1MOLA

Two crystal structures of a potently sweet protein: natural monellin at 2.75 angstroms resolution and single-chain monellin at 1.7 angstroms resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Two crystal structures of a potently sweet protein. Natural monellin at 2.75 A resolution and single-chain monellin at 1.7 A resolution.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Sweet-tasting protein
total genus 21
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1molA00
1DVDA 3SVAA 3UL5A 3PS8A 4N6LA 1PFPA 5LC7A 1FA3A 5ELJA 1NB5I 4EYCA 3LH4A 1WNHA 3KFQC 1MNLA 4N6MA 1IV7A 1GD4A 3IMAB 1A67A 4N6OB 1TIJA 1N5HA 5LC6A 1LXEA 3S67A 1GD3A 4N6V0 1NB3I 1N9JA 1STFI 3UL6A 1CYVA 1KWIA 1A90A 3KSED 4LZIA 1N5PA 1CEWI 4N6NB 2W9PA 5A0OB 4CCVA 5EQLA 3K9MC 1MOLA 4TX4A 1CYUA 2W9QA 1YVBI 2KXGA 1IV9A 4IT7A 1ROAA 2O9UX 3Q2PA 4N6UA 1FUWA 3PYJA 1RN7A 4ZM8A 2CH9A 3QRDA 2OCTA 3PXMA 1M9GA 1DVCA 4N6TA 3NX0A 2BO9B 3MWZA 3L0RA 1G96A 1EQKA 3GAXA 5ELUA 1R4CA
chains in the Genus database with same CATH superfamily
2OQEC 2Z76A 1DVDA 1S723 3BU4A 3D9RA 3UL5A 2QIYA 1EA2A 3HI7A 1BU4A 3PS8A 1B21A 2W03A 3N9HA 2OOVC 3S27A 1GY5A 2RNTA 1B2SA 5LC7A 5ELJA 3URPA 1WMPA 1NB5I 2INXA 1DMNA 4RBNA 1D6YA 2IA7A 1FZUA 2M7OA 4N6MA 5IW9A 1VQ73 1RRHA 2XEPA 2RGQA 1ZX2A 1IV7A 3AHSA 4L7KA 3MHEA 3Q90A 3WOFB 5AYSC 4J8TA 1GOUA 3NBBA 5D82A 1LOVA 4HM7B 2ZHXB 4N6OB 1JBTA 3KIIA 1K41A 3CPOA 3FG3A 4G1MB 4HAAA 3AMOB 3G4S3 1BOXA 1RGHA 3D5IA 3FG1A 1FW7A 1RTUA 3KE7A 2OTL3 3WHOA 3OX9A 4WP5A 1OF5B 4HM2B 1L5GB 3NBRA 2HMLB 5KP4A 4FMDA 1LRAA 2ZA4A 3EBYA 1GMQA 1C54A 3SYUA 1ZS7A 3LTAA 2RFRA 4HM8B 4NHFA 5DRVA 1NNVA 1AR0A 2F98A 2RCDA 5D83A 4CJNA 1S5AA 2CWVA 3NHXA 3PCRA 1JBRA 2OTJ3 1JZDA 3EN1B 1K9M4 3MPHA 1KWIA 1DE3A 1A90A 3WR2A 2W6JH 3DGNA 3CNMA 4XBXA 7GSPA 6STDA 3EQQB 2GBWB 3CCU3 1N5PA 3UJMA 4K61A 1JB2A 1U5OA 2CC3A 4HM6B 3JVCA 1W6CA 1A2KA 3K0ZA 5IENA 1JB5A 2K0MA 2HMKB 4KT3B 4J5GA 2WOHA 2P09A 3CCL3 1DMMA 1UI8A 2QGUA 2MC8A 4BTYA 1EG9B 1FGQA 1BNEA 5EQLA 1OGZA 3HIIA 5BIRA 1N9EA 1YJN3 3HK4A 3PGBA 2A15A 1C7HA 4NPBA 1GSPA 1BRIA 2W9QA 3HIGA 4OUQA 5BVBA 2Z7AA 5EEOA 3LMLA 3RDEA 3CC23 1BSCA 1B20A 2HMOB 2W56A 4IT7A 2GEYA 4JF8A 3G6E3 2CFGA 3I563 1JNQA 1BUQA 4Q53A 3FCSB 4MMYB 1RGAA 3X40A 1TFOA 2XSOB 7STDA 5FW5A 3S5CA 2KCDA 1JB4A 3O8YA 4HZBB 5D81A 3V92A 2STDA 1RLSA 2XFTA 3DGLA 1O7HB 1OPYA 1I2FA 3X3YA 3EN8A 3V98A 3QRDA 3MG2A 1WQLB 1GS3A 1D6ZA 1QALA 2OCTA 3VGNA 3CCE3 1JN5A 1UGHI 1QAFA 4EV2A 1BANA 1FGMA 3MG3A 4RNTA 3CME3 3SLUA 1I3IA 2GU1A 3EF8A 1AV4A 3DGOA 3X42A 4K1VA 1BSEA 3RNTA 1V57A 4BL2A 1T2HA 3GZXB 1R4YA 2F5WA 1NWWA 4HM4B 4J5KA 3QK9A 1OGXA 3GAXA 3CCQ3 1Q814 5ELUA 3CD63 1Q40B 3T8UA 4L8OA 5KP1A 1PFPA 2V1LA 1FA3A 2IYJA 4L8PA 3B8LA 3E99A 3EE1A 4K90B 5BU4A 2H0GA 3F7SA 1IT7A 9RNTA 5CF1A 3KFQC 3VF1A 1FGTA 1E3RA 3DGMA 3LT8A 2J8XB 3M8CA 3KCHA 5IERA 3DH2A 1VQ63 1VQ93 1OH0A 2C11A 1RJOA 1TUHA 2K54A 1O7GB 2UX0A 1O7NB 3OWYA 1UDII 1TRPA 2SARA 2W04A 3GSPA 3AGNA 3ROBA 2KAAA 1TIJA 2JDIH 2MF7A 5CK6A 3S67A 1Y4KA 1IQXA 3ZFZA 1BNJA 1B2UA 4JRFA 1OHOA 1I70A 4HBRA 1BRJA 1JKGB 2CG1A 3D4AA 4MJDA 1UI7A 1ZGXA 2KF6A 1AQZA 1W6GA 3K63A 1YJ93 1RGFA 3ZG5A 3SOYA 1D6UA 3MSOA 1YHQ3 8RNTA 2ZDJA 2AADA 1RN1A 3NV0B 2Y74A 3CPW2 1SPUA 1MWRA 4LYLB 4CPKA 1M904 1YNVX 1LQMB 1PYLA 3PCSA 5AEUB 5CLKA 1UCIA 2R41A 4BL3A 4GSPA 4LZIA 2HMMB 4U13A 1CEWI 2XGLA 5IEOA 1JJ22 3A76A 1KD14 4FMCA 5M19A 4WWUC 4CDLA 2XF3A 4BIRA 3LZAA 3U1WA 3D5GA 1LVNA 1ULIB 3FSDA 1BNRA 2XRXB 1FUSA 1OACA 3DZLA 4HYZA 4N3VA 5CF2A 4CCVA 2BHMA 2BU4A 2P38A 3VSYA 1PU4A 1STDA 3MKIA 2CFDA 4X2OA 3K9MC 1O7MB 3LOYA 1CYUA 3Q3FA 1TJDA 3DM8A 4HZ9B 3JUNA 4MMZB 1IV9A 1SQWA 2PNCA 4HM5B 1NJI4 2E2UA 2W0QA 2BNGA 1BGSA 3LTDA 2WGQA 2H0HA 2CG0A 1G0TA 1LOXA 2L4VA 4XBYA 5IF6A 1QMAA 1ASKA 3FG4A 1QVF2 3F8HA 4KFEA 5HGRA 2CH9A 3RGRA 1VQP3 3CC43 2PZVA 3I0YA 1NU3A 4RNZA 1UUGB 2L1SA 1DVCA 1RHLA 3SEDA 3CCM3 1GY6A 2E2TA 1WMOA 1B2ZA 3CC73 2BO9B 1UUVB 2YFJB 3MWZA 4STDA 2Z77A 3OXAA 5JBSA 1JBSA 4FMBA 3CMA3 4X2HA 2BMOB 2O3OA 3BNBA 1BVIA 1RGEA 1UCJA 3F8XA 1X1WA 1SARA 4IPBA 4H61A 1YGWA 2CKFB 5FGOA 3G16A 1K8A4 4NREA 3UNLA 1IT8A 2SBLA 1GY7A 2HMNB 4ORLA 1UW1A 3JUMA 3BIRA 3WMDA 2CFWA 1TRQA 2CWUA 2QA43 1JZOA 1LNIA 3X3XA 4EYCA 5G1KA 4LSOA 3WOEB 1GMPA 3ZG0A 4DKIA 1MGRA 1TP6A 3J7Yd 1MNLA 3JUPA 3BLZA 1ULJB 1I0VA 1BNGA 4R80A 1LOWA 4WYKA 3FLJA 3KSPA 3CCJ3 3IMAB 1A67A 2W56B 1RGKA 1VQM3 4KFDA 1MWSA 4LMIA 1V74A 1N5HA 4KZ1A 3S28A 2CX1A 3N8BA 2D1WA 1GD3A 3A5EA 3WODG 3B4OA 2CIUA 3EJVA 4N6V0 4O8SA 5G2GA 1NB3I 3OW22 1UGIA 2XFSA 3OV4A 2P0MA 1IVWA 1I8VA 1KSIA 2CW9A 4EV5A 3FH1A 4XB5A 1BRKA 3UL6A 4KFFA 4MEIA 1YVSA 1J2BA 5IG4A 1HZ1A 1JN5B 4HJLB 3TDGA 1IVXA 3FKAA 5AYRB 2OQEA 2F4YA 2LQVA 2ZL8A 3ER7A 1KQS2 3CXC2 3KSED 1OHPA 3DMCA 4WYKB 4XDWA 3WDGB 2GEXA 3GZYB 4WHAA 3V99A 4GHOA 5IEPA 2H0IA 1YIJ3 1IVUA 3CCV3 3OWUA 1B2MA 3AGOA 3JUOA 3PZWA 1YJW3 5GSPA 3X3ZA 5A0OB 1DMQA 1BNSA 3BNCA 3D79A 1BUJA 5BXQA 3U97A 1BAOA 4MMXB 2WOFA 3NM7A 4HM0B 1I3FA 1US1A 4FMAA 3EX9A 3JUQA 4O2HA 3MG1A 1MOLA 1W2B2 5JPUA 3FF2A 1JV2B 2KXGA 4GL6A 1IYYA 1GOVA 1WMNA 5HOHA 5STDA 2OWPA 1YGEA 2JQ5A 1IK3A 3LTCA 1ROAA 2O9UX 4N6UA 1UCKA 3F14A 2XSHB 2GU3A 3AMOA 3EHCA 4HVNA 5AEWB 5RNTA 1RNBA 2FXTA 2CFLA 4WFOA 1JRQA 1IU7A 1BRNL 1VQ53 4EBGA 3DGYA 1OF5A 1GYBA 1Q9EA 1U8CB 1IQ8A 1QJGA 3ALAA 5TGNA 4ZM8A 2WGOA 4XM4A 1HKXA 4XBTA 1I0XA 1W2ZA 1IDPA 1RN4A 4H3UA 2GBXB 4QWTA 4LEHA 3PXMA 2AAEA 4EXRA 1M9GA 1W00A 5I97A 8CHOA 2IUKA 3DUKA 3NX0A 3GZBA 6GSPA 2KF5A 3G8ZA 2E2VA 1G96A 2YX9A 2IMJA 3BB9A 3H3HA 3G0KA 1FGOA 1B27A 3BNEA 2XGNA 2F99A 1A2PA 5IG3A 1BRHA 1EQKA 1T5YA 4I5QA 2IUJA 1VQO3 1Q42A 2UUGC 3B4PA 1MGWA 1MWUA 5AIGA 1W7CA 2CK3H 1BNIA 3NBJA 1R4CA 2P0XA 1RCKA 3SVAA 2F86B 3RGAA 6RNTA 1M1XB 1VQ43 1M1K4 4N6LA 3STDA 3H51A 1SIIA 3KZTA 1RKYA 1RMSA 3F7XA 3GWRA 3LH4A 3LT9A 1WNHA 5KP3A 1K28A 1OCVA 1OUNA 1RCLA 3Q1CA 1BSAA 4O3VA 1VQN3 3EB8A 3FZWA 1GMRA 2GXFA 2C10A 5AIFA 4EC6A 3ECFA 3EBTA 1AVKA 3CCR3 1GD4A 1LOYA 2BMRB 1Q7Y4 3CU3A 4FCJA 3MYTA 2KF4A 5IG0A 3IPTA 4KVHA 1X1XA 3T8NA 5LC6A 1LXEA 1AY7A 1I2EA 5AIIA 1NDOB 2UGIA 4R9KA 1HU9A 5AI1A 5JPPA 1RRLA 1BRGA 1Q824 4EW5A 3I553 1MWTA 1RGGA 2BMQB 1VZZA 1DYUA 4IIAA 1B2XA 3F40A 1N9JA 4HOHA 4HM1B 1STFI 2WO0A 1X1UA 1EUIC 1EKMA 1QAKA 1W02A 2ML6A 4BU4A 1IVVA 1CQSA 1W01A 1Q7HA 4BTWA 5DREA 7RNTA 2XH9A 1CYVA 4PEJA 1SIHA 4AEQA 1BSDA 3SX1A 4LGQA 1CH0A 1LQGC 4K1UA 1W4NA 1HYFA 1RNTA 4FCZA 4HKVB 3CNXA 2F5MA 2P05A 3F9SA 1SJWA 3K7CA 1V58A 2CX0A 4BTXA 4N6NB 1A2VA 2W9PA 1Q40A 1ROVA 3T0UA 1UUWB 1IQYA 2Q07A 2I9WA 1VQQA 1E97A 3N54B 1UCLA 1K734 1TFKA 1T3BA 1X1YA 3DY5A 3HZPA 3WA2X 4AKZA 3D3LA 3LYGA 3WA3A 2C4BA 2QEX3 1VQL3 3G713 5EVHA 4ILFA 1TU5A 2KF3A 1VQ83 1G02A 1LNHA 1GOYA 2HMJB 4J9AA 2YFLB 4GB5A 2K3DA 3KKGA 4FR9A 1W6YA 4TX4A 1F8NA 4I4KA 1N8R4 1W5ZA 2B1XB 1YVBI 5M1AA 3OWSA 1DETA 5IG5A 1EEJA 2BIRA 2IY2A 1FUTA 1VQK3 2GSPA 1RSNA 3K5TA 1T2IA 2B24B 2HOHA 1PY3A 3Q2PA 2OOVA 1FUWA 4HM3B 1KC84 3SOAA 3AHWA 1BRSA 1AVLA 3HX8A 3PYJA 3NQZA 1RN7A 2FNQA 2XR8B 3IJEB 2F56A 1Q864 2LYXA 2RSXA 1JKGA 1ISKA 1WTHA 1BNFA 1YIT3 2R4IA 1RGLA 3LTBA 2D42A 1ZO2A 5G1LA 4R1KA 2RBIA 1TTOA 4O02B 1FGRA 4R9LA 1RGCA 3SXXA 2W2CA 1O7WB 2Z6BA 3NV0A 4N6TA 4RNYA 4AKYA 5M18A 1YI23 1BSBA 3LXUX 3KN4A 3EC9A 3NQYA 5CXOA 1QVG2 2YFIB 4OVMA 3GZRA 5AIHA 1RDSA 3L0RA 3NUVA 4FCMA 1E3VA 1O7PB 3UB1A 2CHCA 3NXJA 3CCS3 1B3SA 3X41A 1I2GA 4XDVA 1Z1SA 2KRTA 3GRDA 2ML5A 3B7CA 1BIRA 1OHSA 4OK0A 2FGTA 3HOHA 1NO3A 2BT3A 3FF0A 3DXOA 3NM2A 3S29A 2CFKA 2CWTA 3BNDA 1N8QA 3FGYA 2Y73A 1FYSA 4RZMA 4R4KA
chains in the Genus database with same CATH topology
2OQEC 2Z76A 1DVDA 1S723 3D9RA 3UL5A 2QIYA 1EA2A 3HI7A 3PS8A 3S27A 3N9HA 2W03A 2OOVC 1GY5A 5LC7A 5ELJA 1WMPA 1NB5I 2INXA 1DMNA 4RBNA 1D6YA 2IA7A 4N6MA 2M7OA 5IW9A 1VQ73 1RRHA 2XEPA 2RGQA 1ZX2A 1IV7A 4L7KA 3MHEA 3Q90A 3WOFB 5AYSC 4J8TA 3NBBA 5D82A 4HM7B 4N6OB 3KIIA 1K41A 3CPOA 3FG3A 4G1MB 3G4S3 3AMOB 3FG1A 3KE7A 2OTL3 3OX9A 4WP5A 1OF5B 4HM2B 1L5GB 3NBRA 2HMLB 5KP4A 4FMDA 3EBYA 3LTAA 2RFRA 4HM8B 4NHFA 5DRVA 2F98A 1AR0A 5D83A 2RCDA 1S5AA 2CWVA 3NHXA 3PCRA 2OTJ3 3EN1B 1K9M4 3MPHA 1KWIA 1A90A 2W6JH 3DGNA 3CNMA 4XBXA 6STDA 3EQQB 2GBWB 3CCU3 1N5PA 3UJMA 4K61A 1JB2A 1U5OA 2CC3A 4HM6B 3JVCA 1W6CA 1A2KA 3K0ZA 5IENA 1JB5A 2K0MA 2HMKB 2WOHA 2P09A 3CCL3 1DMMA 1UI8A 2QGUA 2MC8A 4BTYA 1EG9B 1FGQA 5EQLA 1OGZA 3HIIA 1N9EA 1YJN3 3HK4A 3PGBA 2A15A 1C7HA 2W9QA 3HIGA 4OUQA 5BVBA 2Z7AA 5EEOA 3LMLA 3RDEA 3CC23 2W56A 2HMOB 4JF8A 4IT7A 2GEYA 3G6E3 2CFGA 3I563 1JNQA 1BUQA 4Q53A 3FCSB 4MMYB 3X40A 1TFOA 2XSOB 7STDA 5FW5A 3S5CA 2KCDA 1JB4A 3O8YA 4HZBB 5D81A 3V92A 2STDA 2XFTA 3DGLA 1O7HB 1OPYA 3X3YA 3EN8A 3V98A 3QRDA 3MG2A 1WQLB 1GS3A 1D6ZA 1QALA 2OCTA 3VGNA 3CCE3 1JN5A 1QAFA 4EV2A 1FGMA 3MG3A 3CME3 3SLUA 2GU1A 3EF8A 1AV4A 3DGOA 3X42A 4K1VA 3GZXB 1NWWA 4HM4B 3QK9A 1OGXA 3GAXA 3CCQ3 1Q814 5ELUA 3CD63 1Q40B 3T8UA 4L8OA 5KP1A 1PFPA 2V1LA 1FA3A 4L8PA 3B8LA 3E99A 3EE1A 4K90B 3F7SA 1IT7A 5CF1A 3KFQC 3VF1A 1FGTA 1E3RA 3DGMA 3LT8A 5IERA 3M8CA 1VQ63 1VQ93 1OH0A 2C11A 1RJOA 1TUHA 2K54A 1O7GB 2UX0A 1O7NB 3OWYA 2W04A 3ROBA 1TIJA 2JDIH 2MF7A 5CK6A 3S67A 1Y4KA 1IQXA 4JRFA 1OHOA 4HBRA 1JKGB 2CG1A 4MJDA 1UI7A 1W6GA 3K63A 1YJ93 1YHQ3 3SOYA 1D6UA 3MSOA 2ZDJA 3NV0B 3CPW2 2Y74A 1SPUA 1M904 3PCSA 5AEUB 5CLKA 4LZIA 2HMMB 4U13A 1CEWI 2XGLA 5IEOA 1JJ22 3A76A 1KD14 4FMCA 4WWUC 4CDLA 2XF3A 3LZAA 3U1WA 1LVNA 1ULIB 3FSDA 2XRXB 1OACA 3DZLA 4HYZA 4N3VA 5CF2A 4CCVA 2BHMA 2P38A 3VSYA 1PU4A 1STDA 3MKIA 2CFDA 4X2OA 3K9MC 1O7MB 3LOYA 1CYUA 3DM8A 4HZ9B 3JUNA 4MMZB 1IV9A 1SQWA 2PNCA 4HM5B 1NJI4 2E2UA 2W0QA 2BNGA 3LTDA 2WGQA 2CG0A 1LOXA 4XBYA 2L4VA 5IF6A 1QMAA 1ASKA 3FG4A 1QVF2 3F8HA 4KFEA 5HGRA 2CH9A 3RGRA 1VQP3 3CC43 2PZVA 3I0YA 1NU3A 4RNZA 1DVCA 3CCM3 3SEDA 1GY6A 2E2TA 1WMOA 3CC73 2BO9B 1UUVB 2YFJB 3MWZA 4STDA 2Z77A 3OXAA 5JBSA 4FMBA 3CMA3 4X2HA 2BMOB 2O3OA 3BNBA 3F8XA 4IPBA 4H61A 2CKFB 5FGOA 3G16A 1K8A4 4NREA 3UNLA 1IT8A 2SBLA 1GY7A 2HMNB 4ORLA 1UW1A 3JUMA 3WMDA 2CFWA 2CWUA 2QA43 3X3XA 4EYCA 4LSOA 3WOEB 1TP6A 3J7Yd 1MNLA 3JUPA 3BLZA 1ULJB 4R80A 4WYKA 3FLJA 3KSPA 3CCJ3 3IMAB 1A67A 2W56B 1VQM3 4KFDA 4LMIA 1V74A 1N5HA 4KZ1A 3S28A 3N8BA 2D1WA 1GD3A 3WODG 3B4OA 2CIUA 3EJVA 4N6V0 4O8SA 5G2GA 1NB3I 3OW22 2XFSA 3OV4A 2P0MA 1IVWA 1KSIA 2CW9A 4EV5A 3FH1A 4XB5A 3UL6A 4KFFA 4MEIA 1J2BA 5IG4A 4HJLB 1JN5B 3TDGA 1IVXA 3FKAA 5AYRB 2OQEA 2LQVA 2ZL8A 3ER7A 1KQS2 3CXC2 3KSED 1OHPA 3DMCA 4WYKB 4XDWA 3WDGB 2GEXA 3GZYB 4WHAA 3V99A 5IEPA 1YIJ3 1IVUA 3CCV3 3OWUA 3JUOA 3PZWA 1YJW3 3X3ZA 5A0OB 1DMQA 3BNCA 5BXQA 3U97A 4MMXB 2WOFA 3NM7A 4HM0B 1US1A 4FMAA 3EX9A 3JUQA 4O2HA 3MG1A 1MOLA 1W2B2 5JPUA 3FF2A 1JV2B 2KXGA 4GL6A 1WMNA 5STDA 2OWPA 1YGEA 2JQ5A 1IK3A 3LTCA 1ROAA 2O9UX 4N6UA 3F14A 2XSHB 2GU3A 3AMOA 3EHCA 4HVNA 5AEWB 2FXTA 2CFLA 4WFOA 1JRQA 1IU7A 1VQ53 4EBGA 1OF5A 1GYBA 3ALAA 1U8CB 1IQ8A 1QJGA 5TGNA 4ZM8A 2WGOA 4XM4A 1HKXA 4XBTA 1W2ZA 1IDPA 4H3UA 2GBXB 4QWTA 4LEHA 3PXMA 5I97A 4EXRA 1M9GA 1W00A 8CHOA 2IUKA 3DUKA 3NX0A 3GZBA 3G8ZA 2E2VA 1G96A 2YX9A 2IMJA 3BB9A 3H3HA 3G0KA 1FGOA 3BNEA 2XGNA 2F99A 5IG3A 1EQKA 1T5YA 2IUJA 1VQO3 1Q42A 3B4PA 5AIGA 1W7CA 2CK3H 3NBJA 1R4CA 2P0XA 3SVAA 1VQ43 2F86B 3RGAA 1M1XB 1M1K4 4N6LA 3STDA 3H51A 1SIIA 3KZTA 1RKYA 3F7XA 3GWRA 3LH4A 3LT9A 1WNHA 5KP3A 1K28A 1OCVA 1OUNA 3Q1CA 4O3VA 1VQN3 3EB8A 3FZWA 2GXFA 2C10A 5AIFA 4EC6A 3ECFA 3EBTA 1AVKA 3CCR3 1GD4A 2BMRB 1Q7Y4 3CU3A 4FCJA 3MYTA 5IG0A 3IPTA 4KVHA 3T8NA 5LC6A 1LXEA 5AIIA 1NDOB 4R9KA 5AI1A 1HU9A 5JPPA 1RRLA 1Q824 3I553 2BMQB 1VZZA 1DYUA 4IIAA 3F40A 1N9JA 4HM1B 1STFI 2WO0A 1EKMA 2ML6A 1QAKA 1W02A 1IVVA 1CQSA 1W01A 4BTWA 5DREA 2XH9A 1CYVA 4PEJA 1SIHA 4AEQA 3SX1A 4LGQA 4K1UA 1W4NA 4HKVB 4FCZA 3CNXA 2P05A 3F9SA 1SJWA 3K7CA 4BTXA 4N6NB 1A2VA 2W9PA 1Q40A 1ROVA 3T0UA 1UUWB 1IQYA 2Q07A 2I9WA 1E97A 3N54B 1K734 1TFKA 3DY5A 3HZPA 3WA2X 4AKZA 3D3LA 3LYGA 3WA3A 2QEX3 1VQL3 3G713 5EVHA 1TU5A 1VQ83 1LNHA 2HMJB 4J9AA 2YFLB 4GB5A 3KKGA 4FR9A 1W6YA 4TX4A 1F8NA 4I4KA 1N8R4 1W5ZA 2B1XB 1YVBI 3OWSA 5IG5A 1VQK3 3K5TA 2B24B 3Q2PA 1FUWA 2OOVA 4HM3B 1KC84 3SOAA 1AVLA 3HX8A 3PYJA 3NQZA 1RN7A 2XR8B 2FNQA 3IJEB 1Q864 2LYXA 2RSXA 1JKGA 1ISKA 1WTHA 1YIT3 2R4IA 3LTBA 2D42A 1ZO2A 4R1KA 4O02B 1FGRA 4R9LA 3SXXA 2W2CA 1O7WB 2Z6BA 3NV0A 4N6TA 4RNYA 4AKYA 1YI23 3LXUX 3KN4A 3EC9A 3NQYA 5CXOA 1QVG2 2YFIB 4OVMA 3GZRA 5AIHA 3L0RA 3NUVA 4FCMA 1E3VA 1O7PB 3UB1A 2CHCA 3NXJA 3CCS3 3X41A 4XDVA 1Z1SA 2KRTA 3GRDA 2ML5A 3B7CA 1OHSA 4OK0A 2FGTA 1NO3A 2BT3A 3FF0A 3DXOA 3NM2A 3S29A 2CFKA 2CWTA 3BNDA 1N8QA 3FGYA 2Y73A 4RZMA 4R4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVD A;  3SVA A;  3UL5 A;  3PS8 A;  4N6L A;  1PFP A;  5LC7 A;  1FA3 A;  5ELJ A;  1NB5 I;  4EYC A;  3LH4 A;  1WNH A;  3KFQ C;  1MNL A;  4N6M A;  1IV7 A;  1GD4 A;  3IMA B;  1A67 A;  4N6O B;  1TIJ A;  1N5H A;  5LC6 A;  1LXE A;  3S67 A;  1GD3 A;  4N6V 0;  1NB3 I;  1N9J A;  1STF I;  3UL6 A;  1CYV A;  1KWI A;  1A90 A;  3KSE D;  4LZI A;  1N5P A;  1CEW I;  4N6N B;  2W9P A;  5A0O B;  4CCV A;  5EQL A;  3K9M C;  1MOL A;  4TX4 A;  1CYU A;  2W9Q A;  1YVB I;  2KXG A;  1IV9 A;  4IT7 A;  1ROA A;  2O9U X;  3Q2P A;  4N6U A;  1FUW A;  3PYJ A;  1RN7 A;  4ZM8 A;  2CH9 A;  3QRD A;  2OCT A;  3PXM A;  1M9G A;  1DVC A;  4N6T A;  3NX0 A;  2BO9 B;  3MWZ A;  3L0R A;  1G96 A;  1EQK A;  3GAX A;  5ELU A;  1R4C A; 
#chains in the Genus database with same CATH topology
 2OQE C;  2Z76 A;  1DVD A;  1S72 3;  3BU4 A;  3D9R A;  3UL5 A;  2QIY A;  1EA2 A;  3HI7 A;  1BU4 A;  3PS8 A;  1B21 A;  2W03 A;  3N9H A;  2OOV C;  3S27 A;  1GY5 A;  2RNT A;  1B2S A;  5LC7 A;  5ELJ A;  3URP A;  1WMP A;  1NB5 I;  2INX A;  1DMN A;  4RBN A;  1D6Y A;  2IA7 A;  1FZU A;  2M7O A;  4N6M A;  5IW9 A;  1VQ7 3;  1RRH A;  2XEP A;  2RGQ A;  1ZX2 A;  1IV7 A;  3AHS A;  4L7K A;  3MHE A;  3Q90 A;  3WOF B;  5AYS C;  4J8T A;  1GOU A;  3NBB A;  5D82 A;  1LOV A;  4HM7 B;  2ZHX B;  4N6O B;  1JBT A;  3KII A;  1K41 A;  3CPO A;  3FG3 A;  4G1M B;  4HAA A;  3AMO B;  3G4S 3;  1BOX A;  1RGH A;  3D5I A;  3FG1 A;  1FW7 A;  1RTU A;  3KE7 A;  2OTL 3;  3WHO A;  3OX9 A;  4WP5 A;  1OF5 B;  4HM2 B;  1L5G B;  3NBR A;  2HML B;  5KP4 A;  4FMD A;  1LRA A;  2ZA4 A;  3EBY A;  1GMQ A;  1C54 A;  3SYU A;  1ZS7 A;  3LTA A;  2RFR A;  4HM8 B;  4NHF A;  5DRV A;  1NNV A;  1AR0 A;  2F98 A;  2RCD A;  5D83 A;  4CJN A;  1S5A A;  2CWV A;  3NHX A;  3PCR A;  1JBR A;  2OTJ 3;  1JZD A;  3EN1 B;  1K9M 4;  3MPH A;  1KWI A;  1DE3 A;  1A90 A;  3WR2 A;  2W6J H;  3DGN A;  3CNM A;  4XBX A;  7GSP A;  6STD A;  3EQQ B;  2GBW B;  3CCU 3;  1N5P A;  3UJM A;  4K61 A;  1JB2 A;  1U5O A;  2CC3 A;  4HM6 B;  3JVC A;  1W6C A;  1A2K A;  3K0Z A;  5IEN A;  1JB5 A;  2K0M A;  2HMK B;  4KT3 B;  4J5G A;  2WOH A;  2P09 A;  3CCL 3;  1DMM A;  1UI8 A;  2QGU A;  2MC8 A;  4BTY A;  1EG9 B;  1FGQ A;  1BNE A;  5EQL A;  1OGZ A;  3HII A;  5BIR A;  1N9E A;  1YJN 3;  3HK4 A;  3PGB A;  2A15 A;  1C7H A;  4NPB A;  1GSP A;  1BRI A;  2W9Q A;  3HIG A;  4OUQ A;  5BVB A;  2Z7A A;  5EEO A;  3LML A;  3RDE A;  3CC2 3;  1BSC A;  1B20 A;  2HMO B;  2W56 A;  4IT7 A;  2GEY A;  4JF8 A;  3G6E 3;  2CFG A;  3I56 3;  1JNQ A;  1BUQ A;  4Q53 A;  3FCS B;  4MMY B;  1RGA A;  3X40 A;  1TFO A;  2XSO B;  7STD A;  5FW5 A;  3S5C A;  2KCD A;  1JB4 A;  3O8Y A;  4HZB B;  5D81 A;  3V92 A;  2STD A;  1RLS A;  2XFT A;  3DGL A;  1O7H B;  1OPY A;  1I2F A;  3X3Y A;  3EN8 A;  3V98 A;  3QRD A;  3MG2 A;  1WQL B;  1GS3 A;  1D6Z A;  1QAL A;  2OCT A;  3VGN A;  3CCE 3;  1JN5 A;  1UGH I;  1QAF A;  4EV2 A;  1BAN A;  1FGM A;  3MG3 A;  4RNT A;  3CME 3;  3SLU A;  1I3I A;  2GU1 A;  3EF8 A;  1AV4 A;  3DGO A;  3X42 A;  4K1V A;  1BSE A;  3RNT A;  1V57 A;  4BL2 A;  1T2H A;  3GZX B;  1R4Y A;  2F5W A;  1NWW A;  4HM4 B;  4J5K A;  3QK9 A;  1OGX A;  3GAX A;  3CCQ 3;  1Q81 4;  5ELU A;  3CD6 3;  1Q40 B;  3T8U A;  4L8O A;  5KP1 A;  1PFP A;  2V1L A;  1FA3 A;  2IYJ A;  4L8P A;  3B8L A;  3E99 A;  3EE1 A;  4K90 B;  5BU4 A;  2H0G A;  3F7S A;  1IT7 A;  9RNT A;  5CF1 A;  3KFQ C;  3VF1 A;  1FGT A;  1E3R A;  3DGM A;  3LT8 A;  2J8X B;  3M8C A;  3KCH A;  5IER A;  3DH2 A;  1VQ6 3;  1VQ9 3;  1OH0 A;  2C11 A;  1RJO A;  1TUH A;  2K54 A;  1O7G B;  2UX0 A;  1O7N B;  3OWY A;  1UDI I;  1TRP A;  2SAR A;  2W04 A;  3GSP A;  3AGN A;  3ROB A;  2KAA A;  1TIJ A;  2JDI H;  2MF7 A;  5CK6 A;  3S67 A;  1Y4K A;  1IQX A;  3ZFZ A;  1BNJ A;  1B2U A;  4JRF A;  1OHO A;  1I70 A;  4HBR A;  1BRJ A;  1JKG B;  2CG1 A;  3D4A A;  4MJD A;  1UI7 A;  1ZGX A;  2KF6 A;  1AQZ A;  1W6G A;  3K63 A;  1YJ9 3;  1RGF A;  3ZG5 A;  3SOY A;  1D6U A;  3MSO A;  1YHQ 3;  8RNT A;  2ZDJ A;  2AAD A;  1RN1 A;  3NV0 B;  2Y74 A;  3CPW 2;  1SPU A;  1MWR A;  4LYL B;  4CPK A;  1M90 4;  1YNV X;  1LQM B;  1PYL A;  3PCS A;  5AEU B;  5CLK A;  1UCI A;  2R41 A;  4BL3 A;  4GSP A;  4LZI A;  2HMM B;  4U13 A;  1CEW I;  2XGL A;  5IEO A;  1JJ2 2;  3A76 A;  1KD1 4;  4FMC A;  5M19 A;  4WWU C;  4CDL A;  2XF3 A;  4BIR A;  3LZA A;  3U1W A;  3D5G A;  1LVN A;  1ULI B;  3FSD A;  1BNR A;  2XRX B;  1FUS A;  1OAC A;  3DZL A;  4HYZ A;  4N3V A;  5CF2 A;  4CCV A;  2BHM A;  2BU4 A;  2P38 A;  3VSY A;  1PU4 A;  1STD A;  3MKI A;  2CFD A;  4X2O A;  3K9M C;  1O7M B;  3LOY A;  1CYU A;  3Q3F A;  1TJD A;  3DM8 A;  4HZ9 B;  3JUN A;  4MMZ B;  1IV9 A;  1SQW A;  2PNC A;  4HM5 B;  1NJI 4;  2E2U A;  2W0Q A;  2BNG A;  1BGS A;  3LTD A;  2WGQ A;  2H0H A;  2CG0 A;  1G0T A;  1LOX A;  2L4V A;  4XBY A;  5IF6 A;  1QMA A;  1ASK A;  3FG4 A;  1QVF 2;  3F8H A;  4KFE A;  5HGR A;  2CH9 A;  3RGR A;  1VQP 3;  3CC4 3;  2PZV A;  3I0Y A;  1NU3 A;  4RNZ A;  1UUG B;  2L1S A;  1DVC A;  1RHL A;  3SED A;  3CCM 3;  1GY6 A;  2E2T A;  1WMO A;  1B2Z A;  3CC7 3;  2BO9 B;  1UUV B;  2YFJ B;  3MWZ A;  4STD A;  2Z77 A;  3OXA A;  5JBS A;  1JBS A;  4FMB A;  3CMA 3;  4X2H A;  2BMO B;  2O3O A;  3BNB A;  1BVI A;  1RGE A;  1UCJ A;  3F8X A;  1X1W A;  1SAR A;  4IPB A;  4H61 A;  1YGW A;  2CKF B;  5FGO A;  3G16 A;  1K8A 4;  4NRE A;  3UNL A;  1IT8 A;  2SBL A;  1GY7 A;  2HMN B;  4ORL A;  1UW1 A;  3JUM A;  3BIR A;  3WMD A;  2CFW A;  1TRQ A;  2CWU A;  2QA4 3;  1JZO A;  1LNI A;  3X3X A;  4EYC A;  5G1K A;  4LSO A;  3WOE B;  1GMP A;  3ZG0 A;  4DKI A;  1MGR A;  1TP6 A;  3J7Y d;  1MNL A;  3JUP A;  3BLZ A;  1ULJ B;  1I0V A;  1BNG A;  4R80 A;  1LOW A;  4WYK A;  3FLJ A;  3KSP A;  3CCJ 3;  3IMA B;  1A67 A;  2W56 B;  1RGK A;  1VQM 3;  4KFD A;  1MWS A;  4LMI A;  1V74 A;  1N5H A;  4KZ1 A;  3S28 A;  2CX1 A;  3N8B A;  2D1W A;  1GD3 A;  3A5E A;  3WOD G;  3B4O A;  2CIU A;  3EJV A;  4N6V 0;  4O8S A;  5G2G A;  1NB3 I;  3OW2 2;  1UGI A;  2XFS A;  3OV4 A;  2P0M A;  1IVW A;  1I8V A;  1KSI A;  2CW9 A;  4EV5 A;  3FH1 A;  4XB5 A;  1BRK A;  3UL6 A;  4KFF A;  4MEI A;  1YVS A;  1J2B A;  5IG4 A;  1HZ1 A;  1JN5 B;  4HJL B;  3TDG A;  1IVX A;  3FKA A;  5AYR B;  2OQE A;  2F4Y A;  2LQV A;  2ZL8 A;  3ER7 A;  1KQS 2;  3CXC 2;  3KSE D;  1OHP A;  3DMC A;  4WYK B;  4XDW A;  3WDG B;  2GEX A;  3GZY B;  4WHA A;  3V99 A;  4GHO A;  5IEP A;  2H0I A;  1YIJ 3;  1IVU A;  3CCV 3;  3OWU A;  1B2M A;  3AGO A;  3JUO A;  3PZW A;  1YJW 3;  5GSP A;  3X3Z A;  5A0O B;  1DMQ A;  1BNS A;  3BNC A;  3D79 A;  1BUJ A;  5BXQ A;  3U97 A;  1BAO A;  4MMX B;  2WOF A;  3NM7 A;  4HM0 B;  1I3F A;  1US1 A;  4FMA A;  3EX9 A;  3JUQ A;  4O2H A;  3MG1 A;  1MOL A;  1W2B 2;  5JPU A;  3FF2 A;  1JV2 B;  2KXG A;  4GL6 A;  1IYY A;  1GOV A;  1WMN A;  5HOH A;  5STD A;  2OWP A;  1YGE A;  2JQ5 A;  1IK3 A;  3LTC A;  1ROA A;  2O9U X;  4N6U A;  1UCK A;  3F14 A;  2XSH B;  2GU3 A;  3AMO A;  3EHC A;  4HVN A;  5AEW B;  5RNT A;  1RNB A;  2FXT A;  2CFL A;  4WFO A;  1JRQ A;  1IU7 A;  1BRN L;  1VQ5 3;  4EBG A;  3DGY A;  1OF5 A;  1GYB A;  1Q9E A;  1U8C B;  1IQ8 A;  1QJG A;  3ALA A;  5TGN A;  4ZM8 A;  2WGO A;  4XM4 A;  1HKX A;  4XBT A;  1I0X A;  1W2Z A;  1IDP A;  1RN4 A;  4H3U A;  2GBX B;  4QWT A;  4LEH A;  3PXM A;  2AAE A;  4EXR A;  1M9G A;  1W00 A;  5I97 A;  8CHO A;  2IUK A;  3DUK A;  3NX0 A;  3GZB A;  6GSP A;  2KF5 A;  3G8Z A;  2E2V A;  1G96 A;  2YX9 A;  2IMJ A;  3BB9 A;  3H3H A;  3G0K A;  1FGO A;  1B27 A;  3BNE A;  2XGN A;  2F99 A;  1A2P A;  5IG3 A;  1BRH A;  1EQK A;  1T5Y A;  4I5Q A;  2IUJ A;  1VQO 3;  1Q42 A;  2UUG C;  3B4P A;  1MGW A;  1MWU A;  5AIG A;  1W7C A;  2CK3 H;  1BNI A;  3NBJ A;  1R4C A;  2P0X A;  1RCK A;  3SVA A;  2F86 B;  3RGA A;  6RNT A;  1M1X B;  1VQ4 3;  1M1K 4;  4N6L A;  3STD A;  3H51 A;  1SII A;  3KZT A;  1RKY A;  1RMS A;  3F7X A;  3GWR A;  3LH4 A;  3LT9 A;  1WNH A;  5KP3 A;  1K28 A;  1OCV A;  1OUN A;  1RCL A;  3Q1C A;  1BSA A;  4O3V A;  1VQN 3;  3EB8 A;  3FZW A;  1GMR A;  2GXF A;  2C10 A;  5AIF A;  4EC6 A;  3ECF A;  3EBT A;  1AVK A;  3CCR 3;  1GD4 A;  1LOY A;  2BMR B;  1Q7Y 4;  3CU3 A;  4FCJ A;  3MYT A;  2KF4 A;  5IG0 A;  3IPT A;  4KVH A;  1X1X A;  3T8N A;  5LC6 A;  1LXE A;  1AY7 A;  1I2E A;  5AII A;  1NDO B;  2UGI A;  4R9K A;  1HU9 A;  5AI1 A;  5JPP A;  1RRL A;  1BRG A;  1Q82 4;  4EW5 A;  3I55 3;  1MWT A;  1RGG A;  2BMQ B;  1VZZ A;  1DYU A;  4IIA A;  1B2X A;  3F40 A;  1N9J A;  4HOH A;  4HM1 B;  1STF I;  2WO0 A;  1X1U A;  1EUI C;  1EKM A;  1QAK A;  1W02 A;  2ML6 A;  4BU4 A;  1IVV A;  1CQS A;  1W01 A;  1Q7H A;  4BTW A;  5DRE A;  7RNT A;  2XH9 A;  1CYV A;  4PEJ A;  1SIH A;  4AEQ A;  1BSD A;  3SX1 A;  4LGQ A;  1CH0 A;  1LQG C;  4K1U A;  1W4N A;  1HYF A;  1RNT A;  4FCZ A;  4HKV B;  3CNX A;  2F5M A;  2P05 A;  3F9S A;  1SJW A;  3K7C A;  1V58 A;  2CX0 A;  4BTX A;  4N6N B;  1A2V A;  2W9P A;  1Q40 A;  1ROV A;  3T0U A;  1UUW B;  1IQY A;  2Q07 A;  2I9W A;  1VQQ A;  1E97 A;  3N54 B;  1UCL A;  1K73 4;  1TFK A;  1T3B A;  1X1Y A;  3DY5 A;  3HZP A;  3WA2 X;  4AKZ A;  3D3L A;  3LYG A;  3WA3 A;  2C4B A;  2QEX 3;  1VQL 3;  3G71 3;  5EVH A;  4ILF A;  1TU5 A;  2KF3 A;  1VQ8 3;  1G02 A;  1LNH A;  1GOY A;  2HMJ B;  4J9A A;  2YFL B;  4GB5 A;  2K3D A;  3KKG A;  4FR9 A;  1W6Y A;  4TX4 A;  1F8N A;  4I4K A;  1N8R 4;  1W5Z A;  2B1X B;  1YVB I;  5M1A A;  3OWS A;  1DET A;  5IG5 A;  1EEJ A;  2BIR A;  2IY2 A;  1FUT A;  1VQK 3;  2GSP A;  1RSN A;  3K5T A;  1T2I A;  2B24 B;  2HOH A;  1PY3 A;  3Q2P A;  2OOV A;  1FUW A;  4HM3 B;  1KC8 4;  3SOA A;  3AHW A;  1BRS A;  1AVL A;  3HX8 A;  3PYJ A;  3NQZ A;  1RN7 A;  2FNQ A;  2XR8 B;  3IJE B;  2F56 A;  1Q86 4;  2LYX A;  2RSX A;  1JKG A;  1ISK A;  1WTH A;  1BNF A;  1YIT 3;  2R4I A;  1RGL A;  3LTB A;  2D42 A;  1ZO2 A;  5G1L A;  4R1K A;  2RBI A;  1TTO A;  4O02 B;  1FGR A;  4R9L A;  1RGC A;  3SXX A;  2W2C A;  1O7W B;  2Z6B A;  3NV0 A;  4N6T A;  4RNY A;  4AKY A;  5M18 A;  1YI2 3;  1BSB A;  3LXU X;  3KN4 A;  3EC9 A;  3NQY A;  5CXO A;  1QVG 2;  2YFI B;  4OVM A;  3GZR A;  5AIH A;  1RDS A;  3L0R A;  3NUV A;  4FCM A;  1E3V A;  1O7P B;  3UB1 A;  2CHC A;  3NXJ A;  3CCS 3;  1B3S A;  3X41 A;  1I2G A;  4XDV A;  1Z1S A;  2KRT A;  3GRD A;  2ML5 A;  3B7C A;  1BIR A;  1OHS A;  4OK0 A;  2FGT A;  3HOH A;  1NO3 A;  2BT3 A;  3FF0 A;  3DXO A;  3NM2 A;  3S29 A;  2CFK A;  2CWT A;  3BND A;  1N8Q A;  3FGY A;  2Y73 A;  1FYS A;  4RZM A;  4R4K A; 
#chains in the Genus database with same CATH homology
 2OQE C;  2Z76 A;  1DVD A;  1S72 3;  3D9R A;  3UL5 A;  2QIY A;  1EA2 A;  3HI7 A;  3PS8 A;  3S27 A;  3N9H A;  2W03 A;  2OOV C;  1GY5 A;  5LC7 A;  5ELJ A;  1WMP A;  1NB5 I;  2INX A;  1DMN A;  4RBN A;  1D6Y A;  2IA7 A;  4N6M A;  2M7O A;  5IW9 A;  1VQ7 3;  1RRH A;  2XEP A;  2RGQ A;  1ZX2 A;  1IV7 A;  4L7K A;  3MHE A;  3Q90 A;  3WOF B;  5AYS C;  4J8T A;  3NBB A;  5D82 A;  4HM7 B;  4N6O B;  3KII A;  1K41 A;  3CPO A;  3FG3 A;  4G1M B;  3G4S 3;  3AMO B;  3FG1 A;  3KE7 A;  2OTL 3;  3OX9 A;  4WP5 A;  1OF5 B;  4HM2 B;  1L5G B;  3NBR A;  2HML B;  5KP4 A;  4FMD A;  3EBY A;  3LTA A;  2RFR A;  4HM8 B;  4NHF A;  5DRV A;  2F98 A;  1AR0 A;  5D83 A;  2RCD A;  1S5A A;  2CWV A;  3NHX A;  3PCR A;  2OTJ 3;  3EN1 B;  1K9M 4;  3MPH A;  1KWI A;  1A90 A;  2W6J H;  3DGN A;  3CNM A;  4XBX A;  6STD A;  3EQQ B;  2GBW B;  3CCU 3;  1N5P A;  3UJM A;  4K61 A;  1JB2 A;  1U5O A;  2CC3 A;  4HM6 B;  3JVC A;  1W6C A;  1A2K A;  3K0Z A;  5IEN A;  1JB5 A;  2K0M A;  2HMK B;  2WOH A;  2P09 A;  3CCL 3;  1DMM A;  1UI8 A;  2QGU A;  2MC8 A;  4BTY A;  1EG9 B;  1FGQ A;  5EQL A;  1OGZ A;  3HII A;  1N9E A;  1YJN 3;  3HK4 A;  3PGB A;  2A15 A;  1C7H A;  2W9Q A;  3HIG A;  4OUQ A;  5BVB A;  2Z7A A;  5EEO A;  3LML A;  3RDE A;  3CC2 3;  2W56 A;  2HMO B;  4JF8 A;  4IT7 A;  2GEY A;  3G6E 3;  2CFG A;  3I56 3;  1JNQ A;  1BUQ A;  4Q53 A;  3FCS B;  4MMY B;  3X40 A;  1TFO A;  2XSO B;  7STD A;  5FW5 A;  3S5C A;  2KCD A;  1JB4 A;  3O8Y A;  4HZB B;  5D81 A;  3V92 A;  2STD A;  2XFT A;  3DGL A;  1O7H B;  1OPY A;  3X3Y A;  3EN8 A;  3V98 A;  3QRD A;  3MG2 A;  1WQL B;  1GS3 A;  1D6Z A;  1QAL A;  2OCT A;  3VGN A;  3CCE 3;  1JN5 A;  1QAF A;  4EV2 A;  1FGM A;  3MG3 A;  3CME 3;  3SLU A;  2GU1 A;  3EF8 A;  1AV4 A;  3DGO A;  3X42 A;  4K1V A;  3GZX B;  1NWW A;  4HM4 B;  3QK9 A;  1OGX A;  3GAX A;  3CCQ 3;  1Q81 4;  5ELU A;  3CD6 3;  1Q40 B;  3T8U A;  4L8O A;  5KP1 A;  1PFP A;  2V1L A;  1FA3 A;  4L8P A;  3B8L A;  3E99 A;  3EE1 A;  4K90 B;  3F7S A;  1IT7 A;  5CF1 A;  3KFQ C;  3VF1 A;  1FGT A;  1E3R A;  3DGM A;  3LT8 A;  5IER A;  3M8C A;  1VQ6 3;  1VQ9 3;  1OH0 A;  2C11 A;  1RJO A;  1TUH A;  2K54 A;  1O7G B;  2UX0 A;  1O7N B;  3OWY A;  2W04 A;  3ROB A;  1TIJ A;  2JDI H;  2MF7 A;  5CK6 A;  3S67 A;  1Y4K A;  1IQX A;  4JRF A;  1OHO A;  4HBR A;  1JKG B;  2CG1 A;  4MJD A;  1UI7 A;  1W6G A;  3K63 A;  1YJ9 3;  1YHQ 3;  3SOY A;  1D6U A;  3MSO A;  2ZDJ A;  3NV0 B;  3CPW 2;  2Y74 A;  1SPU A;  1M90 4;  3PCS A;  5AEU B;  5CLK A;  4LZI A;  2HMM B;  4U13 A;  1CEW I;  2XGL A;  5IEO A;  1JJ2 2;  3A76 A;  1KD1 4;  4FMC A;  4WWU C;  4CDL A;  2XF3 A;  3LZA A;  3U1W A;  1LVN A;  1ULI B;  3FSD A;  2XRX B;  1OAC A;  3DZL A;  4HYZ A;  4N3V A;  5CF2 A;  4CCV A;  2BHM A;  2P38 A;  3VSY A;  1PU4 A;  1STD A;  3MKI A;  2CFD A;  4X2O A;  3K9M C;  1O7M B;  3LOY A;  1CYU A;  3DM8 A;  4HZ9 B;  3JUN A;  4MMZ B;  1IV9 A;  1SQW A;  2PNC A;  4HM5 B;  1NJI 4;  2E2U A;  2W0Q A;  2BNG A;  3LTD A;  2WGQ A;  2CG0 A;  1LOX A;  4XBY A;  2L4V A;  5IF6 A;  1QMA A;  1ASK A;  3FG4 A;  1QVF 2;  3F8H A;  4KFE A;  5HGR A;  2CH9 A;  3RGR A;  1VQP 3;  3CC4 3;  2PZV A;  3I0Y A;  1NU3 A;  4RNZ A;  1DVC A;  3CCM 3;  3SED A;  1GY6 A;  2E2T A;  1WMO A;  3CC7 3;  2BO9 B;  1UUV B;  2YFJ B;  3MWZ A;  4STD A;  2Z77 A;  3OXA A;  5JBS A;  4FMB A;  3CMA 3;  4X2H A;  2BMO B;  2O3O A;  3BNB A;  3F8X A;  4IPB A;  4H61 A;  2CKF B;  5FGO A;  3G16 A;  1K8A 4;  4NRE A;  3UNL A;  1IT8 A;  2SBL A;  1GY7 A;  2HMN B;  4ORL A;  1UW1 A;  3JUM A;  3WMD A;  2CFW A;  2CWU A;  2QA4 3;  3X3X A;  4EYC A;  4LSO A;  3WOE B;  1TP6 A;  3J7Y d;  1MNL A;  3JUP A;  3BLZ A;  1ULJ B;  4R80 A;  4WYK A;  3FLJ A;  3KSP A;  3CCJ 3;  3IMA B;  1A67 A;  2W56 B;  1VQM 3;  4KFD A;  4LMI A;  1V74 A;  1N5H A;  4KZ1 A;  3S28 A;  3N8B A;  2D1W A;  1GD3 A;  3WOD G;  3B4O A;  2CIU A;  3EJV A;  4N6V 0;  4O8S A;  5G2G A;  1NB3 I;  3OW2 2;  2XFS A;  3OV4 A;  2P0M A;  1IVW A;  1KSI A;  2CW9 A;  4EV5 A;  3FH1 A;  4XB5 A;  3UL6 A;  4KFF A;  4MEI A;  1J2B A;  5IG4 A;  4HJL B;  1JN5 B;  3TDG A;  1IVX A;  3FKA A;  5AYR B;  2OQE A;  2LQV A;  2ZL8 A;  3ER7 A;  1KQS 2;  3CXC 2;  3KSE D;  1OHP A;  3DMC A;  4WYK B;  4XDW A;  3WDG B;  2GEX A;  3GZY B;  4WHA A;  3V99 A;  5IEP A;  1YIJ 3;  1IVU A;  3CCV 3;  3OWU A;  3JUO A;  3PZW A;  1YJW 3;  3X3Z A;  5A0O B;  1DMQ A;  3BNC A;  5BXQ A;  3U97 A;  4MMX B;  2WOF A;  3NM7 A;  4HM0 B;  1US1 A;  4FMA A;  3EX9 A;  3JUQ A;  4O2H A;  3MG1 A;  1MOL A;  1W2B 2;  5JPU A;  3FF2 A;  1JV2 B;  2KXG A;  4GL6 A;  1WMN A;  5STD A;  2OWP A;  1YGE A;  2JQ5 A;  1IK3 A;  3LTC A;  1ROA A;  2O9U X;  4N6U A;  3F14 A;  2XSH B;  2GU3 A;  3AMO A;  3EHC A;  4HVN A;  5AEW B;  2FXT A;  2CFL A;  4WFO A;  1JRQ A;  1IU7 A;  1VQ5 3;  4EBG A;  1OF5 A;  1GYB A;  3ALA A;  1U8C B;  1IQ8 A;  1QJG A;  5TGN A;  4ZM8 A;  2WGO A;  4XM4 A;  1HKX A;  4XBT A;  1W2Z A;  1IDP A;  4H3U A;  2GBX B;  4QWT A;  4LEH A;  3PXM A;  5I97 A;  4EXR A;  1M9G A;  1W00 A;  8CHO A;  2IUK A;  3DUK A;  3NX0 A;  3GZB A;  3G8Z A;  2E2V A;  1G96 A;  2YX9 A;  2IMJ A;  3BB9 A;  3H3H A;  3G0K A;  1FGO A;  3BNE A;  2XGN A;  2F99 A;  5IG3 A;  1EQK A;  1T5Y A;  2IUJ A;  1VQO 3;  1Q42 A;  3B4P A;  5AIG A;  1W7C A;  2CK3 H;  3NBJ A;  1R4C A;  2P0X A;  3SVA A;  1VQ4 3;  2F86 B;  3RGA A;  1M1X B;  1M1K 4;  4N6L A;  3STD A;  3H51 A;  1SII A;  3KZT A;  1RKY A;  3F7X A;  3GWR A;  3LH4 A;  3LT9 A;  1WNH A;  5KP3 A;  1K28 A;  1OCV A;  1OUN A;  3Q1C A;  4O3V A;  1VQN 3;  3EB8 A;  3FZW A;  2GXF A;  2C10 A;  5AIF A;  4EC6 A;  3ECF A;  3EBT A;  1AVK A;  3CCR 3;  1GD4 A;  2BMR B;  1Q7Y 4;  3CU3 A;  4FCJ A;  3MYT A;  5IG0 A;  3IPT A;  4KVH A;  3T8N A;  5LC6 A;  1LXE A;  5AII A;  1NDO B;  4R9K A;  5AI1 A;  1HU9 A;  5JPP A;  1RRL A;  1Q82 4;  3I55 3;  2BMQ B;  1VZZ A;  1DYU A;  4IIA A;  3F40 A;  1N9J A;  4HM1 B;  1STF I;  2WO0 A;  1EKM A;  2ML6 A;  1QAK A;  1W02 A;  1IVV A;  1CQS A;  1W01 A;  4BTW A;  5DRE A;  2XH9 A;  1CYV A;  4PEJ A;  1SIH A;  4AEQ A;  3SX1 A;  4LGQ A;  4K1U A;  1W4N A;  4HKV B;  4FCZ A;  3CNX A;  2P05 A;  3F9S A;  1SJW A;  3K7C A;  4BTX A;  4N6N B;  1A2V A;  2W9P A;  1Q40 A;  1ROV A;  3T0U A;  1UUW B;  1IQY A;  2Q07 A;  2I9W A;  1E97 A;  3N54 B;  1K73 4;  1TFK A;  3DY5 A;  3HZP A;  3WA2 X;  4AKZ A;  3D3L A;  3LYG A;  3WA3 A;  2QEX 3;  1VQL 3;  3G71 3;  5EVH A;  1TU5 A;  1VQ8 3;  1LNH A;  2HMJ B;  4J9A A;  2YFL B;  4GB5 A;  3KKG A;  4FR9 A;  1W6Y A;  4TX4 A;  1F8N A;  4I4K A;  1N8R 4;  1W5Z A;  2B1X B;  1YVB I;  3OWS A;  5IG5 A;  1VQK 3;  3K5T A;  2B24 B;  3Q2P A;  1FUW A;  2OOV A;  4HM3 B;  1KC8 4;  3SOA A;  1AVL A;  3HX8 A;  3PYJ A;  3NQZ A;  1RN7 A;  2XR8 B;  2FNQ A;  3IJE B;  1Q86 4;  2LYX A;  2RSX A;  1JKG A;  1ISK A;  1WTH A;  1YIT 3;  2R4I A;  3LTB A;  2D42 A;  1ZO2 A;  4R1K A;  4O02 B;  1FGR A;  4R9L A;  3SXX A;  2W2C A;  1O7W B;  2Z6B A;  3NV0 A;  4N6T A;  4RNY A;  4AKY A;  1YI2 3;  3LXU X;  3KN4 A;  3EC9 A;  3NQY A;  5CXO A;  1QVG 2;  2YFI B;  4OVM A;  3GZR A;  5AIH A;  3L0R A;  3NUV A;  4FCM A;  1E3V A;  1O7P B;  3UB1 A;  2CHC A;  3NXJ A;  3CCS 3;  3X41 A;  4XDV A;  1Z1S A;  2KRT A;  3GRD A;  2ML5 A;  3B7C A;  1OHS A;  4OK0 A;  2FGT A;  1NO3 A;  2BT3 A;  3FF0 A;  3DXO A;  3NM2 A;  3S29 A;  2CFK A;  2CWT A;  3BND A;  1N8Q A;  3FGY A;  2Y73 A;  4RZM A;  4R4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...