZA 1GMPA 1YNVX 4RNTA 1BGSA 3BIRA 1X1YA 3URPA 1UCKA 2KAAA 1JBRA 1B20A 1RGLA 1BVIA 1RGGA 2F5MA 1DE3A 1RGAA 1BRGA 3D4AA 1B2XA 1BRHA 2HOHA 1TRPA 3AHWA 1RHLA 2KF3A 1BSCA 1ZGXA 2AADA 1RGKA 2BIRA 1A2PA 1SARA 1RN1A 1RNTA 1LOWA 1G02A 3D5GA 1RNBA 7RNTA 1I2EA 1X1XA 1RSNA 4J5GA 1BIRA 1RLSA 1BUJA 2C4BA 2ZA4A 1MGWA 1I2FA 1C54A 1B27A 2F56A 3DH2A 1RN4A 5BU4A 1RDSA 1PY3A 4GSPA 4BU4A 2GSPA 1BNFA 1T2IA 2KF5A 3KCHA 1BSDA 1R4YA 1UCLA 1YVSA 1GOUA 2RBIA 6RNTA 1RGHA 3A5EA 1I2GA 1BSAA 5HOHA 1X1UA 1BSBA 2RNTA 1I0XA 1B3SA 1T2HA 3HOHA 1I8VA 1UCIA 1LRAA 1BNEA 3Q3FA 1YGWA 1JBTA 3DGYA 3BU4A 2F5WA 2F4YA 1IYYA 4J5KA 5GSPA 1B2UA 1B2MA 1FZUA 3RNTA 3D5IA 8RNTA 1HYFA 1LNIA 1BOXA 1GMRA 1I3IA 3SYUA 1UCJA
chains in the Genus database with same CATH superfamily
1O7HB 3GZBA 3S67A 3CXC2 1BRJA 1FYSA 2BMOB 1JB2A 3FH1A 4WFOA 1VQM3 3B4PA 1BU4A 1M9GA 3Q1CA 4JRFA 1IVVA 3MYTA 3JUQA 2ZHXB 1AY7A 3BLZA 1B2ZA 3X3YA 3OWSA 2XFSA 1RRLA 4LYLB 4R80A 5IG4A 1UW1A 7GSPA 4ZM8A 5G1KA 4O2HA 3I553 4GB5A 4RNYA 2L1SA 1S723 1BNRA 1HU9A 3WHOA 3JUOA 2F98A 1D6ZA 4CJNA 2SBLA 1VQL3 1GOYA 2WOHA 1BAOA 4HAAA 5KP4A 2KF6A 1I3FA 1GOVA 1QMAA 1LOVA 1TIJA 2KXGA 2MF7A 3UJMA 1VQ63 1B2SA 1BNGA 1SIHA 1X1WA 3EBYA 1UI7A 3DGOA 3GRDA 1B21A 4FMDA 1A90A 1JBSA 1CH0A 1NJI4 3STDA 2CWTA 4HBRA 3MPHA 4HM2B 1WNHA 3JUMA 2GU3A 2ML5A 1DMNA 3BB9A 3UL6A 1Q824 1BRNL 2M7OA 1BGSA 1K9M4 3CMA3 3LT8A 1UCKA 2CFGA 1JBRA 1ISKA 2CG0A 3LOYA 4HM4B 1Q42A 1RGGA 1YIT3 3U1WA 2LQVA 4CDLA 3D9RA 4IT7A 3BNEA 1ULIB 4NREA 2WGOA 5DREA 1BRHA 1MWSA 2HOHA 3KKGA 4N6TA 2BT3A 3AHWA 2CHCA 3WOFB 2KF3A 2CIUA 1ZGXA 4HYZA 4XBTA 2UGIA 3MHEA 1RGKA 4O8SA 2C10A 3FF0A 5AYSC 1SPUA 1RN1A 1RNBA 1UI8A 2J8XB 2ML6A 2YFJB 1OPYA 4HM0B 1I2EA 3LTAA 3NHXA 2MC8A 4EC6A 1OF5A 1K28A 3M8CA 3PXMA 4IPBA 1RLSA 5LC6A 1BUJA 3SOAA 1OHOA 4JF8A 1Q40A 2C4BA 2RSXA 1VQ53 4MMXB 1MGWA 1KQS2 1C54A 1TFKA 2I9WA 5BU4A 1FGOA 3LTDA 4L8PA 5BXQA 2CX1A 1F8NA 2P09A 1IK3A 4O3VA 2CFKA 3HI7A 3GAXA 4HZ9B 2RFRA 3KCHA 1ZS7A 1WTHA 3UL5A 1R4YA 3SEDA 1GOUA 1LNHA 3CC73 2IUKA 1D6YA 3A5EA 3FSDA 5HOHA 4KT3B 1U5OA 3DZLA 1I8VA 4NHFA 4K90B 1UUWB 3O8YA 3F8XA 5M1AA 3DGYA 3BU4A 1YJN3 7STDA 4MJDA 5KP3A 1B2UA 1CQSA 2GBWB 4BL3A 1B2MA 2Z6BA 3EBTA 3WOEB 3K7CA 3ROBA 3RNTA 4HM8B 5EEOA 3OW22 1UDII 1HYFA 5A0OB 1NWWA 1PFPA 2P05A 4X2OA 3SOYA 1JV2B 2HMKB 3IJEB 3GZRA 3PCRA 2W56B 3F40A 3FCSB 1O7GB 1RJOA 4R1KA 1OF5B 1W2B2 1O7NB 2XEPA 1AVKA 5AEUB 1VQQA 3N9HA 3KN4A 1Q40B 5AIIA 1JNQA 2OTL3 3AGNA 1YIJ3 1WMPA 3HZPA 2CFDA 4OK0A 1BANA 2CWVA 4XDVA 1AVLA 3EN1B 4AKYA 3ECFA 2OQEC 2WO0A 5BIRA 1VZZA 3CPW2 1RGCA 2STDA 3WMDA 1N8QA 8CHOA 3VGNA 1MOLA 1DETA 3SX1A 1AR0A 1JZDA 3LTBA 4I4KA 2CKFB 1RCKA 2Y73A 1BRSA 4XBYA 1W6CA 2AAEA 4FCMA 3SXXA 4FR9A 1N5HA 1QALA 4XB5A 1BRKA 1M1XB 3NM2A 3CC43 3KSPA 2IYJA 1JZOA 2IY2A 2WGQA 1JB4A 1Z1SA 3NM7A 1YGEA 4HKVB 1OHPA 2JDIH 1ZO2A 1IQXA 3CPOA 5CK6A 1Q9EA 1W5ZA 3AGOA 4AKZA 1IVXA 3NBBA 3FG1A 3CCL3 3S29A 3G16A 1W6YA 3TDGA 3EHCA 3S27A 4BIRA 1FUTA 1BSEA 4MEIA 3BIRA 3FGYA 3WA3A 4HM6B 1E3VA 1EEJA 1GD4A 4OUQA 2ZDJA 1BVIA 3IPTA 2H0IA 2P0MA 3NBRA 1K734 1EG9B 1NU3A 2OCTA 2OTJ3 1RGAA 4TX4A 4LEHA 1B2XA 4H61A 4N6UA 1KSIA 2GXFA 3DM8A 4FMBA 3V98A 3G6E3 1UUVB 2RGQA 5JPUA 3GWRA 3LTCA 2BO9B 3OV4A 7RNTA 1Q7HA 4CPKA 4BL2A 1X1XA 1LOXA 1CEWI 4HM5B 1AV4A 4LSOA 3X42A 1N8R4 1EUIC 2YX9A 2ZA4A 1I2FA 3LZAA 1B27A 2F56A 1FA3A 2GBXB 2BMQB 3NX0A 4LZIA 3ALAA 3EE1A 5LC7A 3CCV3 3MWZA 4BU4A 1BNFA 5HGRA 1FGMA 5I97A 2KRTA 1GYBA 1BSDA 1FGRA 4HM3B 1LQGC 1Q814 1OGXA 1YVSA 3S28A 2R41A 3MSOA 1K41A 1Y4KA 4Q53A 1W01A 1X1UA 1ASKA 4LMIA 2RNTA 2LYXA 3NBJA 3JUPA 1T2HA 1CYVA 2BHMA 3HIGA 4FMCA 1DVDA 1IU7A 1RN7A 1UCIA 1Q7Y4 1FUWA 3K63A 1BNEA 3Q3FA 2W56A 3K5TA 1QAFA 3B4OA 3LXUX 2UX0A 3UB1A 1JBTA 3F8HA 2F4YA 1VQ73 1A2KA 1U8CB 3L0RA 4R4KA 5G1LA 3FKAA 1J2BA 1IYYA 3QK9A 2V1LA 1EQKA 4RNZA 3EN8A 3CCQ3 3V92A 2IA7A 2XR8B 3F9SA 3D5IA 3N54B 1DVCA 4XDWA 3LH4A 4KFDA 3NV0A 8RNTA 3CME3 3EC9A 1DMQA 3ZG5A 2F5WA 3HK4A 2INXA 3CCE3 3G713 1OH0A 3DUKA 2QEX3 1JJ22 2Y74A 3EB8A 3PYJA 3HX8A 5AIFA 1NB3I 4HJLB 4HM7B 2QGUA 1O7MB 2F86B 1DMMA 1LOYA 2KF4A 1FUSA 2A15A 1YJW3 1STDA 3DGMA 4HOHA 5RNTA 2FNQA 2XF3A 2BU4A 2W03A 4KZ1A 1TP6A 2PNCA 1IQ8A 1I70A 1YHQ3 3DGLA 5IG3A 1E3RA 4N6MA 5AI1A 4K61A 1RGFA 1GSPA 2UUGC 3K9MC 1MGRA 3PCSA 4KFEA 5IEPA 3CCU3 4NPBA 3G8ZA 2E2UA 3H51A 5TGNA 2HMJB 4ORLA 4XM4A 2W9QA 5JPPA 1VQ93 2W6JH 4GL6A 3F7XA 1RTUA 5AIHA 1G0TA 1LQMB 1O7PB 4BTXA 1TRQA 4R9KA 2B1XB 4EBGA 3I0YA 2GU1A 1NNVA 2F99A 1RCLA 2E2TA 2HMOB 3CU3A 4OVMA 5FGOA 1LXEA 3CCJ3 1IV9A 1Q864 3X40A 2PZVA 3QRDA 3BNDA 1JRQA 1ROVA 1TUHA 3NV0B 2FGTA 4PEJA 1CYUA 1A2VA 1FW7A 1G96A 3H3HA 1BNJA 1VQK3 4EV5A 1GMPA 1M904 1YNVX 2GEYA 3NQZA 2ZL8A 2Z77A 1B20A 1RGLA 2XH9A 5FW5A 2F5MA 5G2GA 5D81A 1NO3A 5AYRB 1DE3A 3CC23 4WWUC 3D4AA 4HVNA 5IG5A 1N9JA 3X3XA 1TRPA 4WHAA 3EF8A 4R9LA 1HKXA 2P0XA 4BTWA 1PU4A 1BSCA 1IVWA 5M18A 2XSOB 1W2ZA 2BIRA 3CNXA 2K3DA 1RNTA 3D5GA 3CNMA 3BNBA 2WOFA 2Z76A 1SIIA 4N6NB 1IT8A 2C11A 5IG0A 3GZYB 1RSNA 1ULJB 1E97A 3JVCA 1TFOA 3Q2PA 1ROAA 2E2VA 4STDA 5AIGA 1OCVA 1SQWA 2QA43 1GD3A 4MMZB 4EXRA 1R4CA 3CCM3 1GS3A 1RDSA 2CW9A 1STFI 2GEXA 4GSPA 4EW5A 1KC84 5JBSA 3BNCA 2GSPA 4ILFA 2D42A 1GY5A 4FCZA 1T2IA 2HMLB 4LGQA 1V58A 3SVAA 3EX9A 1WMOA 4J8TA 1S5AA 3ZG0A 1JKGB 1OACA 3KSED 2RBIA 3LT9A 5CLKA 3MG3A 3AMOB 2B24B 1I2GA 1BSAA 1DYUA 1N9EA 3HIIA 4WYKB 3X3ZA 1VQN3 4N6V0 3CCR3 1KD14 1WMNA 1LRAA 1O7WB 1JB5A 1RRHA 1YGWA 2K54A 4X2HA 5ELUA 2OOVA 5CXOA 3T8NA 3KIIA 4J5KA 4KFFA 5BVBA 2BMRB 3EJVA 2O3OA 5D82A 1FZUA 4WP5A 1BUQA 2D1WA 1YJ93 4EV2A 3MKIA 1LNIA 1V74A 3DMCA 1BOXA 3SYUA 1UCJA 2K0MA 1QAKA 1BNSA 4RZMA 4HZBB 1I0VA 1MWUA 1OUNA 4GHOA 2QIYA 1MWTA 3S5CA 3T8UA 3VF1A 2IMJA 2YFLB 3RDEA 2KCDA 1ZX2A 3D79A 3KFQC 4DKIA 1L5GB 1QVF2 4KVHA 1IT7A 1BNIA 5ELJA 3GSPA 1JN5A 1UUGB 1N5PA 1KWIA 2IUJA 1K8A4 5DRVA 1W7CA 1GY6A 2O9UX 1BRIA 1GMQA 3MG2A 3DY5A 3OX9A 3OWUA 3NXJA 4J9AA 5EQLA 3NUVA 3U97A 4H3UA 1HZ1A 1PYLA 3CCS3 3E99A 4CCVA 3NQYA 3MG1A 1OGZA 3FF2A 1RGEA 1IV7A 3JUNA 1YI23 1IDPA 3FLJA 1FGTA 1W6GA 3LMLA 2H0GA 3WR2A 5IENA 4G1MB 1VQO3 1W4NA 2XGLA 3B8LA 1OHSA 3A76A 2W0QA 3PGBA 1C7HA 1VQP3 2SARA 1TTOA 6GSPA 4RBNA 3CD63 1TJDA 1RMSA 3I563 3AHSA 9RNTA 3V99A 3T0UA 4I5QA 1AQZA 4RNTA 1UGHI 4FCJA 2CFLA 3URPA 1X1YA 3RGAA 6STDA 2W04A 5IF6A 3J7Yd 2KAAA 3FG3A 2CWUA 3FZWA 1QVG2 4N6OB 3SLUA 3LYGA 1T5YA 1NDOB 2XFTA 1BRGA 4L7KA 4HM1B 1T3BA 3PS8A 2W9PA 2HMMB 1RHLA 1EKMA 2XGNA 3ER7A 3FG4A 1JN5B 3PZWA 1VQ83 2W2CA 2AADA 4K1VA 1V57A 1EA2A 1A2PA 1SARA 2FXTA 4O02B 1LOWA 1G02A 3DXOA 2RCDA 3OXAA 1TU5A 2H0HA 1D6UA 4MMYB 3ZFZA 5CF1A 3KZTA 3EQQB 1UGIA 3N8BA 4J5GA 1BIRA 5STDA 4AEQA 1YVBI 4L8OA 1JKGA 3F7SA 1NB5I 4N6LA 2R4IA 4N3VA 5IERA 1SJWA 2JQ5A 3Q90A 3AMOA 5IW9A 3DH2A 1GY7A 4WYKA 1RN4A 1FGQA 3D3LA 3RGRA 1PY3A 1QJGA 4QWTA 2HMNB 3F14A 3WODG 4EYCA 1RKYA 1VQ43 3G0KA 5IEOA 2XRXB 2CX0A 2KF5A 3B7CA 1IQYA 1A67A 1UCLA 4BTYA 2CFWA 1W02A 6RNTA 4XBXA 1RGHA 3DGNA 3UNLA 5EVHA 1LVNA 2CC3A 2L4VA 4IIAA 5D83A 5CF2A 1MWRA 1WQLB 1BSBA 1I0XA 2BNGA 1B3SA 3HOHA 3KE7A 2YFIB 3OWYA 5KP1A 2XSHB 2OWPA 4FMAA 2Z7AA 3K0ZA 3G4S3 3VSYA 3IMAB 4U13A 5M19A 1US1A 3WDGB 5GSPA 2Q07A 2CH9A 1M1K4 5AEWB 1MNLA 2CG1A 1IVUA 2P38A 3WA2X 3GZXB 1I3IA 1GMRA 1W00A 2CK3H 2OQEA 3X41A 4K1UA 2OOVC
chains in the Genus database with same CATH topology
1BNSA 1I0VA 4GHOA 1BRJA 1FYSA 3AGNA 1BU4A 1BANA 1LOYA 2KF4A 1FUSA 1AY7A 1B2ZA 4HOHA 5BIRA 5RNTA 1BNIA 1RGCA 2BU4A 1I70A 3GSPA 7GSPA 1RGFA 1GSPA 1BNRA 1MGRA 1DETA 1BRIA 1GMQA 3WHOA 1RCKA 1BRSA 1GOYA 1HZ1A 1PYLA 2AAEA 1RTUA 1BAOA 4HAAA 2KF6A 1BRKA 1TRQA 1I3FA 1GOVA 1LOVA 1B2SA 1BNGA 1X1WA 1RGEA 1RCLA 3WR2A 1B21A 1JBSA 1CH0A 1Q9EA 2SARA 1TTOA 3AGOA 6GSPA 1RMSA 3AHSA 9RNTA 1FW7A 1BRNL 1BNJA 4BIRA 1FUTA 1BSEA 1AQZA 1GMPA 1YNVX 4RNTA 1BGSA 3BIRA 1X1YA 3URPA 1UCKA 2KAAA 1JBRA 1B20A 1RGLA 1BVIA 1RGGA 2F5MA 1DE3A 1RGAA 1BRGA 3D4AA 1B2XA 1BRHA 2HOHA 1TRPA 3AHWA 1RHLA 2KF3A 1BSCA 1ZGXA 2AADA 1RGKA 2BIRA 1A2PA 1SARA 1RN1A 1RNTA 1LOWA 1G02A 3D5GA 1RNBA 7RNTA 1I2EA 1X1XA 1RSNA 4J5GA 1BIRA 1RLSA 1BUJA 2C4BA 2ZA4A 1MGWA 1I2FA 1C54A 1B27A 2F56A 3DH2A 1RN4A 5BU4A 1RDSA 1PY3A 4GSPA 4BU4A 2GSPA 1BNFA 1T2IA 2KF5A 3KCHA 1BSDA 1R4YA 1UCLA 1YVSA 1GOUA 2RBIA 6RNTA 1RGHA 3A5EA 1I2GA 1BSAA 5HOHA 1X1UA 1BSBA 2RNTA 1I0XA 1B3SA 1T2HA 3HOHA 1I8VA 1UCIA 1LRAA 1BNEA 3Q3FA 1YGWA 1JBTA 3DGYA 3BU4A 2F5WA 2F4YA 1IYYA 4J5KA 5GSPA 1B2UA 1B2MA 1FZUA 3RNTA 3D5IA 8RNTA 1HYFA 1LNIA 1BOXA 1GMRA 1I3IA 3SYUA 1UCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNS A;  1I0V A;  4GHO A;  1BRJ A;  1FYS A;  3AGN A;  1BU4 A;  1BAN A;  1LOY A;  2KF4 A;  1FUS A;  1AY7 A;  1B2Z A;  4HOH A;  5BIR A;  5RNT A;  1BNI A;  1RGC A;  2BU4 A;  1I70 A;  3GSP A;  7GSP A;  1RGF A;  1GSP A;  1BNR A;  1MGR A;  1DET A;  1BRI A;  1GMQ A;  3WHO A;  1RCK A;  1BRS A;  1GOY A;  1HZ1 A;  1PYL A;  2AAE A;  1RTU A;  1BAO A;  4HAA A;  2KF6 A;  1BRK A;  1TRQ A;  1I3F A;  1GOV A;  1LOV A;  1B2S A;  1BNG A;  1X1W A;  1RGE A;  1RCL A;  3WR2 A;  1B21 A;  1JBS A;  1CH0 A;  1Q9E A;  2SAR A;  1TTO A;  3AGO A;  6GSP A;  1RMS A;  3AHS A;  9RNT A;  1FW7 A;  1BRN L;  1BNJ A;  4BIR A;  1FUT A;  1BSE A;  1AQZ A;  1GMP A;  1YNV X;  4RNT A;  1BGS A;  3BIR A;  1X1Y A;  3URP A;  1UCK A;  2KAA A;  1JBR A;  1B20 A;  1RGL A;  1BVI A;  1RGG A;  2F5M A;  1DE3 A;  1RGA A;  1BRG A;  3D4A A;  1B2X A;  1BRH A;  2HOH A;  1TRP A;  3AHW A;  1RHL A;  2KF3 A;  1BSC A;  1ZGX A;  2AAD A;  1RGK A;  2BIR A;  1A2P A;  1SAR A;  1RN1 A;  1RNT A;  1LOW A;  1G02 A;  3D5G A;  1RNB A;  7RNT A;  1I2E A;  1X1X A;  1RSN A;  4J5G A;  1BIR A;  1RLS A;  1BUJ A;  2C4B A;  2ZA4 A;  1MGW A;  1I2F A;  1C54 A;  1B27 A;  2F56 A;  3DH2 A;  1RN4 A;  5BU4 A;  1RDS A;  1PY3 A;  4GSP A;  4BU4 A;  2GSP A;  1BNF A;  1T2I A;  2KF5 A;  3KCH A;  1BSD A;  1R4Y A;  1UCL A;  1YVS A;  1GOU A;  2RBI A;  6RNT A;  1RGH A;  3A5E A;  1I2G A;  1BSA A;  5HOH A;  1X1U A;  1BSB A;  2RNT A;  1I0X A;  1B3S A;  1T2H A;  3HOH A;  1I8V A;  1UCI A;  1LRA A;  1BNE A;  3Q3F A;  1YGW A;  1JBT A;  3DGY A;  3BU4 A;  2F5W A;  2F4Y A;  1IYY A;  4J5K A;  5GSP A;  1B2U A;  1B2M A;  1FZU A;  3RNT A;  3D5I A;  8RNT A;  1HYF A;  1LNI A;  1BOX A;  1GMR A;  1I3I A;  3SYU A;  1UCJ A; 
#chains in the Genus database with same CATH topology
 1O7H B;  3GZB A;  3S67 A;  3CXC 2;  1BRJ A;  1FYS A;  2BMO B;  1JB2 A;  3FH1 A;  4WFO A;  1VQM 3;  3B4P A;  1BU4 A;  1M9G A;  3Q1C A;  4JRF A;  1IVV A;  3MYT A;  3JUQ A;  2ZHX B;  1AY7 A;  3BLZ A;  1B2Z A;  3X3Y A;  3OWS A;  2XFS A;  1RRL A;  4LYL B;  4R80 A;  5IG4 A;  1UW1 A;  7GSP A;  4ZM8 A;  5G1K A;  4O2H A;  3I55 3;  4GB5 A;  4RNY A;  2L1S A;  1S72 3;  1BNR A;  1HU9 A;  3WHO A;  3JUO A;  2F98 A;  1D6Z A;  4CJN A;  2SBL A;  1VQL 3;  1GOY A;  2WOH A;  1BAO A;  4HAA A;  5KP4 A;  2KF6 A;  1I3F A;  1GOV A;  1QMA A;  1LOV A;  1TIJ A;  2KXG A;  2MF7 A;  3UJM A;  1VQ6 3;  1B2S A;  1BNG A;  1SIH A;  1X1W A;  3EBY A;  1UI7 A;  3DGO A;  3GRD A;  1B21 A;  4FMD A;  1A90 A;  1JBS A;  1CH0 A;  1NJI 4;  3STD A;  2CWT A;  4HBR A;  3MPH A;  4HM2 B;  1WNH A;  3JUM A;  2GU3 A;  2ML5 A;  1DMN A;  3BB9 A;  3UL6 A;  1Q82 4;  1BRN L;  2M7O A;  1BGS A;  1K9M 4;  3CMA 3;  3LT8 A;  1UCK A;  2CFG A;  1JBR A;  1ISK A;  2CG0 A;  3LOY A;  4HM4 B;  1Q42 A;  1RGG A;  1YIT 3;  3U1W A;  2LQV A;  4CDL A;  3D9R A;  4IT7 A;  3BNE A;  1ULI B;  4NRE A;  2WGO A;  5DRE A;  1BRH A;  1MWS A;  2HOH A;  3KKG A;  4N6T A;  2BT3 A;  3AHW A;  2CHC A;  3WOF B;  2KF3 A;  2CIU A;  1ZGX A;  4HYZ A;  4XBT A;  2UGI A;  3MHE A;  1RGK A;  4O8S A;  2C10 A;  3FF0 A;  5AYS C;  1SPU A;  1RN1 A;  1RNB A;  1UI8 A;  2J8X B;  2ML6 A;  2YFJ B;  1OPY A;  4HM0 B;  1I2E A;  3LTA A;  3NHX A;  2MC8 A;  4EC6 A;  1OF5 A;  1K28 A;  3M8C A;  3PXM A;  4IPB A;  1RLS A;  5LC6 A;  1BUJ A;  3SOA A;  1OHO A;  4JF8 A;  1Q40 A;  2C4B A;  2RSX A;  1VQ5 3;  4MMX B;  1MGW A;  1KQS 2;  1C54 A;  1TFK A;  2I9W A;  5BU4 A;  1FGO A;  3LTD A;  4L8P A;  5BXQ A;  2CX1 A;  1F8N A;  2P09 A;  1IK3 A;  4O3V A;  2CFK A;  3HI7 A;  3GAX A;  4HZ9 B;  2RFR A;  3KCH A;  1ZS7 A;  1WTH A;  3UL5 A;  1R4Y A;  3SED A;  1GOU A;  1LNH A;  3CC7 3;  2IUK A;  1D6Y A;  3A5E A;  3FSD A;  5HOH A;  4KT3 B;  1U5O A;  3DZL A;  1I8V A;  4NHF A;  4K90 B;  1UUW B;  3O8Y A;  3F8X A;  5M1A A;  3DGY A;  3BU4 A;  1YJN 3;  7STD A;  4MJD A;  5KP3 A;  1B2U A;  1CQS A;  2GBW B;  4BL3 A;  1B2M A;  2Z6B A;  3EBT A;  3WOE B;  3K7C A;  3ROB A;  3RNT A;  4HM8 B;  5EEO A;  3OW2 2;  1UDI I;  1HYF A;  5A0O B;  1NWW A;  1PFP A;  2P05 A;  4X2O A;  3SOY A;  1JV2 B;  2HMK B;  3IJE B;  3GZR A;  3PCR A;  2W56 B;  3F40 A;  3FCS B;  1O7G B;  1RJO A;  4R1K A;  1OF5 B;  1W2B 2;  1O7N B;  2XEP A;  1AVK A;  5AEU B;  1VQQ A;  3N9H A;  3KN4 A;  1Q40 B;  5AII A;  1JNQ A;  2OTL 3;  3AGN A;  1YIJ 3;  1WMP A;  3HZP A;  2CFD A;  4OK0 A;  1BAN A;  2CWV A;  4XDV A;  1AVL A;  3EN1 B;  4AKY A;  3ECF A;  2OQE C;  2WO0 A;  5BIR A;  1VZZ A;  3CPW 2;  1RGC A;  2STD A;  3WMD A;  1N8Q A;  8CHO A;  3VGN A;  1MOL A;  1DET A;  3SX1 A;  1AR0 A;  1JZD A;  3LTB A;  4I4K A;  2CKF B;  1RCK A;  2Y73 A;  1BRS A;  4XBY A;  1W6C A;  2AAE A;  4FCM A;  3SXX A;  4FR9 A;  1N5H A;  1QAL A;  4XB5 A;  1BRK A;  1M1X B;  3NM2 A;  3CC4 3;  3KSP A;  2IYJ A;  1JZO A;  2IY2 A;  2WGQ A;  1JB4 A;  1Z1S A;  3NM7 A;  1YGE A;  4HKV B;  1OHP A;  2JDI H;  1ZO2 A;  1IQX A;  3CPO A;  5CK6 A;  1Q9E A;  1W5Z A;  3AGO A;  4AKZ A;  1IVX A;  3NBB A;  3FG1 A;  3CCL 3;  3S29 A;  3G16 A;  1W6Y A;  3TDG A;  3EHC A;  3S27 A;  4BIR A;  1FUT A;  1BSE A;  4MEI A;  3BIR A;  3FGY A;  3WA3 A;  4HM6 B;  1E3V A;  1EEJ A;  1GD4 A;  4OUQ A;  2ZDJ A;  1BVI A;  3IPT A;  2H0I A;  2P0M A;  3NBR A;  1K73 4;  1EG9 B;  1NU3 A;  2OCT A;  2OTJ 3;  1RGA A;  4TX4 A;  4LEH A;  1B2X A;  4H61 A;  4N6U A;  1KSI A;  2GXF A;  3DM8 A;  4FMB A;  3V98 A;  3G6E 3;  1UUV B;  2RGQ A;  5JPU A;  3GWR A;  3LTC A;  2BO9 B;  3OV4 A;  7RNT A;  1Q7H A;  4CPK A;  4BL2 A;  1X1X A;  1LOX A;  1CEW I;  4HM5 B;  1AV4 A;  4LSO A;  3X42 A;  1N8R 4;  1EUI C;  2YX9 A;  2ZA4 A;  1I2F A;  3LZA A;  1B27 A;  2F56 A;  1FA3 A;  2GBX B;  2BMQ B;  3NX0 A;  4LZI A;  3ALA A;  3EE1 A;  5LC7 A;  3CCV 3;  3MWZ A;  4BU4 A;  1BNF A;  5HGR A;  1FGM A;  5I97 A;  2KRT A;  1GYB A;  1BSD A;  1FGR A;  4HM3 B;  1LQG C;  1Q81 4;  1OGX A;  1YVS A;  3S28 A;  2R41 A;  3MSO A;  1K41 A;  1Y4K A;  4Q53 A;  1W01 A;  1X1U A;  1ASK A;  4LMI A;  2RNT A;  2LYX A;  3NBJ A;  3JUP A;  1T2H A;  1CYV A;  2BHM A;  3HIG A;  4FMC A;  1DVD A;  1IU7 A;  1RN7 A;  1UCI A;  1Q7Y 4;  1FUW A;  3K63 A;  1BNE A;  3Q3F A;  2W56 A;  3K5T A;  1QAF A;  3B4O A;  3LXU X;  2UX0 A;  3UB1 A;  1JBT A;  3F8H A;  2F4Y A;  1VQ7 3;  1A2K A;  1U8C B;  3L0R A;  4R4K A;  5G1L A;  3FKA A;  1J2B A;  1IYY A;  3QK9 A;  2V1L A;  1EQK A;  4RNZ A;  3EN8 A;  3CCQ 3;  3V92 A;  2IA7 A;  2XR8 B;  3F9S A;  3D5I A;  3N54 B;  1DVC A;  4XDW A;  3LH4 A;  4KFD A;  3NV0 A;  8RNT A;  3CME 3;  3EC9 A;  1DMQ A;  3ZG5 A;  2F5W A;  3HK4 A;  2INX A;  3CCE 3;  3G71 3;  1OH0 A;  3DUK A;  2QEX 3;  1JJ2 2;  2Y74 A;  3EB8 A;  3PYJ A;  3HX8 A;  5AIF A;  1NB3 I;  4HJL B;  4HM7 B;  2QGU A;  1O7M B;  2F86 B;  1DMM A;  1LOY A;  2KF4 A;  1FUS A;  2A15 A;  1YJW 3;  1STD A;  3DGM A;  4HOH A;  5RNT A;  2FNQ A;  2XF3 A;  2BU4 A;  2W03 A;  4KZ1 A;  1TP6 A;  2PNC A;  1IQ8 A;  1I70 A;  1YHQ 3;  3DGL A;  5IG3 A;  1E3R A;  4N6M A;  5AI1 A;  4K61 A;  1RGF A;  1GSP A;  2UUG C;  3K9M C;  1MGR A;  3PCS A;  4KFE A;  5IEP A;  3CCU 3;  4NPB A;  3G8Z A;  2E2U A;  3H51 A;  5TGN A;  2HMJ B;  4ORL A;  4XM4 A;  2W9Q A;  5JPP A;  1VQ9 3;  2W6J H;  4GL6 A;  3F7X A;  1RTU A;  5AIH A;  1G0T A;  1LQM B;  1O7P B;  4BTX A;  1TRQ A;  4R9K A;  2B1X B;  4EBG A;  3I0Y A;  2GU1 A;  1NNV A;  2F99 A;  1RCL A;  2E2T A;  2HMO B;  3CU3 A;  4OVM A;  5FGO A;  1LXE A;  3CCJ 3;  1IV9 A;  1Q86 4;  3X40 A;  2PZV A;  3QRD A;  3BND A;  1JRQ A;  1ROV A;  1TUH A;  3NV0 B;  2FGT A;  4PEJ A;  1CYU A;  1A2V A;  1FW7 A;  1G96 A;  3H3H A;  1BNJ A;  1VQK 3;  4EV5 A;  1GMP A;  1M90 4;  1YNV X;  2GEY A;  3NQZ A;  2ZL8 A;  2Z77 A;  1B20 A;  1RGL A;  2XH9 A;  5FW5 A;  2F5M A;  5G2G A;  5D81 A;  1NO3 A;  5AYR B;  1DE3 A;  3CC2 3;  4WWU C;  3D4A A;  4HVN A;  5IG5 A;  1N9J A;  3X3X A;  1TRP A;  4WHA A;  3EF8 A;  4R9L A;  1HKX A;  2P0X A;  4BTW A;  1PU4 A;  1BSC A;  1IVW A;  5M18 A;  2XSO B;  1W2Z A;  2BIR A;  3CNX A;  2K3D A;  1RNT A;  3D5G A;  3CNM A;  3BNB A;  2WOF A;  2Z76 A;  1SII A;  4N6N B;  1IT8 A;  2C11 A;  5IG0 A;  3GZY B;  1RSN A;  1ULJ B;  1E97 A;  3JVC A;  1TFO A;  3Q2P A;  1ROA A;  2E2V A;  4STD A;  5AIG A;  1OCV A;  1SQW A;  2QA4 3;  1GD3 A;  4MMZ B;  4EXR A;  1R4C A;  3CCM 3;  1GS3 A;  1RDS A;  2CW9 A;  1STF I;  2GEX A;  4GSP A;  4EW5 A;  1KC8 4;  5JBS A;  3BNC A;  2GSP A;  4ILF A;  2D42 A;  1GY5 A;  4FCZ A;  1T2I A;  2HML B;  4LGQ A;  1V58 A;  3SVA A;  3EX9 A;  1WMO A;  4J8T A;  1S5A A;  3ZG0 A;  1JKG B;  1OAC A;  3KSE D;  2RBI A;  3LT9 A;  5CLK A;  3MG3 A;  3AMO B;  2B24 B;  1I2G A;  1BSA A;  1DYU A;  1N9E A;  3HII A;  4WYK B;  3X3Z A;  1VQN 3;  4N6V 0;  3CCR 3;  1KD1 4;  1WMN A;  1LRA A;  1O7W B;  1JB5 A;  1RRH A;  1YGW A;  2K54 A;  4X2H A;  5ELU A;  2OOV A;  5CXO A;  3T8N A;  3KII A;  4J5K A;  4KFF A;  5BVB A;  2BMR B;  3EJV A;  2O3O A;  5D82 A;  1FZU A;  4WP5 A;  1BUQ A;  2D1W A;  1YJ9 3;  4EV2 A;  3MKI A;  1LNI A;  1V74 A;  3DMC A;  1BOX A;  3SYU A;  1UCJ A;  2K0M A;  1QAK A;  1BNS A;  4RZM A;  4HZB B;  1I0V A;  1MWU A;  1OUN A;  4GHO A;  2QIY A;  1MWT A;  3S5C A;  3T8U A;  3VF1 A;  2IMJ A;  2YFL B;  3RDE A;  2KCD A;  1ZX2 A;  3D79 A;  3KFQ C;  4DKI A;  1L5G B;  1QVF 2;  4KVH A;  1IT7 A;  1BNI A;  5ELJ A;  3GSP A;  1JN5 A;  1UUG B;  1N5P A;  1KWI A;  2IUJ A;  1K8A 4;  5DRV A;  1W7C A;  1GY6 A;  2O9U X;  1BRI A;  1GMQ A;  3MG2 A;  3DY5 A;  3OX9 A;  3OWU A;  3NXJ A;  4J9A A;  5EQL A;  3NUV A;  3U97 A;  4H3U A;  1HZ1 A;  1PYL A;  3CCS 3;  3E99 A;  4CCV A;  3NQY A;  3MG1 A;  1OGZ A;  3FF2 A;  1RGE A;  1IV7 A;  3JUN A;  1YI2 3;  1IDP A;  3FLJ A;  1FGT A;  1W6G A;  3LML A;  2H0G A;  3WR2 A;  5IEN A;  4G1M B;  1VQO 3;  1W4N A;  2XGL A;  3B8L A;  1OHS A;  3A76 A;  2W0Q A;  3PGB A;  1C7H A;  1VQP 3;  2SAR A;  1TTO A;  6GSP A;  4RBN A;  3CD6 3;  1TJD A;  1RMS A;  3I56 3;  3AHS A;  9RNT A;  3V99 A;  3T0U A;  4I5Q A;  1AQZ A;  4RNT A;  1UGH I;  4FCJ A;  2CFL A;  3URP A;  1X1Y A;  3RGA A;  6STD A;  2W04 A;  5IF6 A;  3J7Y d;  2KAA A;  3FG3 A;  2CWU A;  3FZW A;  1QVG 2;  4N6O B;  3SLU A;  3LYG A;  1T5Y A;  1NDO B;  2XFT A;  1BRG A;  4L7K A;  4HM1 B;  1T3B A;  3PS8 A;  2W9P A;  2HMM B;  1RHL A;  1EKM A;  2XGN A;  3ER7 A;  3FG4 A;  1JN5 B;  3PZW A;  1VQ8 3;  2W2C A;  2AAD A;  4K1V A;  1V57 A;  1EA2 A;  1A2P A;  1SAR A;  2FXT A;  4O02 B;  1LOW A;  1G02 A;  3DXO A;  2RCD A;  3OXA A;  1TU5 A;  2H0H A;  1D6U A;  4MMY B;  3ZFZ A;  5CF1 A;  3KZT A;  3EQQ B;  1UGI A;  3N8B A;  4J5G A;  1BIR A;  5STD A;  4AEQ A;  1YVB I;  4L8O A;  1JKG A;  3F7S A;  1NB5 I;  4N6L A;  2R4I A;  4N3V A;  5IER A;  1SJW A;  2JQ5 A;  3Q90 A;  3AMO A;  5IW9 A;  3DH2 A;  1GY7 A;  4WYK A;  1RN4 A;  1FGQ A;  3D3L A;  3RGR A;  1PY3 A;  1QJG A;  4QWT A;  2HMN B;  3F14 A;  3WOD G;  4EYC A;  1RKY A;  1VQ4 3;  3G0K A;  5IEO A;  2XRX B;  2CX0 A;  2KF5 A;  3B7C A;  1IQY A;  1A67 A;  1UCL A;  4BTY A;  2CFW A;  1W02 A;  6RNT A;  4XBX A;  1RGH A;  3DGN A;  3UNL A;  5EVH A;  1LVN A;  2CC3 A;  2L4V A;  4IIA A;  5D83 A;  5CF2 A;  1MWR A;  1WQL B;  1BSB A;  1I0X A;  2BNG A;  1B3S A;  3HOH A;  3KE7 A;  2YFI B;  3OWY A;  5KP1 A;  2XSH B;  2OWP A;  4FMA A;  2Z7A A;  3K0Z A;  3G4S 3;  3VSY A;  3IMA B;  4U13 A;  5M19 A;  1US1 A;  3WDG B;  5GSP A;  2Q07 A;  2CH9 A;  1M1K 4;  5AEW B;  1MNL A;  2CG1 A;  1IVU A;  2P38 A;  3WA2 X;  3GZX B;  1I3I A;  1GMR A;  1W00 A;  2CK3 H;  2OQE A;  3X41 A;  4K1U A;  2OOV C; 
#chains in the Genus database with same CATH homology
 1BNS A;  1I0V A;  4GHO A;  1BRJ A;  1FYS A;  3AGN A;  1BU4 A;  1BAN A;  1LOY A;  2KF4 A;  1FUS A;  1AY7 A;  1B2Z A;  4HOH A;  5BIR A;  5RNT A;  1BNI A;  1RGC A;  2BU4 A;  1I70 A;  3GSP A;  7GSP A;  1RGF A;  1GSP A;  1BNR A;  1MGR A;  1DET A;  1BRI A;  1GMQ A;  3WHO A;  1RCK A;  1BRS A;  1GOY A;  1HZ1 A;  1PYL A;  2AAE A;  1RTU A;  1BAO A;  4HAA A;  2KF6 A;  1BRK A;  1TRQ A;  1I3F A;  1GOV A;  1LOV A;  1B2S A;  1BNG A;  1X1W A;  1RGE A;  1RCL A;  3WR2 A;  1B21 A;  1JBS A;  1CH0 A;  1Q9E A;  2SAR A;  1TTO A;  3AGO A;  6GSP A;  1RMS A;  3AHS A;  9RNT A;  1FW7 A;  1BRN L;  1BNJ A;  4BIR A;  1FUT A;  1BSE A;  1AQZ A;  1GMP A;  1YNV X;  4RNT A;  1BGS A;  3BIR A;  1X1Y A;  3URP A;  1UCK A;  2KAA A;  1JBR A;  1B20 A;  1RGL A;  1BVI A;  1RGG A;  2F5M A;  1DE3 A;  1RGA A;  1BRG A;  3D4A A;  1B2X A;  1BRH A;  2HOH A;  1TRP A;  3AHW A;  1RHL A;  2KF3 A;  1BSC A;  1ZGX A;  2AAD A;  1RGK A;  2BIR A;  1A2P A;  1SAR A;  1RN1 A;  1RNT A;  1LOW A;  1G02 A;  3D5G A;  1RNB A;  7RNT A;  1I2E A;  1X1X A;  1RSN A;  4J5G A;  1BIR A;  1RLS A;  1BUJ A;  2C4B A;  2ZA4 A;  1MGW A;  1I2F A;  1C54 A;  1B27 A;  2F56 A;  3DH2 A;  1RN4 A;  5BU4 A;  1RDS A;  1PY3 A;  4GSP A;  4BU4 A;  2GSP A;  1BNF A;  1T2I A;  2KF5 A;  3KCH A;  1BSD A;  1R4Y A;  1UCL A;  1YVS A;  1GOU A;  2RBI A;  6RNT A;  1RGH A;  3A5E A;  1I2G A;  1BSA A;  5HOH A;  1X1U A;  1BSB A;  2RNT A;  1I0X A;  1B3S A;  1T2H A;  3HOH A;  1I8V A;  1UCI A;  1LRA A;  1BNE A;  3Q3F A;  1YGW A;  1JBT A;  3DGY A;  3BU4 A;  2F5W A;  2F4Y A;  1IYY A;  4J5K A;  5GSP A;  1B2U A;  1B2M A;  1FZU A;  3RNT A;  3D5I A;  8RNT A;  1HYF A;  1LNI A;  1BOX A;  1GMR A;  1I3I A;  3SYU A;  1UCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...