4TX4A

Crystal structure of a single-domain cysteine protease inhibitor from cowpea (vigna unguiculata)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
b'NSLEIDSLARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWLNFKELQEFKHVGDAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine proteinase inhibitor
publication title Expression in Escherichia coli of cysteine protease inhibitors from cowpea (Vigna unguiculata): The crystal structure of a single-domain cystatin gives insights on its thermal and pH stability.
pubmed doi rcsb
source organism Vigna unguiculata
molecule tags Hydrolase inhibitor
total genus 15
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4tx4A00
5A0OB 2W9PA 3K9MC 3IMAB 1GD3A 1CEWI 1YVBI 1STFI 1N5HA 1PFPA 3L0RA 1G96A 1RN7A 4CCVA 2BO9B 3UL5A 1NB5I 2KXGA 2CH9A 1CYVA 4N6MA 1MOLA 1MNLA 3GAXA 1CYUA 1FA3A 3PS8A 1LXEA 4ZM8A 4N6LA 1KWIA 3KSED 5ELUA 3PXMA 4EYCA 1FUWA 1GD4A 5LC7A 2OCTA 1DVDA 5EQLA 3Q2PA 2W9QA 1TIJA 3MWZA 1M9GA 1WNHA 3SVAA 1R4CA 1N5PA 2O9UX 5LC6A 1DVCA 3NX0A 1A90A 1ROAA 3PYJA 4LZIA 1NB3I 1IV7A 1EQKA 4N6TA 1N9JA 4N6NB 3UL6A 1A67A 4N6OB 3QRDA 4TX4A 3KFQC 4IT7A 3S67A 4N6V0 3LH4A 1IV9A 4N6UA 5ELJA
chains in the Genus database with same CATH superfamily
1I2EA 3EBTA 1YI23 3WODG 3S28A 2KF4A 1X1YA 1I70A 5A0OB 4O02B 3NQYA 1BU4A 1I0XA 1QMAA 1RLSA 3CPOA 3HOHA 4WYKB 3X3ZA 3IMAB 2OTL3 1GD3A 1IVVA 3Q3FA 4MMYB 1W2ZA 2MC8A 1UCJA 2H0HA 3I0YA 3X3YA 2BT3A 1V58A 4HM4B 6GSPA 1WMPA 1DETA 3FCSB 4WP5A 3LTBA 1B2SA 3NV0B 3WA3A 1FGMA 4NHFA 3NHXA 3HI7A 1TRPA 1JRQA 3TDGA 1BNRA 1HZ1A 1NB5I 4WFOA 1B21A 1W6CA 1ASKA 3EN8A 1QVG2 2W56B 3HIIA 1QAFA 4WHAA 2JQ5A 2OQEC 3LT8A 5KP3A 4N6MA 2L4VA 2XEPA 1Q824 5IG0A 1QALA 3D5IA 8RNTA 2XRXB 1O7WB 3GAXA 2W04A 1BUJA 1BNGA 3H3HA 5IW9A 3OWUA 1YVSA 4J5GA 3AHSA 4CJNA 3PZWA 1T5YA 1SQWA 1T2HA 2XH9A 4XBTA 2BU4A 1LOYA 3DH2A 3ROBA 1ZGXA 3M8CA 1IQ8A 1I3FA 3SEDA 1AR0A 4BL2A 4ZM8A 7RNTA 3G4S3 1F8NA 1BRIA 2YFIB 4N6LA 3ZG5A 4RNZA 1S723 2W03A 2WOFA 3U97A 1VQL3 1ISKA 2QIYA 2CFLA 3N54B 1VQ73 1MWSA 1QJGA 5ELUA 3WA2X 8CHOA 1I8VA 4FCMA 3FG4A 4HZ9B 5D82A 1FUWA 5LC7A 4LMIA 3B4PA 4EW5A 6RNTA 1STDA 5D83A 5IG3A 3NV0A 5AYRB 3ZFZA 1Q42A 1RCLA 4KFDA 4HBRA 1RN1A 4MEIA 3MKIA 4ORLA 3DGMA 1JKGB 3MSOA 4R4KA 2W56A 2RFRA 1WNHA 3A5EA 2QGUA 3AMOB 1R4CA 1FGOA 2WGOA 1BRJA 4JF8A 2V1LA 2HMKB 1KSIA 1N5PA 3LXUX 3B7CA 3X42A 4NREA 2BMOB 5STDA 3RDEA 3EN1B 2BMRB 3GZYB 5AIFA 1I0VA 2KAAA 1LOWA 1TUHA 1W5ZA 1JB5A 1U5OA 1MGRA 2OWPA 4MMXB 1OHSA 2Y74A 2F5MA 2GXFA 3NX0A 5RNTA 3CC73 3G8ZA 4GB5A 1A90A 1IU7A 3GZRA 1D6UA 1ROAA 1FYSA 1NB3I 1ROVA 2PZVA 3BLZA 4H61A 2F98A 2HMOB 1TU5A 1LQGC 4R80A 1EQKA 1DE3A 1RGCA 1KQS2 3CME3 1VQ93 1RTUA 1G0TA 2W6JH 1K41A 1A67A 1FGRA 3SXXA 3VGNA 1WMNA 5BXQA 3QRDA 2IUJA 1W7CA 1VQP3 3VF1A 3JUMA 4IT7A 1BUQA 4AKZA 1OGZA 1LNIA 4BTWA 3DZLA 1JBRA 1BRSA 3S27A 1JKGA 3CD63 3WDGB 3MHEA 3IPTA 3AMOA 1BVIA 1RN4A 2W9PA 3D4AA 1OHOA 2P09A 7GSPA 1I2FA 2UX0A 4KFFA 5AEUB 2B24B 2P05A 1N5HA 1JBTA 1IT8A 2AADA 1BNIA 6STDA 5JBSA 4LYLB 1BAOA 1G96A 3DMCA 3JUQA 1N8QA 2ML5A 1RHLA 3SLUA 1A2VA 2BO9B 3AGNA 2BIRA 1QVF2 3DGLA 2KXGA 4U13A 1YIT3 3K0ZA 4I4KA 3CCQ3 1JNQA 5M1AA 2ML6A 3WMDA 4PEJA 1OPYA 1FGTA 3CNXA 3DM8A 4XBXA 4LGQA 1IQXA 1X1UA 3EF8A 5FGOA 1MOLA 1TFKA 3LMLA 4KZ1A 9RNTA 1KD14 4FMBA 1W02A 4K90B 1RNTA 1TRQA 2F86B 3FLJA 1J2BA 2INXA 3BB9A 3SX1A 4KFEA 2LYXA 4OUQA 4XB5A 1NO3A 1FUSA 1LQMB 3PS8A 5D81A 5BVBA 1LXEA 3Q1CA 1YGWA 1YNVX 4XBYA 1YJN3 2SBLA 1OGXA 3F7XA 1KC84 3CC23 2O3OA 3KSED 3EX9A 2GU1A 1WMOA 1EA2A 1OHPA 3EJVA 1DMMA 1AVKA 4EC6A 4HM1B 5KP4A 1GY5A 3PXMA 2HOHA 3BNBA 4EYCA 3NBRA 1HKXA 1GD4A 3KSPA 3STDA 1B2ZA 2C10A 4QWTA 3KE7A 2IY2A 1B3SA 1HU9A 3GZBA 2P0XA 1Q7HA 3AHWA 4FCZA 3CCU3 2OOVA 3Q2PA 1AVLA 1VQ53 3KCHA 2CG0A 2H0IA 3N9HA 1M904 5IG4A 3MG2A 2IA7A 3G0KA 3LYGA 1AV4A 2D1WA 4NPBA 1O7NB 3X40A 1M9GA 4KVHA 2E2TA 1UCLA 2CX1A 3MG3A 5GSPA 1VQK3 2C11A 2BHMA 3FG3A 4R9KA 3E99A 3O8YA 3LZAA 3DGYA 4H3UA 4BTXA 1IYYA 2C4BA 2W0QA 3F8HA 3RGAA 1UUGB 2YFLB 1JBSA 1W6GA 3BU4A 1IVXA 3EBYA 4HM3B 2OTJ3 1GMRA 5LC6A 1VZZA 3BNCA 5AIGA 5AI1A 3CPW2 1DVCA 3ER7A 2Z6BA 5G1KA 1O7PB 3CCV3 3K5TA 2J8XB 1SPUA 3NBJA 2CFWA 2D42A 3NBBA 2Z77A 1K28A 4HM6B 4LSOA 4X2HA 5CK6A 2P38A 3BNEA 3VSYA 1JN5B 1WQLB 2CWVA 4HVNA 1EG9B 3OW22 1IV7A 5JPPA 2YX9A 1BANA 1ULJB 5DRVA 1DMNA 1RJOA 2XFSA 5FW5A 3S29A 5I97A 3ALAA 3HIGA 1UCKA 1JB4A 1BSAA 2XR8B 1Q40B 4FMAA 1I2GA 1JJ22 4GHOA 1OCVA 3GSPA 1BSCA 1R4YA 2L1SA 2ZL8A 3KFQC 3RGRA 4EV2A 3I563 4HZBB 3S67A 3I553 4XM4A 3UJMA 3LH4A 1IV9A 4N6UA 1BSDA 1IQYA 3URPA 1Q7Y4 3MPHA 1V57A 1RDSA 3EE1A 4Q53A 3DGNA 1PYLA 4HYZA 4RBNA 2GU3A 3ZG0A 4L7KA 1TTOA 3LT9A 3CCJ3 2H0GA 3JUOA 4RZMA 1WTHA 2F4YA 1FUTA 3K9MC 3G16A 4I5QA 2KCDA 1ZO2A 1RGLA 5G1LA 3V99A 3CCM3 2CG1A 1CEWI 1GY7A 1TFOA 2GEXA 4EBGA 1GS3A 3LTDA 3KKGA 5EEOA 1OF5B 1LVNA 1STFI 1W6YA 4HM5B 5JPUA 1PFPA 2WOHA 3L0RA 4HKVB 2RNTA 2F99A 2HMLB 1UUWB 4CCVA 2A15A 2CHCA 1O7MB 1C7HA 1JV2B 1RGFA 2CX0A 2MF7A 3CU3A 3IJEB 4AKYA 3CCE3 4HOHA 3G713 4FMCA 1MWUA 5AIIA 1US1A 1JN5A 2CIUA 3JUNA 5HGRA 1CQSA 2P0MA 5KP1A 5HOHA 5IENA 1SJWA 5M18A 3OWSA 1CH0A 1Q40A 4HM0B 1HYFA 4KT3B 1O7GB 1B27A 4K1VA 3GWRA 1M1XB 1ZS7A 2CW9A 3SYUA 3NUVA 1E3RA 7STDA 1BNJA 1LNHA 2PNCA 2XSHB 2CC3A 3MG1A 4LEHA 1UDII 2LQVA 4BU4A 1FW7A 2XFTA 3PGBA 3FF2A 1G02A 3FZWA 3KIIA 1BNSA 2WGQA 1K734 3PCSA 2GEYA 1GYBA 3F40A 3NM2A 2W2CA 2RBIA 1RGGA 4RNYA 3T8NA 1YJ93 1C54A 1UGHI 4MMZB 2OCTA 2K0MA 2K54A 1X1WA 1OF5A 3JVCA 3HX8A 2ZHXB 4L8OA 1U8CB 3T8UA 1GMPA 1OACA 3X41A 4RNTA 3F8XA 3FKAA 4OVMA 1IDPA 4GL6A 4XDWA 1BIRA 4HAAA 5AEWB 2QEX3 3MWZA 2OOVC 1UW1A 1LOVA 1IVWA 3LOYA 3SVAA 1MGWA 2RSXA 1BSEA 2CFDA 2CFGA 3GZXB 1UCIA 5IG5A 1VQM3 4CPKA 1K8A4 1BGSA 1VQ43 2O9UX 1YIJ3 1K9M4 4EXRA 2GBWB 1UUVB 4K1UA 2GSPA 1E3VA 2KF5A 5EVHA 2I9WA 3JUPA 3G6E3 5DREA 1VQO3 5IERA 2GBXB 1OUNA 4R1KA 4G1MB 3CC43 1RKYA 4AEQA 3V98A 3RNTA 3HZPA 2SARA 4BTYA 2E2UA 1EEJA 5AIHA 1RRLA 2CKFB 2KF6A 1I3IA 1IVUA 1PU4A 4STDA 1PY3A 3WOEB 2ZDJA 1MWRA 1NNVA 1SIHA 2K3DA 1BNEA 4N6NB 4DKIA 4O2HA 5IF6A 3S5CA 4WWUC 3FF0A 4TX4A 1AQZA 1B20A 1W00A 5CXOA 4BL3A 5ELJA 2IUKA 3DUKA 3KZTA 1TJDA 3NXJA 1RRHA 1RGKA 1Z1SA 2M7OA 1B2MA 3HK4A 1VQQA 3A76A 3K7CA 3Q90A 1BNFA 3F14A 1RSNA 1MWTA 1Y4KA 3EHCA 1W4NA 1UGIA 3D3LA 1YVBI 2F5WA 3J7Yd 4J8TA 5IEOA 1GOVA 1RN7A 1DMQA 4IPBA 3OX9A 4FCJA 3LTAA 4FMDA 3UB1A 1BRNL 5M19A 1N8R4 2RGQA 2OQEA 2XSOB 4WYKA 2R41A 3UL5A 1RMSA 2CH9A 3BIRA 3NQZA 3KN4A 3F7SA 3UNLA 3DXOA 1CYVA 1T3BA 2BNGA 2XF3A 3D79A 3D9RA 5AYSC 2UGIA 5G2GA 3SOAA 1VQN3 2HMMB 3CCS3 2FXTA 1JZDA 1EUIC 1LRAA 1E97A 1MNLA 3OXAA 1GSPA 2YFJB 1CYUA 1FA3A 1RNBA 3U1WA 2F56A 3EQQB 2IYJA 5CLKA 3CNMA 4HM8B 4EV5A 1SIIA 1RGEA 1L5GB 2UUGC 2XGNA 3FG1A 2ZA4A 3CMA3 1UI7A 3PCRA 3T0UA 4L8PA 2Y73A 1GY6A 1Q864 3V92A 2B1XB 3FSDA 1M1K4 1KWIA 3QK9A 5CF1A 2JDIH 2CFKA 4O3VA 1VQ63 1D6YA 4XDVA 1YGEA 4IIAA 4MJDA 3LTCA 1QAKA 1NDOB 2FNQA 1X1XA 2RCDA 3ECFA 2BMQB 2HMJB 4O8SA 1W2B2 3OWYA 1DVDA 1AY7A 1ULIB 4K61A 2Q07A 5TGNA 1FZUA 1Q814 5EQLA 2STDA 3H51A 4J5KA 1LOXA 3X3XA 2Z76A 3CCR3 4FR9A 1T2IA 3F9SA 3DY5A 1D6ZA 3OV4A 1EKMA 2W9QA 4HJLB 3SOYA 1TIJA 1ZX2A 1NU3A 1V74A 3AGOA 3B4OA 1S5AA 1W01A 4HM7B 3B8LA 3FGYA 1BRGA 1GOYA 1NJI4 2CK3H 1OH0A 1B2UA 1A2KA 1NWWA 4BIRA 5BIRA 3NM7A 1YHQ3 2FGTA 2Z7AA 1SARA 3D5GA 4N3VA 3WR2A 1RGHA 1IT7A 1UI8A 2HMNB 4GSPA 1FGQA 3CCL3 1TP6A 3EB8A 4J9AA 2QA43 1O7HB 3GRDA 4HM2B 2KRTA 3FH1A 3PYJA 1DYUA 1GOUA 3DGOA 4LZIA 1BOXA 2WO0A 1Q9EA 1GMQA 4R9LA 1A2PA 1BRHA 2XGLA 2KF3A 4OK0A 1YJW3 1JB2A 2IMJA 2CWTA 4N6TA 1RCKA 2E2VA 1N9JA 3EC9A 1IK3A 3K63A 5BU4A 4ILFA 4CDLA 5IEPA 3UL6A 3BNDA 5CF2A 2CWUA 4N6OB 3MYTA 3WOFB 1BSBA 1B2XA 2R4IA 3N8BA 3WHOA 4X2OA 4N6V0 4JRFA 1VQ83 1JZOA 1RGAA 1N9EA 3CXC2 2AAEA 1BRKA
chains in the Genus database with same CATH topology
3EBTA 1YI23 3WODG 3S28A 5A0OB 4O02B 3NQYA 4WYKB 1QMAA 3CPOA 3X3ZA 3IMAB 2OTL3 1GD3A 1IVVA 4MMYB 1W2ZA 2MC8A 3I0YA 3X3YA 2BT3A 4HM4B 1WMPA 3FCSB 4WP5A 3LTBA 3NV0B 3WA3A 1FGMA 4NHFA 3NHXA 3HI7A 1JRQA 3TDGA 1NB5I 4WFOA 1W6CA 1ASKA 3EN8A 1QVG2 2W56B 3HIIA 1QAFA 4WHAA 2JQ5A 2OQEC 3LT8A 5KP3A 4N6MA 2L4VA 2XEPA 1Q824 5IG0A 1QALA 2XRXB 1O7WB 3GAXA 2W04A 3H3HA 5IW9A 3OWUA 3PZWA 1T5YA 1SQWA 2XH9A 4XBTA 3ROBA 3M8CA 3SEDA 1IQ8A 3G4S3 1AR0A 4ZM8A 1F8NA 4N6LA 2YFIB 1S723 4RNZA 1VQL3 2W03A 2WOFA 3U97A 1ISKA 2QIYA 2CFLA 3N54B 1VQ73 1QJGA 5ELUA 3WA2X 8CHOA 4FCMA 3FG4A 4HZ9B 5D82A 1FUWA 5LC7A 4LMIA 3B4PA 1STDA 5D83A 5IG3A 3NV0A 5AYRB 1Q42A 4KFDA 4HBRA 4MEIA 3MKIA 4ORLA 3DGMA 1JKGB 3MSOA 4R4KA 2W56A 2RFRA 1WNHA 3AMOB 2QGUA 1R4CA 1FGOA 2WGOA 4JF8A 2V1LA 2HMKB 1KSIA 1N5PA 3LXUX 3B7CA 3X42A 4NREA 2BMOB 5STDA 3RDEA 3EN1B 2BMRB 3GZYB 5AIFA 1TUHA 1W5ZA 1JB5A 1U5OA 2OWPA 4MMXB 1OHSA 2Y74A 2GXFA 3NX0A 1A90A 3CC73 3G8ZA 4GB5A 1IU7A 3GZRA 1D6UA 1ROAA 1NB3I 1ROVA 2PZVA 3BLZA 4H61A 2F98A 2HMOB 1TU5A 4R80A 1EQKA 1KQS2 3CME3 1VQ93 2W6JH 1K41A 1A67A 1FGRA 3SXXA 3VGNA 1WMNA 5BXQA 3QRDA 2IUJA 1W7CA 1VQP3 3VF1A 3JUMA 4IT7A 1BUQA 4AKZA 1OGZA 4BTWA 3DZLA 3S27A 1JKGA 3CD63 3WDGB 3MHEA 3IPTA 3AMOA 2W9PA 1OHOA 2P09A 2UX0A 4KFFA 5AEUB 2B24B 2P05A 1N5HA 1IT8A 6STDA 5JBSA 1G96A 3DMCA 3JUQA 1N8QA 2ML5A 3SLUA 1A2VA 2BO9B 1QVF2 3DGLA 2KXGA 4U13A 1YIT3 3K0ZA 4I4KA 3CCQ3 1JNQA 2ML6A 3WMDA 4PEJA 1OPYA 1FGTA 3CNXA 3DM8A 4XBXA 4LGQA 1IQXA 3EF8A 5FGOA 1MOLA 1TFKA 3LMLA 4KZ1A 1KD14 4FMBA 1W02A 4K90B 2F86B 3FLJA 1J2BA 2INXA 3BB9A 3SX1A 4KFEA 2LYXA 4OUQA 4XB5A 1NO3A 3PS8A 5BVBA 5D81A 1LXEA 3Q1CA 4XBYA 1YJN3 2SBLA 1OGXA 3F7XA 1KC84 3CC23 2O3OA 3KSED 3EX9A 2GU1A 1WMOA 1EA2A 1OHPA 3EJVA 1DMMA 1AVKA 4EC6A 4HM1B 5KP4A 1GY5A 3PXMA 3BNBA 4EYCA 3NBRA 1HKXA 1GD4A 3KSPA 3STDA 2C10A 4QWTA 3KE7A 3GZBA 1HU9A 2P0XA 3CCU3 4FCZA 2OOVA 3Q2PA 1AVLA 1VQ53 3N9HA 2CG0A 1M904 5IG4A 3MG2A 2IA7A 3G0KA 3LYGA 1AV4A 2D1WA 1O7NB 3X40A 1M9GA 4KVHA 2E2TA 3MG3A 1VQK3 2C11A 2BHMA 3FG3A 4R9KA 3E99A 3O8YA 3LZAA 4H3UA 4BTXA 2W0QA 3F8HA 3RGAA 2YFLB 2OTJ3 1W6GA 3EBYA 1IVXA 4HM3B 5LC6A 1VZZA 3BNCA 5AIGA 5AI1A 3CPW2 1DVCA 3ER7A 2Z6BA 1O7PB 3CCV3 3K5TA 3NBJA 1SPUA 2CFWA 2D42A 3NBBA 2Z77A 1K28A 4HM6B 4LSOA 4X2HA 5CK6A 2P38A 3BNEA 3VSYA 1JN5B 1WQLB 2CWVA 4HVNA 1EG9B 3OW22 1IV7A 5JPPA 2YX9A 1ULJB 5DRVA 1DMNA 1RJOA 2XFSA 5FW5A 3S29A 5I97A 3ALAA 3HIGA 1JB4A 2XR8B 1Q40B 4FMAA 1JJ22 1OCVA 3I563 2ZL8A 3KFQC 3RGRA 4EV2A 4HZBB 3S67A 3I553 4XM4A 3UJMA 3LH4A 1IV9A 4N6UA 1IQYA 1Q7Y4 3MPHA 3EE1A 4Q53A 3DGNA 4RBNA 4HYZA 2GU3A 4L7KA 3LT9A 3CCJ3 3JUOA 4RZMA 1WTHA 3K9MC 3G16A 2KCDA 1ZO2A 3V99A 2CG1A 1CEWI 1GY7A 1TFOA 2GEXA 4EBGA 1GS3A 3LTDA 3KKGA 5EEOA 1OF5B 1LVNA 1STFI 1W6YA 4HM5B 5JPUA 1PFPA 2WOHA 3L0RA 4HKVB 2F99A 2HMLB 1UUWB 4CCVA 2A15A 2CHCA 1O7MB 1C7HA 1JV2B 2MF7A 3CU3A 3CCE3 3IJEB 4AKYA 3G713 4FMCA 5AIIA 5HGRA 1US1A 1JN5A 2CIUA 3JUNA 1CQSA 2P0MA 5KP1A 5IENA 1SJWA 3OWSA 1Q40A 4HM0B 1O7GB 4K1VA 3GWRA 1M1XB 2CW9A 3NUVA 1E3RA 7STDA 1LNHA 2PNCA 2XSHB 3MG1A 2CC3A 4LEHA 2LQVA 2XFTA 3PGBA 3FF2A 3FZWA 3KIIA 2WGQA 1K734 3PCSA 2GEYA 1GYBA 3F40A 3NM2A 2W2CA 4RNYA 1YJ93 3T8NA 4MMZB 2OCTA 2K0MA 2K54A 1OF5A 3JVCA 3HX8A 3T8UA 4L8OA 1U8CB 1OACA 3X41A 3F8XA 3FKAA 4OVMA 1IDPA 4GL6A 4XDWA 5AEWB 2QEX3 3MWZA 2OOVC 1UW1A 3LOYA 1IVWA 3SVAA 2RSXA 3GZXB 2CFDA 2CFGA 5IG5A 1VQM3 1K8A4 1VQ43 2O9UX 1YIJ3 1K9M4 4EXRA 2GBWB 1UUVB 4K1UA 1E3VA 5EVHA 2I9WA 3JUPA 3G6E3 5DREA 1VQO3 5IERA 2GBXB 1OUNA 4R1KA 4G1MB 3CC43 1RKYA 4AEQA 3V98A 3HZPA 4BTYA 2E2UA 5AIHA 1RRLA 2CKFB 1IVUA 1PU4A 4STDA 3WOEB 2ZDJA 1SIHA 4N6NB 4O2HA 5IF6A 3S5CA 4WWUC 3FF0A 4TX4A 1W00A 5CXOA 5ELJA 2IUKA 3DUKA 3KZTA 3NXJA 1RRHA 1Z1SA 2M7OA 3HK4A 3K7CA 3A76A 3Q90A 3F14A 1Y4KA 3EHCA 1W4NA 3D3LA 1YVBI 3J7Yd 4J8TA 5IEOA 1RN7A 1DMQA 4IPBA 3OX9A 4FCJA 3LTAA 4FMDA 3UB1A 1N8R4 2RGQA 2OQEA 2XSOB 4WYKA 3UL5A 2CH9A 3NQZA 3KN4A 3F7SA 3UNLA 3DXOA 1CYVA 2XF3A 2BNGA 3D9RA 5AYSC 5G2GA 3SOAA 1VQN3 2HMMB 3CCS3 2FXTA 1E97A 1MNLA 3OXAA 2YFJB 1CYUA 1FA3A 3U1WA 3EQQB 5CLKA 3CNMA 4HM8B 4EV5A 1SIIA 1L5GB 2XGNA 3FG1A 3CMA3 1UI7A 3PCRA 3T0UA 4L8PA 2Y73A 1GY6A 1Q864 3V92A 2B1XB 3FSDA 1M1K4 1KWIA 3QK9A 5CF1A 2JDIH 2CFKA 4O3VA 1VQ63 1D6YA 4XDVA 1YGEA 4IIAA 4MJDA 3LTCA 1QAKA 1NDOB 2FNQA 3ECFA 2RCDA 4O8SA 2BMQB 2HMJB 1W2B2 3OWYA 1DVDA 1ULIB 4K61A 2Q07A 5TGNA 1Q814 5EQLA 2STDA 3H51A 1LOXA 3X3XA 2Z76A 3CCR3 4FR9A 3F9SA 3DY5A 1D6ZA 3OV4A 1EKMA 2W9QA 4HJLB 3SOYA 1TIJA 1ZX2A 1NU3A 1V74A 3B4OA 1S5AA 1W01A 4HM7B 3B8LA 3FGYA 1NJI4 2CK3H 1OH0A 1A2KA 1NWWA 3NM7A 1YHQ3 2FGTA 2Z7AA 4N3VA 1IT7A 1UI8A 2HMNB 1FGQA 3CCL3 1TP6A 3EB8A 4J9AA 2QA43 1O7HB 3GRDA 4HM2B 2KRTA 3FH1A 3PYJA 1DYUA 3DGOA 4LZIA 4R9LA 2WO0A 2XGLA 4OK0A 1YJW3 1JB2A 2IMJA 2CWTA 4N6TA 2E2VA 1N9JA 3EC9A 1IK3A 3K63A 4CDLA 5IEPA 3UL6A 3BNDA 5CF2A 2CWUA 4N6OB 3MYTA 3WOFB 2R4IA 3N8BA 4X2OA 4N6V0 4JRFA 1VQ83 3CCM3 1N9EA 3CXC2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0O B;  2W9P A;  3K9M C;  3IMA B;  1GD3 A;  1CEW I;  1YVB I;  1STF I;  1N5H A;  1PFP A;  3L0R A;  1G96 A;  1RN7 A;  4CCV A;  2BO9 B;  3UL5 A;  1NB5 I;  2KXG A;  2CH9 A;  1CYV A;  4N6M A;  1MOL A;  1MNL A;  3GAX A;  1CYU A;  1FA3 A;  3PS8 A;  1LXE A;  4ZM8 A;  4N6L A;  1KWI A;  3KSE D;  5ELU A;  3PXM A;  4EYC A;  1FUW A;  1GD4 A;  5LC7 A;  2OCT A;  1DVD A;  5EQL A;  3Q2P A;  2W9Q A;  1TIJ A;  3MWZ A;  1M9G A;  1WNH A;  3SVA A;  1R4C A;  1N5P A;  2O9U X;  5LC6 A;  1DVC A;  3NX0 A;  1A90 A;  1ROA A;  3PYJ A;  4LZI A;  1NB3 I;  1IV7 A;  1EQK A;  4N6T A;  1N9J A;  4N6N B;  3UL6 A;  1A67 A;  4N6O B;  3QRD A;  4TX4 A;  3KFQ C;  4IT7 A;  3S67 A;  4N6V 0;  3LH4 A;  1IV9 A;  4N6U A;  5ELJ A; 
#chains in the Genus database with same CATH topology
 1I2E A;  3EBT A;  1YI2 3;  3WOD G;  3S28 A;  2KF4 A;  1X1Y A;  1I70 A;  5A0O B;  4O02 B;  3NQY A;  1BU4 A;  1I0X A;  1QMA A;  1RLS A;  3CPO A;  3HOH A;  4WYK B;  3X3Z A;  3IMA B;  2OTL 3;  1GD3 A;  1IVV A;  3Q3F A;  4MMY B;  1W2Z A;  2MC8 A;  1UCJ A;  2H0H A;  3I0Y A;  3X3Y A;  2BT3 A;  1V58 A;  4HM4 B;  6GSP A;  1WMP A;  1DET A;  3FCS B;  4WP5 A;  3LTB A;  1B2S A;  3NV0 B;  3WA3 A;  1FGM A;  4NHF A;  3NHX A;  3HI7 A;  1TRP A;  1JRQ A;  3TDG A;  1BNR A;  1HZ1 A;  1NB5 I;  4WFO A;  1B21 A;  1W6C A;  1ASK A;  3EN8 A;  1QVG 2;  2W56 B;  3HII A;  1QAF A;  4WHA A;  2JQ5 A;  2OQE C;  3LT8 A;  5KP3 A;  4N6M A;  2L4V A;  2XEP A;  1Q82 4;  5IG0 A;  1QAL A;  3D5I A;  8RNT A;  2XRX B;  1O7W B;  3GAX A;  2W04 A;  1BUJ A;  1BNG A;  3H3H A;  5IW9 A;  3OWU A;  1YVS A;  4J5G A;  3AHS A;  4CJN A;  3PZW A;  1T5Y A;  1SQW A;  1T2H A;  2XH9 A;  4XBT A;  2BU4 A;  1LOY A;  3DH2 A;  3ROB A;  1ZGX A;  3M8C A;  1IQ8 A;  1I3F A;  3SED A;  1AR0 A;  4BL2 A;  4ZM8 A;  7RNT A;  3G4S 3;  1F8N A;  1BRI A;  2YFI B;  4N6L A;  3ZG5 A;  4RNZ A;  1S72 3;  2W03 A;  2WOF A;  3U97 A;  1VQL 3;  1ISK A;  2QIY A;  2CFL A;  3N54 B;  1VQ7 3;  1MWS A;  1QJG A;  5ELU A;  3WA2 X;  8CHO A;  1I8V A;  4FCM A;  3FG4 A;  4HZ9 B;  5D82 A;  1FUW A;  5LC7 A;  4LMI A;  3B4P A;  4EW5 A;  6RNT A;  1STD A;  5D83 A;  5IG3 A;  3NV0 A;  5AYR B;  3ZFZ A;  1Q42 A;  1RCL A;  4KFD A;  4HBR A;  1RN1 A;  4MEI A;  3MKI A;  4ORL A;  3DGM A;  1JKG B;  3MSO A;  4R4K A;  2W56 A;  2RFR A;  1WNH A;  3A5E A;  2QGU A;  3AMO B;  1R4C A;  1FGO A;  2WGO A;  1BRJ A;  4JF8 A;  2V1L A;  2HMK B;  1KSI A;  1N5P A;  3LXU X;  3B7C A;  3X42 A;  4NRE A;  2BMO B;  5STD A;  3RDE A;  3EN1 B;  2BMR B;  3GZY B;  5AIF A;  1I0V A;  2KAA A;  1LOW A;  1TUH A;  1W5Z A;  1JB5 A;  1U5O A;  1MGR A;  2OWP A;  4MMX B;  1OHS A;  2Y74 A;  2F5M A;  2GXF A;  3NX0 A;  5RNT A;  3CC7 3;  3G8Z A;  4GB5 A;  1A90 A;  1IU7 A;  3GZR A;  1D6U A;  1ROA A;  1FYS A;  1NB3 I;  1ROV A;  2PZV A;  3BLZ A;  4H61 A;  2F98 A;  2HMO B;  1TU5 A;  1LQG C;  4R80 A;  1EQK A;  1DE3 A;  1RGC A;  1KQS 2;  3CME 3;  1VQ9 3;  1RTU A;  1G0T A;  2W6J H;  1K41 A;  1A67 A;  1FGR A;  3SXX A;  3VGN A;  1WMN A;  5BXQ A;  3QRD A;  2IUJ A;  1W7C A;  1VQP 3;  3VF1 A;  3JUM A;  4IT7 A;  1BUQ A;  4AKZ A;  1OGZ A;  1LNI A;  4BTW A;  3DZL A;  1JBR A;  1BRS A;  3S27 A;  1JKG A;  3CD6 3;  3WDG B;  3MHE A;  3IPT A;  3AMO A;  1BVI A;  1RN4 A;  2W9P A;  3D4A A;  1OHO A;  2P09 A;  7GSP A;  1I2F A;  2UX0 A;  4KFF A;  5AEU B;  2B24 B;  2P05 A;  1N5H A;  1JBT A;  1IT8 A;  2AAD A;  1BNI A;  6STD A;  5JBS A;  4LYL B;  1BAO A;  1G96 A;  3DMC A;  3JUQ A;  1N8Q A;  2ML5 A;  1RHL A;  3SLU A;  1A2V A;  2BO9 B;  3AGN A;  2BIR A;  1QVF 2;  3DGL A;  2KXG A;  4U13 A;  1YIT 3;  3K0Z A;  4I4K A;  3CCQ 3;  1JNQ A;  5M1A A;  2ML6 A;  3WMD A;  4PEJ A;  1OPY A;  1FGT A;  3CNX A;  3DM8 A;  4XBX A;  4LGQ A;  1IQX A;  1X1U A;  3EF8 A;  5FGO A;  1MOL A;  1TFK A;  3LML A;  4KZ1 A;  9RNT A;  1KD1 4;  4FMB A;  1W02 A;  4K90 B;  1RNT A;  1TRQ A;  2F86 B;  3FLJ A;  1J2B A;  2INX A;  3BB9 A;  3SX1 A;  4KFE A;  2LYX A;  4OUQ A;  4XB5 A;  1NO3 A;  1FUS A;  1LQM B;  3PS8 A;  5D81 A;  5BVB A;  1LXE A;  3Q1C A;  1YGW A;  1YNV X;  4XBY A;  1YJN 3;  2SBL A;  1OGX A;  3F7X A;  1KC8 4;  3CC2 3;  2O3O A;  3KSE D;  3EX9 A;  2GU1 A;  1WMO A;  1EA2 A;  1OHP A;  3EJV A;  1DMM A;  1AVK A;  4EC6 A;  4HM1 B;  5KP4 A;  1GY5 A;  3PXM A;  2HOH A;  3BNB A;  4EYC A;  3NBR A;  1HKX A;  1GD4 A;  3KSP A;  3STD A;  1B2Z A;  2C10 A;  4QWT A;  3KE7 A;  2IY2 A;  1B3S A;  1HU9 A;  3GZB A;  2P0X A;  1Q7H A;  3AHW A;  4FCZ A;  3CCU 3;  2OOV A;  3Q2P A;  1AVL A;  1VQ5 3;  3KCH A;  2CG0 A;  2H0I A;  3N9H A;  1M90 4;  5IG4 A;  3MG2 A;  2IA7 A;  3G0K A;  3LYG A;  1AV4 A;  2D1W A;  4NPB A;  1O7N B;  3X40 A;  1M9G A;  4KVH A;  2E2T A;  1UCL A;  2CX1 A;  3MG3 A;  5GSP A;  1VQK 3;  2C11 A;  2BHM A;  3FG3 A;  4R9K A;  3E99 A;  3O8Y A;  3LZA A;  3DGY A;  4H3U A;  4BTX A;  1IYY A;  2C4B A;  2W0Q A;  3F8H A;  3RGA A;  1UUG B;  2YFL B;  1JBS A;  1W6G A;  3BU4 A;  1IVX A;  3EBY A;  4HM3 B;  2OTJ 3;  1GMR A;  5LC6 A;  1VZZ A;  3BNC A;  5AIG A;  5AI1 A;  3CPW 2;  1DVC A;  3ER7 A;  2Z6B A;  5G1K A;  1O7P B;  3CCV 3;  3K5T A;  2J8X B;  1SPU A;  3NBJ A;  2CFW A;  2D42 A;  3NBB A;  2Z77 A;  1K28 A;  4HM6 B;  4LSO A;  4X2H A;  5CK6 A;  2P38 A;  3BNE A;  3VSY A;  1JN5 B;  1WQL B;  2CWV A;  4HVN A;  1EG9 B;  3OW2 2;  1IV7 A;  5JPP A;  2YX9 A;  1BAN A;  1ULJ B;  5DRV A;  1DMN A;  1RJO A;  2XFS A;  5FW5 A;  3S29 A;  5I97 A;  3ALA A;  3HIG A;  1UCK A;  1JB4 A;  1BSA A;  2XR8 B;  1Q40 B;  4FMA A;  1I2G A;  1JJ2 2;  4GHO A;  1OCV A;  3GSP A;  1BSC A;  1R4Y A;  2L1S A;  2ZL8 A;  3KFQ C;  3RGR A;  4EV2 A;  3I56 3;  4HZB B;  3S67 A;  3I55 3;  4XM4 A;  3UJM A;  3LH4 A;  1IV9 A;  4N6U A;  1BSD A;  1IQY A;  3URP A;  1Q7Y 4;  3MPH A;  1V57 A;  1RDS A;  3EE1 A;  4Q53 A;  3DGN A;  1PYL A;  4HYZ A;  4RBN A;  2GU3 A;  3ZG0 A;  4L7K A;  1TTO A;  3LT9 A;  3CCJ 3;  2H0G A;  3JUO A;  4RZM A;  1WTH A;  2F4Y A;  1FUT A;  3K9M C;  3G16 A;  4I5Q A;  2KCD A;  1ZO2 A;  1RGL A;  5G1L A;  3V99 A;  3CCM 3;  2CG1 A;  1CEW I;  1GY7 A;  1TFO A;  2GEX A;  4EBG A;  1GS3 A;  3LTD A;  3KKG A;  5EEO A;  1OF5 B;  1LVN A;  1STF I;  1W6Y A;  4HM5 B;  5JPU A;  1PFP A;  2WOH A;  3L0R A;  4HKV B;  2RNT A;  2F99 A;  2HML B;  1UUW B;  4CCV A;  2A15 A;  2CHC A;  1O7M B;  1C7H A;  1JV2 B;  1RGF A;  2CX0 A;  2MF7 A;  3CU3 A;  3IJE B;  4AKY A;  3CCE 3;  4HOH A;  3G71 3;  4FMC A;  1MWU A;  5AII A;  1US1 A;  1JN5 A;  2CIU A;  3JUN A;  5HGR A;  1CQS A;  2P0M A;  5KP1 A;  5HOH A;  5IEN A;  1SJW A;  5M18 A;  3OWS A;  1CH0 A;  1Q40 A;  4HM0 B;  1HYF A;  4KT3 B;  1O7G B;  1B27 A;  4K1V A;  3GWR A;  1M1X B;  1ZS7 A;  2CW9 A;  3SYU A;  3NUV A;  1E3R A;  7STD A;  1BNJ A;  1LNH A;  2PNC A;  2XSH B;  2CC3 A;  3MG1 A;  4LEH A;  1UDI I;  2LQV A;  4BU4 A;  1FW7 A;  2XFT A;  3PGB A;  3FF2 A;  1G02 A;  3FZW A;  3KII A;  1BNS A;  2WGQ A;  1K73 4;  3PCS A;  2GEY A;  1GYB A;  3F40 A;  3NM2 A;  2W2C A;  2RBI A;  1RGG A;  4RNY A;  3T8N A;  1YJ9 3;  1C54 A;  1UGH I;  4MMZ B;  2OCT A;  2K0M A;  2K54 A;  1X1W A;  1OF5 A;  3JVC A;  3HX8 A;  2ZHX B;  4L8O A;  1U8C B;  3T8U A;  1GMP A;  1OAC A;  3X41 A;  4RNT A;  3F8X A;  3FKA A;  4OVM A;  1IDP A;  4GL6 A;  4XDW A;  1BIR A;  4HAA A;  5AEW B;  2QEX 3;  3MWZ A;  2OOV C;  1UW1 A;  1LOV A;  1IVW A;  3LOY A;  3SVA A;  1MGW A;  2RSX A;  1BSE A;  2CFD A;  2CFG A;  3GZX B;  1UCI A;  5IG5 A;  1VQM 3;  4CPK A;  1K8A 4;  1BGS A;  1VQ4 3;  2O9U X;  1YIJ 3;  1K9M 4;  4EXR A;  2GBW B;  1UUV B;  4K1U A;  2GSP A;  1E3V A;  2KF5 A;  5EVH A;  2I9W A;  3JUP A;  3G6E 3;  5DRE A;  1VQO 3;  5IER A;  2GBX B;  1OUN A;  4R1K A;  4G1M B;  3CC4 3;  1RKY A;  4AEQ A;  3V98 A;  3RNT A;  3HZP A;  2SAR A;  4BTY A;  2E2U A;  1EEJ A;  5AIH A;  1RRL A;  2CKF B;  2KF6 A;  1I3I A;  1IVU A;  1PU4 A;  4STD A;  1PY3 A;  3WOE B;  2ZDJ A;  1MWR A;  1NNV A;  1SIH A;  2K3D A;  1BNE A;  4N6N B;  4DKI A;  4O2H A;  5IF6 A;  3S5C A;  4WWU C;  3FF0 A;  4TX4 A;  1AQZ A;  1B20 A;  1W00 A;  5CXO A;  4BL3 A;  5ELJ A;  2IUK A;  3DUK A;  3KZT A;  1TJD A;  3NXJ A;  1RRH A;  1RGK A;  1Z1S A;  2M7O A;  1B2M A;  3HK4 A;  1VQQ A;  3A76 A;  3K7C A;  3Q90 A;  1BNF A;  3F14 A;  1RSN A;  1MWT A;  1Y4K A;  3EHC A;  1W4N A;  1UGI A;  3D3L A;  1YVB I;  2F5W A;  3J7Y d;  4J8T A;  5IEO A;  1GOV A;  1RN7 A;  1DMQ A;  4IPB A;  3OX9 A;  4FCJ A;  3LTA A;  4FMD A;  3UB1 A;  1BRN L;  5M19 A;  1N8R 4;  2RGQ A;  2OQE A;  2XSO B;  4WYK A;  2R41 A;  3UL5 A;  1RMS A;  2CH9 A;  3BIR A;  3NQZ A;  3KN4 A;  3F7S A;  3UNL A;  3DXO A;  1CYV A;  1T3B A;  2BNG A;  2XF3 A;  3D79 A;  3D9R A;  5AYS C;  2UGI A;  5G2G A;  3SOA A;  1VQN 3;  2HMM B;  3CCS 3;  2FXT A;  1JZD A;  1EUI C;  1LRA A;  1E97 A;  1MNL A;  3OXA A;  1GSP A;  2YFJ B;  1CYU A;  1FA3 A;  1RNB A;  3U1W A;  2F56 A;  3EQQ B;  2IYJ A;  5CLK A;  3CNM A;  4HM8 B;  4EV5 A;  1SII A;  1RGE A;  1L5G B;  2UUG C;  2XGN A;  3FG1 A;  2ZA4 A;  3CMA 3;  1UI7 A;  3PCR A;  3T0U A;  4L8P A;  2Y73 A;  1GY6 A;  1Q86 4;  3V92 A;  2B1X B;  3FSD A;  1M1K 4;  1KWI A;  3QK9 A;  5CF1 A;  2JDI H;  2CFK A;  4O3V A;  1VQ6 3;  1D6Y A;  4XDV A;  1YGE A;  4IIA A;  4MJD A;  3LTC A;  1QAK A;  1NDO B;  2FNQ A;  1X1X A;  2RCD A;  3ECF A;  2BMQ B;  2HMJ B;  4O8S A;  1W2B 2;  3OWY A;  1DVD A;  1AY7 A;  1ULI B;  4K61 A;  2Q07 A;  5TGN A;  1FZU A;  1Q81 4;  5EQL A;  2STD A;  3H51 A;  4J5K A;  1LOX A;  3X3X A;  2Z76 A;  3CCR 3;  4FR9 A;  1T2I A;  3F9S A;  3DY5 A;  1D6Z A;  3OV4 A;  1EKM A;  2W9Q A;  4HJL B;  3SOY A;  1TIJ A;  1ZX2 A;  1NU3 A;  1V74 A;  3AGO A;  3B4O A;  1S5A A;  1W01 A;  4HM7 B;  3B8L A;  3FGY A;  1BRG A;  1GOY A;  1NJI 4;  2CK3 H;  1OH0 A;  1B2U A;  1A2K A;  1NWW A;  4BIR A;  5BIR A;  3NM7 A;  1YHQ 3;  2FGT A;  2Z7A A;  1SAR A;  3D5G A;  4N3V A;  3WR2 A;  1RGH A;  1IT7 A;  1UI8 A;  2HMN B;  4GSP A;  1FGQ A;  3CCL 3;  1TP6 A;  3EB8 A;  4J9A A;  2QA4 3;  1O7H B;  3GRD A;  4HM2 B;  2KRT A;  3FH1 A;  3PYJ A;  1DYU A;  1GOU A;  3DGO A;  4LZI A;  1BOX A;  2WO0 A;  1Q9E A;  1GMQ A;  4R9L A;  1A2P A;  1BRH A;  2XGL A;  2KF3 A;  4OK0 A;  1YJW 3;  1JB2 A;  2IMJ A;  2CWT A;  4N6T A;  1RCK A;  2E2V A;  1N9J A;  3EC9 A;  1IK3 A;  3K63 A;  5BU4 A;  4ILF A;  4CDL A;  5IEP A;  3UL6 A;  3BND A;  5CF2 A;  2CWU A;  4N6O B;  3MYT A;  3WOF B;  1BSB A;  1B2X A;  2R4I A;  3N8B A;  3WHO A;  4X2O A;  4N6V 0;  4JRF A;  1VQ8 3;  1JZO A;  1RGA A;  1N9E A;  3CXC 2;  2AAE A;  1BRK A; 
#chains in the Genus database with same CATH homology
 3EBT A;  1YI2 3;  3WOD G;  3S28 A;  5A0O B;  4O02 B;  3NQY A;  4WYK B;  1QMA A;  3CPO A;  3X3Z A;  3IMA B;  2OTL 3;  1GD3 A;  1IVV A;  4MMY B;  1W2Z A;  2MC8 A;  3I0Y A;  3X3Y A;  2BT3 A;  4HM4 B;  1WMP A;  3FCS B;  4WP5 A;  3LTB A;  3NV0 B;  3WA3 A;  1FGM A;  4NHF A;  3NHX A;  3HI7 A;  1JRQ A;  3TDG A;  1NB5 I;  4WFO A;  1W6C A;  1ASK A;  3EN8 A;  1QVG 2;  2W56 B;  3HII A;  1QAF A;  4WHA A;  2JQ5 A;  2OQE C;  3LT8 A;  5KP3 A;  4N6M A;  2L4V A;  2XEP A;  1Q82 4;  5IG0 A;  1QAL A;  2XRX B;  1O7W B;  3GAX A;  2W04 A;  3H3H A;  5IW9 A;  3OWU A;  3PZW A;  1T5Y A;  1SQW A;  2XH9 A;  4XBT A;  3ROB A;  3M8C A;  3SED A;  1IQ8 A;  3G4S 3;  1AR0 A;  4ZM8 A;  1F8N A;  4N6L A;  2YFI B;  1S72 3;  4RNZ A;  1VQL 3;  2W03 A;  2WOF A;  3U97 A;  1ISK A;  2QIY A;  2CFL A;  3N54 B;  1VQ7 3;  1QJG A;  5ELU A;  3WA2 X;  8CHO A;  4FCM A;  3FG4 A;  4HZ9 B;  5D82 A;  1FUW A;  5LC7 A;  4LMI A;  3B4P A;  1STD A;  5D83 A;  5IG3 A;  3NV0 A;  5AYR B;  1Q42 A;  4KFD A;  4HBR A;  4MEI A;  3MKI A;  4ORL A;  3DGM A;  1JKG B;  3MSO A;  4R4K A;  2W56 A;  2RFR A;  1WNH A;  3AMO B;  2QGU A;  1R4C A;  1FGO A;  2WGO A;  4JF8 A;  2V1L A;  2HMK B;  1KSI A;  1N5P A;  3LXU X;  3B7C A;  3X42 A;  4NRE A;  2BMO B;  5STD A;  3RDE A;  3EN1 B;  2BMR B;  3GZY B;  5AIF A;  1TUH A;  1W5Z A;  1JB5 A;  1U5O A;  2OWP A;  4MMX B;  1OHS A;  2Y74 A;  2GXF A;  3NX0 A;  1A90 A;  3CC7 3;  3G8Z A;  4GB5 A;  1IU7 A;  3GZR A;  1D6U A;  1ROA A;  1NB3 I;  1ROV A;  2PZV A;  3BLZ A;  4H61 A;  2F98 A;  2HMO B;  1TU5 A;  4R80 A;  1EQK A;  1KQS 2;  3CME 3;  1VQ9 3;  2W6J H;  1K41 A;  1A67 A;  1FGR A;  3SXX A;  3VGN A;  1WMN A;  5BXQ A;  3QRD A;  2IUJ A;  1W7C A;  1VQP 3;  3VF1 A;  3JUM A;  4IT7 A;  1BUQ A;  4AKZ A;  1OGZ A;  4BTW A;  3DZL A;  3S27 A;  1JKG A;  3CD6 3;  3WDG B;  3MHE A;  3IPT A;  3AMO A;  2W9P A;  1OHO A;  2P09 A;  2UX0 A;  4KFF A;  5AEU B;  2B24 B;  2P05 A;  1N5H A;  1IT8 A;  6STD A;  5JBS A;  1G96 A;  3DMC A;  3JUQ A;  1N8Q A;  2ML5 A;  3SLU A;  1A2V A;  2BO9 B;  1QVF 2;  3DGL A;  2KXG A;  4U13 A;  1YIT 3;  3K0Z A;  4I4K A;  3CCQ 3;  1JNQ A;  2ML6 A;  3WMD A;  4PEJ A;  1OPY A;  1FGT A;  3CNX A;  3DM8 A;  4XBX A;  4LGQ A;  1IQX A;  3EF8 A;  5FGO A;  1MOL A;  1TFK A;  3LML A;  4KZ1 A;  1KD1 4;  4FMB A;  1W02 A;  4K90 B;  2F86 B;  3FLJ A;  1J2B A;  2INX A;  3BB9 A;  3SX1 A;  4KFE A;  2LYX A;  4OUQ A;  4XB5 A;  1NO3 A;  3PS8 A;  5BVB A;  5D81 A;  1LXE A;  3Q1C A;  4XBY A;  1YJN 3;  2SBL A;  1OGX A;  3F7X A;  1KC8 4;  3CC2 3;  2O3O A;  3KSE D;  3EX9 A;  2GU1 A;  1WMO A;  1EA2 A;  1OHP A;  3EJV A;  1DMM A;  1AVK A;  4EC6 A;  4HM1 B;  5KP4 A;  1GY5 A;  3PXM A;  3BNB A;  4EYC A;  3NBR A;  1HKX A;  1GD4 A;  3KSP A;  3STD A;  2C10 A;  4QWT A;  3KE7 A;  3GZB A;  1HU9 A;  2P0X A;  3CCU 3;  4FCZ A;  2OOV A;  3Q2P A;  1AVL A;  1VQ5 3;  3N9H A;  2CG0 A;  1M90 4;  5IG4 A;  3MG2 A;  2IA7 A;  3G0K A;  3LYG A;  1AV4 A;  2D1W A;  1O7N B;  3X40 A;  1M9G A;  4KVH A;  2E2T A;  3MG3 A;  1VQK 3;  2C11 A;  2BHM A;  3FG3 A;  4R9K A;  3E99 A;  3O8Y A;  3LZA A;  4H3U A;  4BTX A;  2W0Q A;  3F8H A;  3RGA A;  2YFL B;  2OTJ 3;  1W6G A;  3EBY A;  1IVX A;  4HM3 B;  5LC6 A;  1VZZ A;  3BNC A;  5AIG A;  5AI1 A;  3CPW 2;  1DVC A;  3ER7 A;  2Z6B A;  1O7P B;  3CCV 3;  3K5T A;  3NBJ A;  1SPU A;  2CFW A;  2D42 A;  3NBB A;  2Z77 A;  1K28 A;  4HM6 B;  4LSO A;  4X2H A;  5CK6 A;  2P38 A;  3BNE A;  3VSY A;  1JN5 B;  1WQL B;  2CWV A;  4HVN A;  1EG9 B;  3OW2 2;  1IV7 A;  5JPP A;  2YX9 A;  1ULJ B;  5DRV A;  1DMN A;  1RJO A;  2XFS A;  5FW5 A;  3S29 A;  5I97 A;  3ALA A;  3HIG A;  1JB4 A;  2XR8 B;  1Q40 B;  4FMA A;  1JJ2 2;  1OCV A;  3I56 3;  2ZL8 A;  3KFQ C;  3RGR A;  4EV2 A;  4HZB B;  3S67 A;  3I55 3;  4XM4 A;  3UJM A;  3LH4 A;  1IV9 A;  4N6U A;  1IQY A;  1Q7Y 4;  3MPH A;  3EE1 A;  4Q53 A;  3DGN A;  4RBN A;  4HYZ A;  2GU3 A;  4L7K A;  3LT9 A;  3CCJ 3;  3JUO A;  4RZM A;  1WTH A;  3K9M C;  3G16 A;  2KCD A;  1ZO2 A;  3V99 A;  2CG1 A;  1CEW I;  1GY7 A;  1TFO A;  2GEX A;  4EBG A;  1GS3 A;  3LTD A;  3KKG A;  5EEO A;  1OF5 B;  1LVN A;  1STF I;  1W6Y A;  4HM5 B;  5JPU A;  1PFP A;  2WOH A;  3L0R A;  4HKV B;  2F99 A;  2HML B;  1UUW B;  4CCV A;  2A15 A;  2CHC A;  1O7M B;  1C7H A;  1JV2 B;  2MF7 A;  3CU3 A;  3CCE 3;  3IJE B;  4AKY A;  3G71 3;  4FMC A;  5AII A;  5HGR A;  1US1 A;  1JN5 A;  2CIU A;  3JUN A;  1CQS A;  2P0M A;  5KP1 A;  5IEN A;  1SJW A;  3OWS A;  1Q40 A;  4HM0 B;  1O7G B;  4K1V A;  3GWR A;  1M1X B;  2CW9 A;  3NUV A;  1E3R A;  7STD A;  1LNH A;  2PNC A;  2XSH B;  3MG1 A;  2CC3 A;  4LEH A;  2LQV A;  2XFT A;  3PGB A;  3FF2 A;  3FZW A;  3KII A;  2WGQ A;  1K73 4;  3PCS A;  2GEY A;  1GYB A;  3F40 A;  3NM2 A;  2W2C A;  4RNY A;  1YJ9 3;  3T8N A;  4MMZ B;  2OCT A;  2K0M A;  2K54 A;  1OF5 A;  3JVC A;  3HX8 A;  3T8U A;  4L8O A;  1U8C B;  1OAC A;  3X41 A;  3F8X A;  3FKA A;  4OVM A;  1IDP A;  4GL6 A;  4XDW A;  5AEW B;  2QEX 3;  3MWZ A;  2OOV C;  1UW1 A;  3LOY A;  1IVW A;  3SVA A;  2RSX A;  3GZX B;  2CFD A;  2CFG A;  5IG5 A;  1VQM 3;  1K8A 4;  1VQ4 3;  2O9U X;  1YIJ 3;  1K9M 4;  4EXR A;  2GBW B;  1UUV B;  4K1U A;  1E3V A;  5EVH A;  2I9W A;  3JUP A;  3G6E 3;  5DRE A;  1VQO 3;  5IER A;  2GBX B;  1OUN A;  4R1K A;  4G1M B;  3CC4 3;  1RKY A;  4AEQ A;  3V98 A;  3HZP A;  4BTY A;  2E2U A;  5AIH A;  1RRL A;  2CKF B;  1IVU A;  1PU4 A;  4STD A;  3WOE B;  2ZDJ A;  1SIH A;  4N6N B;  4O2H A;  5IF6 A;  3S5C A;  4WWU C;  3FF0 A;  4TX4 A;  1W00 A;  5CXO A;  5ELJ A;  2IUK A;  3DUK A;  3KZT A;  3NXJ A;  1RRH A;  1Z1S A;  2M7O A;  3HK4 A;  3K7C A;  3A76 A;  3Q90 A;  3F14 A;  1Y4K A;  3EHC A;  1W4N A;  3D3L A;  1YVB I;  3J7Y d;  4J8T A;  5IEO A;  1RN7 A;  1DMQ A;  4IPB A;  3OX9 A;  4FCJ A;  3LTA A;  4FMD A;  3UB1 A;  1N8R 4;  2RGQ A;  2OQE A;  2XSO B;  4WYK A;  3UL5 A;  2CH9 A;  3NQZ A;  3KN4 A;  3F7S A;  3UNL A;  3DXO A;  1CYV A;  2XF3 A;  2BNG A;  3D9R A;  5AYS C;  5G2G A;  3SOA A;  1VQN 3;  2HMM B;  3CCS 3;  2FXT A;  1E97 A;  1MNL A;  3OXA A;  2YFJ B;  1CYU A;  1FA3 A;  3U1W A;  3EQQ B;  5CLK A;  3CNM A;  4HM8 B;  4EV5 A;  1SII A;  1L5G B;  2XGN A;  3FG1 A;  3CMA 3;  1UI7 A;  3PCR A;  3T0U A;  4L8P A;  2Y73 A;  1GY6 A;  1Q86 4;  3V92 A;  2B1X B;  3FSD A;  1M1K 4;  1KWI A;  3QK9 A;  5CF1 A;  2JDI H;  2CFK A;  4O3V A;  1VQ6 3;  1D6Y A;  4XDV A;  1YGE A;  4IIA A;  4MJD A;  3LTC A;  1QAK A;  1NDO B;  2FNQ A;  3ECF A;  2RCD A;  4O8S A;  2BMQ B;  2HMJ B;  1W2B 2;  3OWY A;  1DVD A;  1ULI B;  4K61 A;  2Q07 A;  5TGN A;  1Q81 4;  5EQL A;  2STD A;  3H51 A;  1LOX A;  3X3X A;  2Z76 A;  3CCR 3;  4FR9 A;  3F9S A;  3DY5 A;  1D6Z A;  3OV4 A;  1EKM A;  2W9Q A;  4HJL B;  3SOY A;  1TIJ A;  1ZX2 A;  1NU3 A;  1V74 A;  3B4O A;  1S5A A;  1W01 A;  4HM7 B;  3B8L A;  3FGY A;  1NJI 4;  2CK3 H;  1OH0 A;  1A2K A;  1NWW A;  3NM7 A;  1YHQ 3;  2FGT A;  2Z7A A;  4N3V A;  1IT7 A;  1UI8 A;  2HMN B;  1FGQ A;  3CCL 3;  1TP6 A;  3EB8 A;  4J9A A;  2QA4 3;  1O7H B;  3GRD A;  4HM2 B;  2KRT A;  3FH1 A;  3PYJ A;  1DYU A;  3DGO A;  4LZI A;  4R9L A;  2WO0 A;  2XGL A;  4OK0 A;  1YJW 3;  1JB2 A;  2IMJ A;  2CWT A;  4N6T A;  2E2V A;  1N9J A;  3EC9 A;  1IK3 A;  3K63 A;  4CDL A;  5IEP A;  3UL6 A;  3BND A;  5CF2 A;  2CWU A;  4N6O B;  3MYT A;  3WOF B;  2R4I A;  3N8B A;  4X2O A;  4N6V 0;  4JRF A;  1VQ8 3;  3CCM 3;  1N9E A;  3CXC 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...