4TX4A

Crystal structure of a single-domain cysteine protease inhibitor from cowpea (vigna unguiculata)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
NSLEIDSLARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWLNFKELQEFKHVGDAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression in Escherichia coli of cysteine protease inhibitors from cowpea (Vigna unguiculata): The crystal structure of a single-domain cystatin gives insights on its thermal and pH stability.
pubmed doi rcsb
source organism Vigna unguiculata
molecule tags Hydrolase inhibitor
molecule keywords Cysteine proteinase inhibitor
total genus 15
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4tx4A00
3L0RA 3KFQC 4N6UA 1TIJA 1WNHA 1GD3A 2OCTA 2W9PA 3UL5A 5ELJA 3QRDA 3GAXA 1ROAA 2W9QA 1G96A 1RN7A 1LXEA 1YVBI 4CCVA 4TX4A 5A0OB 1CYVA 1DVDA 1N5HA 1KWIA 4N6OB 1MOLA 1A67A 3S67A 3UL6A 3LH4A 3Q2PA 1IV7A 1M9GA 1PFPA 1N9JA 2O9UX 3IMAB 4N6TA 1MNLA 3PXMA 1R4CA 1STFI 1CYUA 2CH9A 4N6MA 5EQLA 1CEWI 4N6NB 4EYCA 4N6LA 5LC7A 5LC6A 1IV9A 3KSED 3PYJA 1EQKA 1NB5I 1GD4A 1FA3A 1NB3I 2BO9B 3SVAA 3K9MC 4IT7A 3NX0A 5ELUA 1FUWA 1DVCA 4N6V0 4LZIA 3PS8A 4ZM8A 1A90A 1N5PA 3MWZA 2KXGA
chains in the Genus database with same CATH superfamily
3HIIA 3JUQA 4FCZA 4ORLA 1W2ZA 1VQ43 1W6GA 4HM4B 4MEIA 3ECFA 1AQZA 3B8LA 3EF8A 3FLJA 3JUMA 1BNIA 4KFDA 5D81A 4BL3A 3I553 2KRTA 1BU4A 3ROBA 1K734 1KC84 1Q9EA 1N5HA 1QMAA 2IA7A 2HMLB 1UI8A 2UUGC 3UL6A 1WMOA 1BNSA 2XRXB 3T8UA 3DH2A 4RBNA 2ML5A 1O7GB 3DXOA 3LMLA 4CJNA 2Z6BA 3F14A 1FA3A 1PYLA 3SOAA 1UUVB 1SIIA 2KAAA 4J5GA 4O8SA 3ER7A 3WA3A 2C4BA 3F40A 3H51A 1FW7A 1TJDA 1JRQA 2F98A 3D3LA 4I5QA 3SX1A 4XBXA 5M19A 1RMSA 3KSPA 2CFWA 2CX0A 1GYBA 4EW5A 1UGHI 3CCU3 3Q90A 1I3FA 1NU3A 4RNTA 1FGQA 2AAEA 2F4YA 3BNCA 4R9LA 1W6YA 4XBTA 4IPBA 1BNGA 1KD14 3S27A 1M1K4 3CCL3 4OK0A 2I9WA 1VQL3 5CF1A 1GOUA 3IJEB 3NM2A 3F9SA 3STDA 1I0XA 5DRVA 1EG9B 1UI7A 3NBBA 5IENA 1DMMA 5LC7A 1YIJ3 2HOHA 1BRNL 4HYZA 1K28A 1BIRA 3N54B 4HOHA 1VQ53 2HMJB 1RGCA 3MPHA 5ELUA 2BNGA 4AKZA 1O7HB 2JDIH 4HZ9B 1VQ73 1K8A4 2XH9A 1JB2A 5IEOA 4LSOA 3CXC2 3BNEA 5IERA 1IU7A 1LXEA 4KT3B 4TX4A 3G4S3 1IDPA 1VQN3 1LOWA 4FR9A 1KWIA 5AIHA 3EE1A 1YIT3 4K1UA 1OHPA 1RGLA 1L5GB 3WR2A 1RLSA 4XDWA 5IF6A 1N8QA 3BU4A 3KCHA 4HM7B 3WOEB 3LTCA 5LC6A 3PYJA 1RN4A 4NREA 4GB5A 4HM3B 1OF5B 2GU3A 1LOVA 4WFOA 5GSPA 4EBGA 3EQQB 3CCE3 1DVCA 1AR0A 2HMMB 4KZ1A 7STDA 3FSDA 1VQQA 1W4NA 4FMAA 1B2UA 2OQEC 5FW5A 4MMXB 5CLKA 1D6YA 2M7OA 2W9QA 4H3UA 3JUOA 1G96A 3FCSB 3FG4A 1I70A 4Q53A 1ZX2A 3DGMA 3G16A 3K0ZA 3EC9A 4FMCA 1YJ93 1OHSA 3HI7A 3HIGA 4XBYA 2W2CA 4N6TA 1G02A 2F5WA 2O9UX 1BSEA 1OHOA 1RTUA 3URPA 3GZBA 5EQLA 3WMDA 3F8XA 5G2GA 5IG0A 3NQYA 4KFEA 3K7CA 3ZG5A 3KE7A 1MWTA 1DE3A 1X1XA 2HMKB 3WA2X 1OCVA 3DUKA 3LTBA 4IT7A 2K54A 2Q07A 3EBYA 1W5ZA 5FGOA 4FMBA 1N5PA 3CD63 2KXGA 2XEPA 1RRLA 1JV2B 2XR8B 3B4PA 2XFTA 4LGQA 1GOYA 1TP6A 4NHFA 4O02B 5D83A 5HOHA 2OTL3 4H61A 3F7XA 3G713 4CCVA 2W6JH 5A0OB 1DMQA 3EN1B 1JNQA 1AY7A 4RZMA 2Z77A 3DZLA 3D9RA 3K5TA 4PEJA 1RRHA 4CPKA 3S5CA 1BSBA 3CCR3 3AGOA 3FZWA 1SARA 2QIYA 4HBRA 6RNTA 3IMAB 1BANA 2OQEA 5JBSA 3PXMA 3HX8A 4XB5A 1B2SA 4HM6B 1RDSA 1SQWA 3KSED 1JKGB 4HM2B 3FGYA 1FUTA 3SOYA 1US1A 1HYFA 1YGWA 2F56A 4GSPA 1RSNA 1Q40B 3B7CA 3RGAA 4BTWA 3MKIA 3KN4A 3KFQC 2FXTA 1JN5A 2W9PA 3BB9A 1TRQA 3EHCA 2D42A 1FGMA 5M18A 3VF1A 5CF2A 1RN7A 1NO3A 1UCLA 1GY7A 1DVDA 3NHXA 4OUQA 1OGZA 1ULJB 1RCLA 4LMIA 3G0KA 8RNTA 1FGTA 1GMQA 4HM5B 5EVHA 2O3OA 1N9JA 5CXOA 3LYGA 1ROVA 1WQLB 2P38A 4X2HA 4EV5A 1BRHA 2H0GA 1RGAA 5BXQA 5AIGA 1JJ22 2BO9B 3FG1A 3B4OA 3K9MC 1I2EA 4RNZA 2WO0A 3KZTA 1NJI4 2R4IA 3CU3A 1EA2A 1B21A 1BNRA 1RGKA 2CK3H 2L1SA 1B27A 3X3YA 3GWRA 2YFJB 2LQVA 2W56A 2Z76A 2CWTA 2WOHA 3MG3A 5KP1A 4MMZB 2GBWB 3SYUA 1BSDA 4U13A 1YGEA 4L7KA 2KCDA 3N9HA 4MJDA 1PFPA 2CHCA 1JBTA 1R4CA 4N6MA 1IVVA 3V92A 4I4KA 4GL6A 4DKIA 3OWUA 1IV9A 2PNCA 2K0MA 1GY6A 3HOHA 3MG1A 4K61A 5BU4A 1AV4A 1NB3I 3SVAA 3PGBA 3Q3FA 1BNEA 4XM4A 3GZYB 3V99A 3ZG0A 1J2BA 4EXRA 3RGRA 4ZM8A 1OF5A 3UB1A 2AADA 2ZA4A 3VGNA 2A15A 1GMRA 1TU5A 1WNHA 2J8XB 1I8VA 3BLZA 4WWUC 3UL5A 1GMPA 1HU9A 1CQSA 2F5MA 4J8TA 1K41A 1IVXA 1EUIC 5AEWB 1F8NA 1B2ZA 4HM1B 1YI23 5AYSC 3AMOA 2QA43 3PZWA 2BMQB 3NV0A 1Q824 1B3SA 1KQS2 1B2XA 4HVNA 1NNVA 4J9AA 4X2OA 1QVF2 4FCMA 1C7HA 1CYUA 2BMOB 1E97A 2Z7AA 3DGYA 3DGOA 2C10A 3DMCA 4HZBB 3BNDA 3OX9A 2CIUA 3WHOA 1ASKA 3CC43 4BIRA 1B2MA 1UW1A 2MF7A 3OXAA 2ZDJA 3LTDA 2B24B 1RN1A 3CMA3 4BL2A 3EB8A 5JPPA 3Q1CA 1IQ8A 2F99A 3FG3A 3CCM3 1TFOA 1GD3A 1RGEA 1MGRA 2XSOB 3D5IA 2XF3A 3GAXA 1WMNA 1RGGA 3ZFZA 2C11A 3CNMA 3OV4A 5IG4A 5TGNA 2RFRA 5AIFA 1WMPA 3AGNA 3HK4A 1HZ1A 2BMRB 3UNLA 1HKXA 1FUSA 4KFFA 1M9GA 2UX0A 1IQYA 1JZDA 4HM8B 2RNTA 3CME3 1STDA 4EYCA 3X42A 1BRJA 1JB4A 2BHMA 2L4VA 2SARA 4G1MB 3SXXA 2YX9A 1QVG2 1YNVX 3A76A 2GSPA 1MWSA 1BVIA 2CFDA 1MWRA 1VZZA 1B20A 3GSPA 4IIAA 2GEYA 4J5KA 3EN8A 2CC3A 3CCQ3 1JBSA 2OCTA 4R9KA 1KSIA 3LTAA 3MG2A 1N9EA 2KF6A 1VQM3 1BAOA 1ZGXA 3LOYA 5KP3A 1W02A 2OTJ3 3OWSA 3GZRA 3G8ZA 4KVHA 3T8NA 1RCKA 1BGSA 4BTXA 4WYKB 2SBLA 4QWTA 1DMNA 1E3RA 3LXUX 1VQ93 1S5AA 1VQK3 1RNBA 4N6NB 1IK3A 2PZVA 2MC8A 2H0HA 5KP4A 5DREA 2WOFA 1LRAA 1AVLA 1TFKA 2ML6A 4WHAA 1IYYA 2WGQA 3CC73 5BVBA 5IW9A 1YJN3 1PU4A 1O7MB 2H0IA 1NDOB 1I2GA 1BNJA 3F8HA 3I0YA 1TTOA 5RNTA 2CFLA 2OWPA 4JRFA 1RKYA 4RNYA 5AYRB 1G0TA 5IG5A 3DM8A 3JVCA 2WGOA 3NM7A 3NUVA 4AKYA 4GHOA 2CFGA 5EEOA 1W6CA 3D4AA 1I0VA 1E3VA 2KF5A 4WP5A 1D6UA 1V57A 1W7CA 2V1LA 1LNIA 1QAKA 3X40A 3G6E3 1YJW3 3KKGA 2CWVA 3SLUA 3N8BA 5AI1A 1CEWI 1OUNA 5AIIA 2F86B 3BIRA 3M8CA 2CX1A 1UCIA 3CNXA 1K9M4 1TRPA 1X1WA 3CPOA 1IVWA 1QALA 1A2PA 1MWUA 2XGLA 3PS8A 1Q7Y4 2KF4A 1ULIB 1O7NB 3I563 1VQ63 2FNQA 5BIRA 1TIJA 4LEHA 1M904 1C54A 3BNBA 1BRIA 2UGIA 1VQ83 1ISKA 1EKMA 1ROAA 2BU4A 2ZL8A 1RGHA 1YVBI 3DGLA 1RGFA 2RGQA 4HAAA 3SEDA 1O7WB 3WOFB 2CFKA 2YFLB 3JUPA 4L8OA 3S67A 3DGNA 1RNTA 3CCS3 1SJWA 1LVNA 2IMJA 2IUKA 2W04A 5STDA 3IPTA 1FZUA 1WTHA 3D79A 1IT7A 1LNHA 4NPBA 1T5YA 3X3ZA 3LT8A 1Q7HA 2RCDA 1BNFA 3FF0A 1T2HA 1EEJA 1A2KA 2E2VA 1M1XB 1OACA 4ILFA 3O8YA 3U97A 1ZS7A 3L0RA 5AEUB 1Q40A 1SIHA 3WDGB 4LYLB 1GY5A 1OGXA 2RSXA 3QRDA 3EJVA 1IQXA 4HJLB 1SPUA 1S723 2QEX3 3U1WA 1Y4KA 2ZHXB 4HM0B 1U8CB 2Y74A 1Q814 1FGRA 2GBXB 3JUNA 1CH0A 3Q2PA 2IYJA 3TDGA 1T2IA 2HMNB 3FF2A 3T0UA 4WYKA 4R1KA 2P09A 4L8PA 3CPW2 1W2B2 1BUJA 4EC6A 1QAFA 3MYTA 1UGIA 5M1AA 3NBRA 3V98A 1BSCA 1LQMB 1LQGC 1VQP3 1YHQ3 2INXA 3EBTA 1JN5B 5HGRA 4N6UA 3NQZA 4XDVA 4AEQA 1VQO3 5CK6A 5ELJA 1OH0A 1V74A 2GEXA 2D1WA 1CYVA 3MHEA 1UDII 1DETA 2W56B 3UJMA 3CCJ3 3OW22 1W00A 6STDA 1TUHA 3LT9A 2IUJA 1Q864 3LH4A 5IEPA 4FCJA 3FH1A 1FGOA 1GS3A 2RBIA 3DY5A 2FGTA 2HMOB 4R4KA 1MNLA 3CCV3 3F7SA 3LZAA 2CW9A 1BOXA 5IG3A 4N6LA 1BRGA 3NXJA 1LOYA 2CWUA 6GSPA 3FKAA 4N3VA 4OVMA 2P05A 1Q42A 3EX9A 9RNTA 1BRKA 1UUGB 4HKVB 2YFIB 8CHOA 4N6V0 1A90A 1BSAA 3MWZA 2JQ5A 1X1YA 4R80A 1RHLA 2XGNA 4O3VA 2OOVC 1PY3A 1UUWB 1JB5A 1BUQA 3QK9A 3X3XA 3HZPA 3K63A 1JBRA 1FYSA 3RDEA 2K3DA 3PCSA 2CKFB 1YVSA 2P0MA 1GSPA 1I3IA 1A67A 1W01A 2BT3A 4BU4A 3AMOB 2CG0A 3AHWA 2CH9A 1UCKA 4BTYA 2LYXA 2GU1A 1I2FA 3S29A 3OWYA 1LOXA 1NB5I 2E2UA 2STDA 1IVUA 1BRSA 5D82A 2P0XA 3ALAA 3KIIA 4EV2A 1V58A 3A5EA 1FUWA 1QJGA 1A2VA 1DYUA 3E99A 1OPYA 1N8R4 3AHSA 2XSHB 2KF3A 3WODG 7GSPA 4O2HA 7RNTA 3PCRA 3H3HA 2W03A 1D6ZA 1T3BA 1JZOA 2CG1A 2Y73A 4FMDA 3D5GA 4N6OB 1MOLA 2IY2A 5I97A 4STDA 3RNTA 2E2TA 4K1VA 1UCJA 1IT8A 4K90B 1IV7A 2OOVA 1U5OA 2XFSA 2W0QA 3NV0B 1X1UA 4MMYB 1STFI 3GRDA 1Z1SA 1AVKA 2GXFA 2QGUA 3GZXB 2R41A 3CC23 5JPUA 1RJOA 3MSOA 1EQKA 1NWWA 5G1LA 1R4YA 1GD4A 1MGWA 3J7Yd 1O7PB 3VSYA 1ZO2A 3NBJA 2BIRA 2B1XB 1JKGA 3NX0A 4CDLA 3S28A 4JF8A 1GOVA 4LZIA 3X41A 5G1KA
chains in the Genus database with same CATH topology
3HIIA 3JUQA 4FCZA 4ORLA 1W2ZA 1VQ43 1W6GA 4HM4B 4MEIA 3ECFA 3B8LA 3FLJA 3EF8A 3JUMA 4KFDA 5D81A 3I553 2KRTA 3ROBA 1K734 1KC84 1QMAA 1N5HA 2IA7A 2HMLB 1UI8A 3UL6A 1WMOA 2XRXB 3T8UA 4RBNA 2ML5A 1O7GB 3DXOA 3LMLA 2Z6BA 3F14A 1FA3A 3SOAA 1UUVB 1SIIA 4O8SA 3WA3A 3ER7A 3F40A 3H51A 1JRQA 2F98A 3D3LA 3SX1A 4XBXA 3KSPA 2CFWA 1GYBA 3CCU3 3Q90A 1NU3A 1FGQA 3BNCA 4R9LA 1W6YA 4XBTA 4IPBA 1KD14 3S27A 1M1K4 3CCL3 4OK0A 2I9WA 1VQL3 5CF1A 3IJEB 3NM2A 3F9SA 3STDA 5DRVA 5IENA 1EG9B 1UI7A 3NBBA 1YIJ3 1DMMA 5LC7A 4HYZA 1K28A 3N54B 1VQ53 2HMJB 3MPHA 5ELUA 4AKZA 2BNGA 1VQ73 1O7HB 2JDIH 4HZ9B 1K8A4 2XH9A 1JB2A 5IEOA 4LSOA 3CXC2 3BNEA 5IERA 1IU7A 1LXEA 4TX4A 3G4S3 1IDPA 1VQN3 4FR9A 1KWIA 5AIHA 3EE1A 1YIT3 4K1UA 1OHPA 1L5GB 4XDWA 5IF6A 1N8QA 4HM7B 3WOEB 3LTCA 5LC6A 3PYJA 4NREA 4GB5A 4HM3B 1OF5B 2GU3A 4WFOA 4EBGA 3CCE3 3EQQB 1DVCA 1AR0A 2HMMB 4KZ1A 7STDA 3FSDA 1W4NA 4FMAA 2OQEC 5FW5A 4MMXB 5CLKA 1D6YA 2M7OA 2W9QA 4H3UA 3JUOA 1G96A 3FCSB 3FG4A 4Q53A 1ZX2A 3DGMA 3G16A 3K0ZA 3EC9A 4FMCA 1YJ93 1OHSA 3HI7A 3HIGA 4XBYA 2W2CA 4N6TA 2O9UX 1OHOA 3GZBA 5EQLA 3WMDA 3F8XA 5G2GA 5IG0A 3NQYA 4KFEA 3K7CA 3KE7A 2HMKB 3WA2X 1OCVA 3DUKA 3LTBA 4IT7A 2K54A 2Q07A 3EBYA 1W5ZA 5FGOA 4FMBA 1N5PA 3CD63 2KXGA 2XEPA 1RRLA 1JV2B 2XR8B 3B4PA 2XFTA 4LGQA 1TP6A 4NHFA 4O02B 5D83A 2OTL3 4H61A 3F7XA 3G713 4CCVA 2W6JH 5A0OB 1DMQA 3EN1B 1JNQA 4RZMA 2Z77A 3DZLA 3D9RA 3K5TA 4PEJA 1RRHA 3S5CA 3CCR3 3FZWA 2QIYA 4HBRA 3IMAB 2OQEA 5JBSA 3PXMA 3HX8A 4XB5A 4HM6B 1SQWA 3KSED 1JKGB 4HM2B 3FGYA 3SOYA 1US1A 3B7CA 1Q40B 3RGAA 4BTWA 3MKIA 3KN4A 3KFQC 2FXTA 1JN5A 2W9PA 3BB9A 3EHCA 2D42A 1FGMA 3VF1A 5CF2A 1RN7A 1NO3A 1GY7A 1DVDA 3NHXA 4OUQA 1OGZA 1ULJB 4LMIA 3G0KA 1FGTA 4HM5B 5EVHA 2O3OA 1N9JA 5CXOA 3LYGA 1ROVA 1WQLB 2P38A 4X2HA 4EV5A 5BXQA 5AIGA 1JJ22 2BO9B 3FG1A 3B4OA 3K9MC 4RNZA 2WO0A 3KZTA 1NJI4 2R4IA 3CU3A 1EA2A 2CK3H 3X3YA 3GWRA 2YFJB 2LQVA 2W56A 2Z76A 2CWTA 2WOHA 3MG3A 5KP1A 4MMZB 2GBWB 4U13A 1YGEA 4L7KA 2KCDA 3N9HA 4MJDA 1PFPA 2CHCA 1R4CA 4N6MA 1IVVA 3V92A 4I4KA 4GL6A 3OWUA 1IV9A 2PNCA 2K0MA 1GY6A 4K61A 3MG1A 1AV4A 1NB3I 3SVAA 3PGBA 4XM4A 3GZYB 3V99A 1J2BA 4EXRA 3RGRA 4ZM8A 1OF5A 3UB1A 3VGNA 2A15A 1TU5A 1WNHA 3BLZA 4WWUC 3UL5A 1HU9A 1CQSA 4J8TA 1K41A 1IVXA 5AEWB 1F8NA 4HM1B 1YI23 5AYSC 3AMOA 2QA43 3PZWA 2BMQB 3NV0A 1Q824 1KQS2 4HVNA 4J9AA 4X2OA 1QVF2 4FCMA 1C7HA 1CYUA 2BMOB 1E97A 2Z7AA 3DGOA 2C10A 3DMCA 4HZBB 3BNDA 3OX9A 2CIUA 3CC43 1ASKA 1UW1A 2MF7A 3OXAA 2ZDJA 3LTDA 2B24B 3CMA3 3EB8A 5JPPA 3Q1CA 2F99A 1IQ8A 3FG3A 3CCM3 1TFOA 1GD3A 2XSOB 2XF3A 3GAXA 1WMNA 2C11A 3CNMA 3OV4A 5IG4A 5TGNA 2RFRA 5AIFA 1WMPA 3HK4A 2BMRB 3UNLA 1HKXA 4KFFA 1M9GA 2UX0A 1IQYA 4HM8B 3CME3 1STDA 4EYCA 3X42A 1JB4A 2BHMA 2L4VA 4G1MB 3SXXA 2YX9A 1QVG2 3A76A 2CFDA 1VZZA 4IIAA 2GEYA 3EN8A 2CC3A 3CCQ3 2OCTA 4R9KA 1KSIA 3LTAA 3MG2A 1N9EA 1VQM3 5KP3A 3LOYA 1W02A 2OTJ3 3OWSA 3GZRA 3G8ZA 4KVHA 3T8NA 4BTXA 4WYKB 2SBLA 4QWTA 1DMNA 1E3RA 3LXUX 1VQ93 1S5AA 1VQK3 4N6NB 1IK3A 2PZVA 2MC8A 5KP4A 5DREA 2WOFA 1AVLA 1TFKA 2ML6A 4WHAA 2WGQA 3CC73 5BVBA 5IW9A 1YJN3 1PU4A 1O7MB 1NDOB 3F8HA 3I0YA 2CFLA 2OWPA 4JRFA 1RKYA 4RNYA 5AYRB 5IG5A 3DM8A 3JVCA 2WGOA 3NM7A 3NUVA 4AKYA 2CFGA 5EEOA 1W6CA 1E3VA 4WP5A 1D6UA 2V1LA 1W7CA 3G6E3 1QAKA 3X40A 1YJW3 3KKGA 2CWVA 3SLUA 3N8BA 5AI1A 1CEWI 1OUNA 5AIIA 2F86B 3M8CA 3CNXA 1K9M4 3CPOA 1IVWA 1QALA 2XGLA 1Q7Y4 3PS8A 1ULIB 1O7NB 3I563 1VQ63 2FNQA 1TIJA 4LEHA 1M904 3BNBA 1ISKA 1VQ83 1EKMA 1ROAA 2ZL8A 1YVBI 3DGLA 2RGQA 3SEDA 1O7WB 3WOFB 2CFKA 2YFLB 3JUPA 4L8OA 3S67A 3DGNA 3CCS3 1SJWA 1LVNA 2IMJA 2IUKA 2W04A 5STDA 3IPTA 1WTHA 1IT7A 1LNHA 1T5YA 3X3ZA 3LT8A 2RCDA 3FF0A 1A2KA 2E2VA 1M1XB 1OACA 3O8YA 3U97A 3L0RA 5AEUB 1Q40A 1SIHA 3WDGB 1GY5A 1OGXA 2RSXA 3QRDA 3EJVA 1IQXA 4HJLB 1SPUA 1S723 2QEX3 3U1WA 1Y4KA 4HM0B 1U8CB 2Y74A 1Q814 1FGRA 2GBXB 3JUNA 3Q2PA 3TDGA 2HMNB 3FF2A 3T0UA 4WYKA 4R1KA 2P09A 4L8PA 3CPW2 1W2B2 4EC6A 1QAFA 3MYTA 3NBRA 3V98A 1VQP3 1YHQ3 2INXA 3EBTA 1JN5B 5HGRA 4N6UA 3NQZA 4XDVA 4AEQA 1VQO3 5CK6A 5ELJA 1OH0A 1V74A 2GEXA 2D1WA 1CYVA 3MHEA 3UJMA 3OW22 2W56B 3CCJ3 1W00A 6STDA 1TUHA 3LT9A 2IUJA 1Q864 3LH4A 5IEPA 4FCJA 3FH1A 1FGOA 1GS3A 3DY5A 2FGTA 2HMOB 4R4KA 1MNLA 3CCV3 3F7SA 3LZAA 2CW9A 5IG3A 4N6LA 3NXJA 2CWUA 3FKAA 4N3VA 4OVMA 2P05A 1Q42A 3EX9A 4HKVB 2YFIB 8CHOA 4N6V0 1A90A 3MWZA 2JQ5A 4R80A 2XGNA 4O3VA 2OOVC 1UUWB 1JB5A 1BUQA 3QK9A 3X3XA 3HZPA 3K63A 3RDEA 3PCSA 2CKFB 2P0MA 1A67A 1W01A 2BT3A 3AMOB 2CG0A 2CH9A 4BTYA 2LYXA 2GU1A 3S29A 3OWYA 1LOXA 1NB5I 2E2UA 2STDA 1IVUA 5D82A 2P0XA 3ALAA 3KIIA 4EV2A 1FUWA 1QJGA 1A2VA 1DYUA 3E99A 1OPYA 1N8R4 2XSHB 3WODG 4O2HA 3PCRA 3H3HA 2W03A 1D6ZA 2CG1A 2Y73A 4FMDA 4N6OB 1MOLA 5I97A 4STDA 2E2TA 4K1VA 4K90B 1IT8A 2OOVA 1IV7A 1U5OA 2XFSA 2W0QA 3NV0B 4MMYB 1STFI 3GRDA 1Z1SA 1AVKA 2GXFA 2QGUA 3GZXB 3CC23 5JPUA 1RJOA 3MSOA 1EQKA 1NWWA 3J7Yd 1GD4A 1O7PB 3VSYA 1ZO2A 3NBJA 2B1XB 1JKGA 3NX0A 4CDLA 3S28A 4JF8A 4LZIA 3X41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0R A;  3KFQ C;  4N6U A;  1TIJ A;  1WNH A;  1GD3 A;  2OCT A;  2W9P A;  3UL5 A;  5ELJ A;  3QRD A;  3GAX A;  1ROA A;  2W9Q A;  1G96 A;  1RN7 A;  1LXE A;  1YVB I;  4CCV A;  4TX4 A;  5A0O B;  1CYV A;  1DVD A;  1N5H A;  1KWI A;  4N6O B;  1MOL A;  1A67 A;  3S67 A;  3UL6 A;  3LH4 A;  3Q2P A;  1IV7 A;  1M9G A;  1PFP A;  1N9J A;  2O9U X;  3IMA B;  4N6T A;  1MNL A;  3PXM A;  1R4C A;  1STF I;  1CYU A;  2CH9 A;  4N6M A;  5EQL A;  1CEW I;  4N6N B;  4EYC A;  4N6L A;  5LC7 A;  5LC6 A;  1IV9 A;  3KSE D;  3PYJ A;  1EQK A;  1NB5 I;  1GD4 A;  1FA3 A;  1NB3 I;  2BO9 B;  3SVA A;  3K9M C;  4IT7 A;  3NX0 A;  5ELU A;  1FUW A;  1DVC A;  4N6V 0;  4LZI A;  3PS8 A;  4ZM8 A;  1A90 A;  1N5P A;  3MWZ A;  2KXG A; 
#chains in the Genus database with same CATH topology
 3HII A;  3JUQ A;  4FCZ A;  4ORL A;  1W2Z A;  1VQ4 3;  1W6G A;  4HM4 B;  4MEI A;  3ECF A;  1AQZ A;  3B8L A;  3EF8 A;  3FLJ A;  3JUM A;  1BNI A;  4KFD A;  5D81 A;  4BL3 A;  3I55 3;  2KRT A;  1BU4 A;  3ROB A;  1K73 4;  1KC8 4;  1Q9E A;  1N5H A;  1QMA A;  2IA7 A;  2HML B;  1UI8 A;  2UUG C;  3UL6 A;  1WMO A;  1BNS A;  2XRX B;  3T8U A;  3DH2 A;  4RBN A;  2ML5 A;  1O7G B;  3DXO A;  3LML A;  4CJN A;  2Z6B A;  3F14 A;  1FA3 A;  1PYL A;  3SOA A;  1UUV B;  1SII A;  2KAA A;  4J5G A;  4O8S A;  3ER7 A;  3WA3 A;  2C4B A;  3F40 A;  3H51 A;  1FW7 A;  1TJD A;  1JRQ A;  2F98 A;  3D3L A;  4I5Q A;  3SX1 A;  4XBX A;  5M19 A;  1RMS A;  3KSP A;  2CFW A;  2CX0 A;  1GYB A;  4EW5 A;  1UGH I;  3CCU 3;  3Q90 A;  1I3F A;  1NU3 A;  4RNT A;  1FGQ A;  2AAE A;  2F4Y A;  3BNC A;  4R9L A;  1W6Y A;  4XBT A;  4IPB A;  1BNG A;  1KD1 4;  3S27 A;  1M1K 4;  3CCL 3;  4OK0 A;  2I9W A;  1VQL 3;  5CF1 A;  1GOU A;  3IJE B;  3NM2 A;  3F9S A;  3STD A;  1I0X A;  5DRV A;  1EG9 B;  1UI7 A;  3NBB A;  5IEN A;  1DMM A;  5LC7 A;  1YIJ 3;  2HOH A;  1BRN L;  4HYZ A;  1K28 A;  1BIR A;  3N54 B;  4HOH A;  1VQ5 3;  2HMJ B;  1RGC A;  3MPH A;  5ELU A;  2BNG A;  4AKZ A;  1O7H B;  2JDI H;  4HZ9 B;  1VQ7 3;  1K8A 4;  2XH9 A;  1JB2 A;  5IEO A;  4LSO A;  3CXC 2;  3BNE A;  5IER A;  1IU7 A;  1LXE A;  4KT3 B;  4TX4 A;  3G4S 3;  1IDP A;  1VQN 3;  1LOW A;  4FR9 A;  1KWI A;  5AIH A;  3EE1 A;  1YIT 3;  4K1U A;  1OHP A;  1RGL A;  1L5G B;  3WR2 A;  1RLS A;  4XDW A;  5IF6 A;  1N8Q A;  3BU4 A;  3KCH A;  4HM7 B;  3WOE B;  3LTC A;  5LC6 A;  3PYJ A;  1RN4 A;  4NRE A;  4GB5 A;  4HM3 B;  1OF5 B;  2GU3 A;  1LOV A;  4WFO A;  5GSP A;  4EBG A;  3EQQ B;  3CCE 3;  1DVC A;  1AR0 A;  2HMM B;  4KZ1 A;  7STD A;  3FSD A;  1VQQ A;  1W4N A;  4FMA A;  1B2U A;  2OQE C;  5FW5 A;  4MMX B;  5CLK A;  1D6Y A;  2M7O A;  2W9Q A;  4H3U A;  3JUO A;  1G96 A;  3FCS B;  3FG4 A;  1I70 A;  4Q53 A;  1ZX2 A;  3DGM A;  3G16 A;  3K0Z A;  3EC9 A;  4FMC A;  1YJ9 3;  1OHS A;  3HI7 A;  3HIG A;  4XBY A;  2W2C A;  4N6T A;  1G02 A;  2F5W A;  2O9U X;  1BSE A;  1OHO A;  1RTU A;  3URP A;  3GZB A;  5EQL A;  3WMD A;  3F8X A;  5G2G A;  5IG0 A;  3NQY A;  4KFE A;  3K7C A;  3ZG5 A;  3KE7 A;  1MWT A;  1DE3 A;  1X1X A;  2HMK B;  3WA2 X;  1OCV A;  3DUK A;  3LTB A;  4IT7 A;  2K54 A;  2Q07 A;  3EBY A;  1W5Z A;  5FGO A;  4FMB A;  1N5P A;  3CD6 3;  2KXG A;  2XEP A;  1RRL A;  1JV2 B;  2XR8 B;  3B4P A;  2XFT A;  4LGQ A;  1GOY A;  1TP6 A;  4NHF A;  4O02 B;  5D83 A;  5HOH A;  2OTL 3;  4H61 A;  3F7X A;  3G71 3;  4CCV A;  2W6J H;  5A0O B;  1DMQ A;  3EN1 B;  1JNQ A;  1AY7 A;  4RZM A;  2Z77 A;  3DZL A;  3D9R A;  3K5T A;  4PEJ A;  1RRH A;  4CPK A;  3S5C A;  1BSB A;  3CCR 3;  3AGO A;  3FZW A;  1SAR A;  2QIY A;  4HBR A;  6RNT A;  3IMA B;  1BAN A;  2OQE A;  5JBS A;  3PXM A;  3HX8 A;  4XB5 A;  1B2S A;  4HM6 B;  1RDS A;  1SQW A;  3KSE D;  1JKG B;  4HM2 B;  3FGY A;  1FUT A;  3SOY A;  1US1 A;  1HYF A;  1YGW A;  2F56 A;  4GSP A;  1RSN A;  1Q40 B;  3B7C A;  3RGA A;  4BTW A;  3MKI A;  3KN4 A;  3KFQ C;  2FXT A;  1JN5 A;  2W9P A;  3BB9 A;  1TRQ A;  3EHC A;  2D42 A;  1FGM A;  5M18 A;  3VF1 A;  5CF2 A;  1RN7 A;  1NO3 A;  1UCL A;  1GY7 A;  1DVD A;  3NHX A;  4OUQ A;  1OGZ A;  1ULJ B;  1RCL A;  4LMI A;  3G0K A;  8RNT A;  1FGT A;  1GMQ A;  4HM5 B;  5EVH A;  2O3O A;  1N9J A;  5CXO A;  3LYG A;  1ROV A;  1WQL B;  2P38 A;  4X2H A;  4EV5 A;  1BRH A;  2H0G A;  1RGA A;  5BXQ A;  5AIG A;  1JJ2 2;  2BO9 B;  3FG1 A;  3B4O A;  3K9M C;  1I2E A;  4RNZ A;  2WO0 A;  3KZT A;  1NJI 4;  2R4I A;  3CU3 A;  1EA2 A;  1B21 A;  1BNR A;  1RGK A;  2CK3 H;  2L1S A;  1B27 A;  3X3Y A;  3GWR A;  2YFJ B;  2LQV A;  2W56 A;  2Z76 A;  2CWT A;  2WOH A;  3MG3 A;  5KP1 A;  4MMZ B;  2GBW B;  3SYU A;  1BSD A;  4U13 A;  1YGE A;  4L7K A;  2KCD A;  3N9H A;  4MJD A;  1PFP A;  2CHC A;  1JBT A;  1R4C A;  4N6M A;  1IVV A;  3V92 A;  4I4K A;  4GL6 A;  4DKI A;  3OWU A;  1IV9 A;  2PNC A;  2K0M A;  1GY6 A;  3HOH A;  3MG1 A;  4K61 A;  5BU4 A;  1AV4 A;  1NB3 I;  3SVA A;  3PGB A;  3Q3F A;  1BNE A;  4XM4 A;  3GZY B;  3V99 A;  3ZG0 A;  1J2B A;  4EXR A;  3RGR A;  4ZM8 A;  1OF5 A;  3UB1 A;  2AAD A;  2ZA4 A;  3VGN A;  2A15 A;  1GMR A;  1TU5 A;  1WNH A;  2J8X B;  1I8V A;  3BLZ A;  4WWU C;  3UL5 A;  1GMP A;  1HU9 A;  1CQS A;  2F5M A;  4J8T A;  1K41 A;  1IVX A;  1EUI C;  5AEW B;  1F8N A;  1B2Z A;  4HM1 B;  1YI2 3;  5AYS C;  3AMO A;  2QA4 3;  3PZW A;  2BMQ B;  3NV0 A;  1Q82 4;  1B3S A;  1KQS 2;  1B2X A;  4HVN A;  1NNV A;  4J9A A;  4X2O A;  1QVF 2;  4FCM A;  1C7H A;  1CYU A;  2BMO B;  1E97 A;  2Z7A A;  3DGY A;  3DGO A;  2C10 A;  3DMC A;  4HZB B;  3BND A;  3OX9 A;  2CIU A;  3WHO A;  1ASK A;  3CC4 3;  4BIR A;  1B2M A;  1UW1 A;  2MF7 A;  3OXA A;  2ZDJ A;  3LTD A;  2B24 B;  1RN1 A;  3CMA 3;  4BL2 A;  3EB8 A;  5JPP A;  3Q1C A;  1IQ8 A;  2F99 A;  3FG3 A;  3CCM 3;  1TFO A;  1GD3 A;  1RGE A;  1MGR A;  2XSO B;  3D5I A;  2XF3 A;  3GAX A;  1WMN A;  1RGG A;  3ZFZ A;  2C11 A;  3CNM A;  3OV4 A;  5IG4 A;  5TGN A;  2RFR A;  5AIF A;  1WMP A;  3AGN A;  3HK4 A;  1HZ1 A;  2BMR B;  3UNL A;  1HKX A;  1FUS A;  4KFF A;  1M9G A;  2UX0 A;  1IQY A;  1JZD A;  4HM8 B;  2RNT A;  3CME 3;  1STD A;  4EYC A;  3X42 A;  1BRJ A;  1JB4 A;  2BHM A;  2L4V A;  2SAR A;  4G1M B;  3SXX A;  2YX9 A;  1QVG 2;  1YNV X;  3A76 A;  2GSP A;  1MWS A;  1BVI A;  2CFD A;  1MWR A;  1VZZ A;  1B20 A;  3GSP A;  4IIA A;  2GEY A;  4J5K A;  3EN8 A;  2CC3 A;  3CCQ 3;  1JBS A;  2OCT A;  4R9K A;  1KSI A;  3LTA A;  3MG2 A;  1N9E A;  2KF6 A;  1VQM 3;  1BAO A;  1ZGX A;  3LOY A;  5KP3 A;  1W02 A;  2OTJ 3;  3OWS A;  3GZR A;  3G8Z A;  4KVH A;  3T8N A;  1RCK A;  1BGS A;  4BTX A;  4WYK B;  2SBL A;  4QWT A;  1DMN A;  1E3R A;  3LXU X;  1VQ9 3;  1S5A A;  1VQK 3;  1RNB A;  4N6N B;  1IK3 A;  2PZV A;  2MC8 A;  2H0H A;  5KP4 A;  5DRE A;  2WOF A;  1LRA A;  1AVL A;  1TFK A;  2ML6 A;  4WHA A;  1IYY A;  2WGQ A;  3CC7 3;  5BVB A;  5IW9 A;  1YJN 3;  1PU4 A;  1O7M B;  2H0I A;  1NDO B;  1I2G A;  1BNJ A;  3F8H A;  3I0Y A;  1TTO A;  5RNT A;  2CFL A;  2OWP A;  4JRF A;  1RKY A;  4RNY A;  5AYR B;  1G0T A;  5IG5 A;  3DM8 A;  3JVC A;  2WGO A;  3NM7 A;  3NUV A;  4AKY A;  4GHO A;  2CFG A;  5EEO A;  1W6C A;  3D4A A;  1I0V A;  1E3V A;  2KF5 A;  4WP5 A;  1D6U A;  1V57 A;  1W7C A;  2V1L A;  1LNI A;  1QAK A;  3X40 A;  3G6E 3;  1YJW 3;  3KKG A;  2CWV A;  3SLU A;  3N8B A;  5AI1 A;  1CEW I;  1OUN A;  5AII A;  2F86 B;  3BIR A;  3M8C A;  2CX1 A;  1UCI A;  3CNX A;  1K9M 4;  1TRP A;  1X1W A;  3CPO A;  1IVW A;  1QAL A;  1A2P A;  1MWU A;  2XGL A;  3PS8 A;  1Q7Y 4;  2KF4 A;  1ULI B;  1O7N B;  3I56 3;  1VQ6 3;  2FNQ A;  5BIR A;  1TIJ A;  4LEH A;  1M90 4;  1C54 A;  3BNB A;  1BRI A;  2UGI A;  1VQ8 3;  1ISK A;  1EKM A;  1ROA A;  2BU4 A;  2ZL8 A;  1RGH A;  1YVB I;  3DGL A;  1RGF A;  2RGQ A;  4HAA A;  3SED A;  1O7W B;  3WOF B;  2CFK A;  2YFL B;  3JUP A;  4L8O A;  3S67 A;  3DGN A;  1RNT A;  3CCS 3;  1SJW A;  1LVN A;  2IMJ A;  2IUK A;  2W04 A;  5STD A;  3IPT A;  1FZU A;  1WTH A;  3D79 A;  1IT7 A;  1LNH A;  4NPB A;  1T5Y A;  3X3Z A;  3LT8 A;  1Q7H A;  2RCD A;  1BNF A;  3FF0 A;  1T2H A;  1EEJ A;  1A2K A;  2E2V A;  1M1X B;  1OAC A;  4ILF A;  3O8Y A;  3U97 A;  1ZS7 A;  3L0R A;  5AEU B;  1Q40 A;  1SIH A;  3WDG B;  4LYL B;  1GY5 A;  1OGX A;  2RSX A;  3QRD A;  3EJV A;  1IQX A;  4HJL B;  1SPU A;  1S72 3;  2QEX 3;  3U1W A;  1Y4K A;  2ZHX B;  4HM0 B;  1U8C B;  2Y74 A;  1Q81 4;  1FGR A;  2GBX B;  3JUN A;  1CH0 A;  3Q2P A;  2IYJ A;  3TDG A;  1T2I A;  2HMN B;  3FF2 A;  3T0U A;  4WYK A;  4R1K A;  2P09 A;  4L8P A;  3CPW 2;  1W2B 2;  1BUJ A;  4EC6 A;  1QAF A;  3MYT A;  1UGI A;  5M1A A;  3NBR A;  3V98 A;  1BSC A;  1LQM B;  1LQG C;  1VQP 3;  1YHQ 3;  2INX A;  3EBT A;  1JN5 B;  5HGR A;  4N6U A;  3NQZ A;  4XDV A;  4AEQ A;  1VQO 3;  5CK6 A;  5ELJ A;  1OH0 A;  1V74 A;  2GEX A;  2D1W A;  1CYV A;  3MHE A;  1UDI I;  1DET A;  2W56 B;  3UJM A;  3CCJ 3;  3OW2 2;  1W00 A;  6STD A;  1TUH A;  3LT9 A;  2IUJ A;  1Q86 4;  3LH4 A;  5IEP A;  4FCJ A;  3FH1 A;  1FGO A;  1GS3 A;  2RBI A;  3DY5 A;  2FGT A;  2HMO B;  4R4K A;  1MNL A;  3CCV 3;  3F7S A;  3LZA A;  2CW9 A;  1BOX A;  5IG3 A;  4N6L A;  1BRG A;  3NXJ A;  1LOY A;  2CWU A;  6GSP A;  3FKA A;  4N3V A;  4OVM A;  2P05 A;  1Q42 A;  3EX9 A;  9RNT A;  1BRK A;  1UUG B;  4HKV B;  2YFI B;  8CHO A;  4N6V 0;  1A90 A;  1BSA A;  3MWZ A;  2JQ5 A;  1X1Y A;  4R80 A;  1RHL A;  2XGN A;  4O3V A;  2OOV C;  1PY3 A;  1UUW B;  1JB5 A;  1BUQ A;  3QK9 A;  3X3X A;  3HZP A;  3K63 A;  1JBR A;  1FYS A;  3RDE A;  2K3D A;  3PCS A;  2CKF B;  1YVS A;  2P0M A;  1GSP A;  1I3I A;  1A67 A;  1W01 A;  2BT3 A;  4BU4 A;  3AMO B;  2CG0 A;  3AHW A;  2CH9 A;  1UCK A;  4BTY A;  2LYX A;  2GU1 A;  1I2F A;  3S29 A;  3OWY A;  1LOX A;  1NB5 I;  2E2U A;  2STD A;  1IVU A;  1BRS A;  5D82 A;  2P0X A;  3ALA A;  3KII A;  4EV2 A;  1V58 A;  3A5E A;  1FUW A;  1QJG A;  1A2V A;  1DYU A;  3E99 A;  1OPY A;  1N8R 4;  3AHS A;  2XSH B;  2KF3 A;  3WOD G;  7GSP A;  4O2H A;  7RNT A;  3PCR A;  3H3H A;  2W03 A;  1D6Z A;  1T3B A;  1JZO A;  2CG1 A;  2Y73 A;  4FMD A;  3D5G A;  4N6O B;  1MOL A;  2IY2 A;  5I97 A;  4STD A;  3RNT A;  2E2T A;  4K1V A;  1UCJ A;  1IT8 A;  4K90 B;  1IV7 A;  2OOV A;  1U5O A;  2XFS A;  2W0Q A;  3NV0 B;  1X1U A;  4MMY B;  1STF I;  3GRD A;  1Z1S A;  1AVK A;  2GXF A;  2QGU A;  3GZX B;  2R41 A;  3CC2 3;  5JPU A;  1RJO A;  3MSO A;  1EQK A;  1NWW A;  5G1L A;  1R4Y A;  1GD4 A;  1MGW A;  3J7Y d;  1O7P B;  3VSY A;  1ZO2 A;  3NBJ A;  2BIR A;  2B1X B;  1JKG A;  3NX0 A;  4CDL A;  3S28 A;  4JF8 A;  1GOV A;  4LZI A;  3X41 A;  5G1K A; 
#chains in the Genus database with same CATH homology
 3HII A;  3JUQ A;  4FCZ A;  4ORL A;  1W2Z A;  1VQ4 3;  1W6G A;  4HM4 B;  4MEI A;  3ECF A;  3B8L A;  3FLJ A;  3EF8 A;  3JUM A;  4KFD A;  5D81 A;  3I55 3;  2KRT A;  3ROB A;  1K73 4;  1KC8 4;  1QMA A;  1N5H A;  2IA7 A;  2HML B;  1UI8 A;  3UL6 A;  1WMO A;  2XRX B;  3T8U A;  4RBN A;  2ML5 A;  1O7G B;  3DXO A;  3LML A;  2Z6B A;  3F14 A;  1FA3 A;  3SOA A;  1UUV B;  1SII A;  4O8S A;  3WA3 A;  3ER7 A;  3F40 A;  3H51 A;  1JRQ A;  2F98 A;  3D3L A;  3SX1 A;  4XBX A;  3KSP A;  2CFW A;  1GYB A;  3CCU 3;  3Q90 A;  1NU3 A;  1FGQ A;  3BNC A;  4R9L A;  1W6Y A;  4XBT A;  4IPB A;  1KD1 4;  3S27 A;  1M1K 4;  3CCL 3;  4OK0 A;  2I9W A;  1VQL 3;  5CF1 A;  3IJE B;  3NM2 A;  3F9S A;  3STD A;  5DRV A;  5IEN A;  1EG9 B;  1UI7 A;  3NBB A;  1YIJ 3;  1DMM A;  5LC7 A;  4HYZ A;  1K28 A;  3N54 B;  1VQ5 3;  2HMJ B;  3MPH A;  5ELU A;  4AKZ A;  2BNG A;  1VQ7 3;  1O7H B;  2JDI H;  4HZ9 B;  1K8A 4;  2XH9 A;  1JB2 A;  5IEO A;  4LSO A;  3CXC 2;  3BNE A;  5IER A;  1IU7 A;  1LXE A;  4TX4 A;  3G4S 3;  1IDP A;  1VQN 3;  4FR9 A;  1KWI A;  5AIH A;  3EE1 A;  1YIT 3;  4K1U A;  1OHP A;  1L5G B;  4XDW A;  5IF6 A;  1N8Q A;  4HM7 B;  3WOE B;  3LTC A;  5LC6 A;  3PYJ A;  4NRE A;  4GB5 A;  4HM3 B;  1OF5 B;  2GU3 A;  4WFO A;  4EBG A;  3CCE 3;  3EQQ B;  1DVC A;  1AR0 A;  2HMM B;  4KZ1 A;  7STD A;  3FSD A;  1W4N A;  4FMA A;  2OQE C;  5FW5 A;  4MMX B;  5CLK A;  1D6Y A;  2M7O A;  2W9Q A;  4H3U A;  3JUO A;  1G96 A;  3FCS B;  3FG4 A;  4Q53 A;  1ZX2 A;  3DGM A;  3G16 A;  3K0Z A;  3EC9 A;  4FMC A;  1YJ9 3;  1OHS A;  3HI7 A;  3HIG A;  4XBY A;  2W2C A;  4N6T A;  2O9U X;  1OHO A;  3GZB A;  5EQL A;  3WMD A;  3F8X A;  5G2G A;  5IG0 A;  3NQY A;  4KFE A;  3K7C A;  3KE7 A;  2HMK B;  3WA2 X;  1OCV A;  3DUK A;  3LTB A;  4IT7 A;  2K54 A;  2Q07 A;  3EBY A;  1W5Z A;  5FGO A;  4FMB A;  1N5P A;  3CD6 3;  2KXG A;  2XEP A;  1RRL A;  1JV2 B;  2XR8 B;  3B4P A;  2XFT A;  4LGQ A;  1TP6 A;  4NHF A;  4O02 B;  5D83 A;  2OTL 3;  4H61 A;  3F7X A;  3G71 3;  4CCV A;  2W6J H;  5A0O B;  1DMQ A;  3EN1 B;  1JNQ A;  4RZM A;  2Z77 A;  3DZL A;  3D9R A;  3K5T A;  4PEJ A;  1RRH A;  3S5C A;  3CCR 3;  3FZW A;  2QIY A;  4HBR A;  3IMA B;  2OQE A;  5JBS A;  3PXM A;  3HX8 A;  4XB5 A;  4HM6 B;  1SQW A;  3KSE D;  1JKG B;  4HM2 B;  3FGY A;  3SOY A;  1US1 A;  3B7C A;  1Q40 B;  3RGA A;  4BTW A;  3MKI A;  3KN4 A;  3KFQ C;  2FXT A;  1JN5 A;  2W9P A;  3BB9 A;  3EHC A;  2D42 A;  1FGM A;  3VF1 A;  5CF2 A;  1RN7 A;  1NO3 A;  1GY7 A;  1DVD A;  3NHX A;  4OUQ A;  1OGZ A;  1ULJ B;  4LMI A;  3G0K A;  1FGT A;  4HM5 B;  5EVH A;  2O3O A;  1N9J A;  5CXO A;  3LYG A;  1ROV A;  1WQL B;  2P38 A;  4X2H A;  4EV5 A;  5BXQ A;  5AIG A;  1JJ2 2;  2BO9 B;  3FG1 A;  3B4O A;  3K9M C;  4RNZ A;  2WO0 A;  3KZT A;  1NJI 4;  2R4I A;  3CU3 A;  1EA2 A;  2CK3 H;  3X3Y A;  3GWR A;  2YFJ B;  2LQV A;  2W56 A;  2Z76 A;  2CWT A;  2WOH A;  3MG3 A;  5KP1 A;  4MMZ B;  2GBW B;  4U13 A;  1YGE A;  4L7K A;  2KCD A;  3N9H A;  4MJD A;  1PFP A;  2CHC A;  1R4C A;  4N6M A;  1IVV A;  3V92 A;  4I4K A;  4GL6 A;  3OWU A;  1IV9 A;  2PNC A;  2K0M A;  1GY6 A;  4K61 A;  3MG1 A;  1AV4 A;  1NB3 I;  3SVA A;  3PGB A;  4XM4 A;  3GZY B;  3V99 A;  1J2B A;  4EXR A;  3RGR A;  4ZM8 A;  1OF5 A;  3UB1 A;  3VGN A;  2A15 A;  1TU5 A;  1WNH A;  3BLZ A;  4WWU C;  3UL5 A;  1HU9 A;  1CQS A;  4J8T A;  1K41 A;  1IVX A;  5AEW B;  1F8N A;  4HM1 B;  1YI2 3;  5AYS C;  3AMO A;  2QA4 3;  3PZW A;  2BMQ B;  3NV0 A;  1Q82 4;  1KQS 2;  4HVN A;  4J9A A;  4X2O A;  1QVF 2;  4FCM A;  1C7H A;  1CYU A;  2BMO B;  1E97 A;  2Z7A A;  3DGO A;  2C10 A;  3DMC A;  4HZB B;  3BND A;  3OX9 A;  2CIU A;  3CC4 3;  1ASK A;  1UW1 A;  2MF7 A;  3OXA A;  2ZDJ A;  3LTD A;  2B24 B;  3CMA 3;  3EB8 A;  5JPP A;  3Q1C A;  2F99 A;  1IQ8 A;  3FG3 A;  3CCM 3;  1TFO A;  1GD3 A;  2XSO B;  2XF3 A;  3GAX A;  1WMN A;  2C11 A;  3CNM A;  3OV4 A;  5IG4 A;  5TGN A;  2RFR A;  5AIF A;  1WMP A;  3HK4 A;  2BMR B;  3UNL A;  1HKX A;  4KFF A;  1M9G A;  2UX0 A;  1IQY A;  4HM8 B;  3CME 3;  1STD A;  4EYC A;  3X42 A;  1JB4 A;  2BHM A;  2L4V A;  4G1M B;  3SXX A;  2YX9 A;  1QVG 2;  3A76 A;  2CFD A;  1VZZ A;  4IIA A;  2GEY A;  3EN8 A;  2CC3 A;  3CCQ 3;  2OCT A;  4R9K A;  1KSI A;  3LTA A;  3MG2 A;  1N9E A;  1VQM 3;  5KP3 A;  3LOY A;  1W02 A;  2OTJ 3;  3OWS A;  3GZR A;  3G8Z A;  4KVH A;  3T8N A;  4BTX A;  4WYK B;  2SBL A;  4QWT A;  1DMN A;  1E3R A;  3LXU X;  1VQ9 3;  1S5A A;  1VQK 3;  4N6N B;  1IK3 A;  2PZV A;  2MC8 A;  5KP4 A;  5DRE A;  2WOF A;  1AVL A;  1TFK A;  2ML6 A;  4WHA A;  2WGQ A;  3CC7 3;  5BVB A;  5IW9 A;  1YJN 3;  1PU4 A;  1O7M B;  1NDO B;  3F8H A;  3I0Y A;  2CFL A;  2OWP A;  4JRF A;  1RKY A;  4RNY A;  5AYR B;  5IG5 A;  3DM8 A;  3JVC A;  2WGO A;  3NM7 A;  3NUV A;  4AKY A;  2CFG A;  5EEO A;  1W6C A;  1E3V A;  4WP5 A;  1D6U A;  2V1L A;  1W7C A;  3G6E 3;  1QAK A;  3X40 A;  1YJW 3;  3KKG A;  2CWV A;  3SLU A;  3N8B A;  5AI1 A;  1CEW I;  1OUN A;  5AII A;  2F86 B;  3M8C A;  3CNX A;  1K9M 4;  3CPO A;  1IVW A;  1QAL A;  2XGL A;  1Q7Y 4;  3PS8 A;  1ULI B;  1O7N B;  3I56 3;  1VQ6 3;  2FNQ A;  1TIJ A;  4LEH A;  1M90 4;  3BNB A;  1ISK A;  1VQ8 3;  1EKM A;  1ROA A;  2ZL8 A;  1YVB I;  3DGL A;  2RGQ A;  3SED A;  1O7W B;  3WOF B;  2CFK A;  2YFL B;  3JUP A;  4L8O A;  3S67 A;  3DGN A;  3CCS 3;  1SJW A;  1LVN A;  2IMJ A;  2IUK A;  2W04 A;  5STD A;  3IPT A;  1WTH A;  1IT7 A;  1LNH A;  1T5Y A;  3X3Z A;  3LT8 A;  2RCD A;  3FF0 A;  1A2K A;  2E2V A;  1M1X B;  1OAC A;  3O8Y A;  3U97 A;  3L0R A;  5AEU B;  1Q40 A;  1SIH A;  3WDG B;  1GY5 A;  1OGX A;  2RSX A;  3QRD A;  3EJV A;  1IQX A;  4HJL B;  1SPU A;  1S72 3;  2QEX 3;  3U1W A;  1Y4K A;  4HM0 B;  1U8C B;  2Y74 A;  1Q81 4;  1FGR A;  2GBX B;  3JUN A;  3Q2P A;  3TDG A;  2HMN B;  3FF2 A;  3T0U A;  4WYK A;  4R1K A;  2P09 A;  4L8P A;  3CPW 2;  1W2B 2;  4EC6 A;  1QAF A;  3MYT A;  3NBR A;  3V98 A;  1VQP 3;  1YHQ 3;  2INX A;  3EBT A;  1JN5 B;  5HGR A;  4N6U A;  3NQZ A;  4XDV A;  4AEQ A;  1VQO 3;  5CK6 A;  5ELJ A;  1OH0 A;  1V74 A;  2GEX A;  2D1W A;  1CYV A;  3MHE A;  3UJM A;  3OW2 2;  2W56 B;  3CCJ 3;  1W00 A;  6STD A;  1TUH A;  3LT9 A;  2IUJ A;  1Q86 4;  3LH4 A;  5IEP A;  4FCJ A;  3FH1 A;  1FGO A;  1GS3 A;  3DY5 A;  2FGT A;  2HMO B;  4R4K A;  1MNL A;  3CCV 3;  3F7S A;  3LZA A;  2CW9 A;  5IG3 A;  4N6L A;  3NXJ A;  2CWU A;  3FKA A;  4N3V A;  4OVM A;  2P05 A;  1Q42 A;  3EX9 A;  4HKV B;  2YFI B;  8CHO A;  4N6V 0;  1A90 A;  3MWZ A;  2JQ5 A;  4R80 A;  2XGN A;  4O3V A;  2OOV C;  1UUW B;  1JB5 A;  1BUQ A;  3QK9 A;  3X3X A;  3HZP A;  3K63 A;  3RDE A;  3PCS A;  2CKF B;  2P0M A;  1A67 A;  1W01 A;  2BT3 A;  3AMO B;  2CG0 A;  2CH9 A;  4BTY A;  2LYX A;  2GU1 A;  3S29 A;  3OWY A;  1LOX A;  1NB5 I;  2E2U A;  2STD A;  1IVU A;  5D82 A;  2P0X A;  3ALA A;  3KII A;  4EV2 A;  1FUW A;  1QJG A;  1A2V A;  1DYU A;  3E99 A;  1OPY A;  1N8R 4;  2XSH B;  3WOD G;  4O2H A;  3PCR A;  3H3H A;  2W03 A;  1D6Z A;  2CG1 A;  2Y73 A;  4FMD A;  4N6O B;  1MOL A;  5I97 A;  4STD A;  2E2T A;  4K1V A;  4K90 B;  1IT8 A;  2OOV A;  1IV7 A;  1U5O A;  2XFS A;  2W0Q A;  3NV0 B;  4MMY B;  1STF I;  3GRD A;  1Z1S A;  1AVK A;  2GXF A;  2QGU A;  3GZX B;  3CC2 3;  5JPU A;  1RJO A;  3MSO A;  1EQK A;  1NWW A;  3J7Y d;  1GD4 A;  1O7P B;  3VSY A;  1ZO2 A;  3NBJ A;  2B1X B;  1JKG A;  3NX0 A;  4CDL A;  3S28 A;  4JF8 A;  4LZI A;  3X41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...