1MOLA

Two crystal structures of a potently sweet protein: natural monellin at 2.75 angstroms resolution and single-chain monellin at 1.7 angstroms resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sweet-tasting protein
molecule keywords MONELLIN
publication title Two crystal structures of a potently sweet protein. Natural monellin at 2.75 A resolution and single-chain monellin at 1.7 A resolution.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 21
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1molA00
5A0OB 3KSED 4N6LA 2O9UX 3LH4A 5ELJA 1DVCA 3L0RA 1FA3A 5ELUA 3GAXA 4N6MA 1KWIA 4TX4A 2BO9B 1FUWA 2W9QA 1CYVA 1N9JA 1ROAA 4N6V0 4N6OB 3UL5A 3SVAA 1R4CA 1LXEA 2CH9A 4EYCA 1RN7A 3UL6A 1G96A 3MWZA 3PYJA 4N6TA 4N6NB 1IV7A 4ZM8A 3QRDA 3S67A 1MOLA 3PXMA 1WNHA 1EQKA 1GD4A 1NB5I 3Q2PA 4IT7A 3NX0A 1PFPA 1A67A 5EQLA 1TIJA 1N5PA 2OCTA 1CYUA 3IMAB 1M9GA 1DVDA 1MNLA 1STFI 2KXGA 1NB3I 3PS8A 5LC7A 2W9PA 4N6UA 1A90A 3KFQC 1N5HA 4CCVA 1CEWI 3K9MC 1YVBI 1IV9A 1GD3A 4LZIA 5LC6A
chains in the Genus database with same CATH superfamily
1ZGXA 3KSED 4N6LA 1O7GB 3JVCA 2LQVA 2O9UX 3F14A 3KKGA 1AR0A 1DVCA 2CWUA 1IVUA 1S5AA 1GY5A 4WYKB 4KFDA 1BGSA 3L0RA 1AVKA 5ELUA 5CF2A 3CCS3 3CPOA 2KRTA 1YJW3 4LYLB 2JDIH 4N6MA 4HM8B 4HM7B 1SJWA 4TX4A 3BNBA 5AYRB 1LOXA 2K54A 3AGNA 2ML6A 3B8LA 3V92A 1FUTA 5BVBA 3V99A 3DM8A 1B20A 4NHFA 4HM5B 1CYVA 1GOVA 1RLSA 3LXUX 3ZG0A 3BNDA 2CFGA 1NJI4 2QIYA 1VZZA 5CXOA 3UL5A 1MGRA 3ZG5A 3GZRA 1M904 5D82A 1JJ22 4O8SA 1I3IA 3FG1A 3RGRA 3FZWA 1TU5A 1G02A 4Q53A 1VQL3 2P09A 3DH2A 1W6CA 3UL6A 4FMCA 2OTJ3 4JRFA 4WFOA 4WP5A 1DMMA 1G96A 2KAAA 1JN5A 1NNVA 5EVHA 1GSPA 3NV0A 4RNTA 1DMNA 1QALA 1OGZA 1MGWA 2KF6A 2QGUA 4ZM8A 1YJ93 1VQ53 1R4YA 3S67A 2CWTA 3T8UA 3FSDA 1Q814 1GMPA 4XBXA 4WHAA 3NBJA 3G0KA 1RGCA 3D9RA 3MPHA 2MC8A 3K63A 3CME3 1LOVA 1JKGA 3FGYA 3RDEA 3EN1B 3GZYB 5M19A 1EQKA 2HMJB 2WOFA 3STDA 1D6ZA 1JBRA 3N54B 1JNQA 1HZ1A 1UI7A 2KF4A 2L4VA 4MMZB 3SYUA 1VQN3 3GWRA 4FR9A 5IERA 2QA43 1VQ43 4IT7A 1YGWA 5FGOA 2E2TA 2J8XB 1GY6A 1WTHA 2CHCA 3J7Yd 1UUGB 5TGNA 2XFSA 3S28A 1YHQ3 4FMBA 1IT7A 2CG1A 2OCTA 1QVG2 3B4PA 2OQEA 1CYUA 1W6YA 1DYUA 4J5KA 2Z77A 3WDGB 3NV0B 1BSDA 3IMAB 5IF6A 1V57A 1DVDA 3CCU3 1W5ZA 1RNBA 1EEJA 4L8PA 1KC84 1RN1A 2K0MA 1BNIA 3DGOA 4OVMA 1MNLA 2GEXA 2XSHB 3HI7A 3KIIA 1W2B2 3IJEB 2KXGA 2KF5A 3KZTA 4HBRA 2P38A 2R41A 4N3VA 1B2MA 3FF0A 3X3XA 1U5OA 3CD63 3LTBA 1QVF2 1IU7A 3N8BA 3X40A 1BRNL 1VQ63 1I0XA 1SQWA 3BU4A 1VQ83 3JUPA 2CWVA 1BANA 1LOYA 2CIUA 2W0QA 3URPA 5RNTA 5BXQA 1YVBI 3D4AA 1JV2B 1IVWA 3U97A 1WMPA 2BNGA 4X2OA 4GB5A 5JBSA 1NU3A 1UW1A 3WOFB 3GSPA 3CC23 1IVXA 3NQZA 1IQ8A 3U1WA 1Z1SA 2Z7AA 3NM7A 2W2CA 1V74A 3EQQB 4HJLB 1OHOA 4XM4A 4GHOA 4STDA 1IQYA 1BNFA 3MG2A 2RFRA 3NQYA 1MWRA 1SIIA 1IK3A 1K734 1UGIA 2C10A 2XR8B 1Q7HA 5HOHA 3G4S3 3EF8A 3G6E3 4LEHA 4NPBA 4HM4B 1KD14 4HAAA 1KSIA 3T0UA 3CCQ3 4PEJA 1PYLA 4EV2A 3F7XA 2K3DA 3FG4A 3Q3FA 5IEPA 4I5QA 2OOVA 3FLJA 1YNVX 2W9QA 5CF1A 3LMLA 3CCL3 2ML5A 5DRVA 1G0TA 1BNJA 2INXA 1ROAA 4N6V0 4LMIA 1IQXA 1OUNA 3FF2A 1TRQA 3KCHA 1AV4A 1LQGC 6STDA 3SVAA 4K1VA 3CNXA 1JB2A 2H0GA 3HIGA 1DMQA 4MEIA 4KFFA 5G1LA 1YI23 1RGEA 2CH9A 1LRAA 1Q42A 2FGTA 2YFLB 1JBTA 5I97A 2IUKA 1X1XA 1B21A 3ROBA 1OF5B 3WMDA 3AHWA 5JPPA 1ZO2A 5BIRA 4N6TA 5KP1A 3D5IA 2Y73A 3SEDA 1I3FA 4N6NB 1CH0A 1IV7A 6GSPA 5AEUB 1LNIA 3G713 1IVVA 3BNCA 3SXXA 3EBTA 3CU3A 1UI8A 3OWSA 4XDWA 1T3BA 2R4IA 1S723 3FH1A 2V1LA 4KFEA 3BIRA 4WWUC 4CDLA 1T5YA 1VQP3 3E99A 7RNTA 1N8QA 1WNHA 3EE1A 3FKAA 4HYZA 1BU4A 3EBYA 3HZPA 1GD4A 2BIRA 1BAOA 4BIRA 1A2PA 1OHPA 4U13A 1O7PB 1O7WB 1BNRA 1GOYA 3WR2A 4K90B 4EXRA 3HOHA 5IG4A 1Q824 3CXC2 1UCJA 2XEPA 3K5TA 1YVSA 3UNLA 2HMNB 1ROVA 1FZUA 1A67A 3Q90A 1US1A 1ZS7A 2F5MA 3D79A 1TIJA 4EV5A 1K28A 1BRKA 1N5PA 1JB5A 4K61A 1BSEA 3CCJ3 3CCV3 3KN4A 2CFWA 1A2VA 2BHMA 2KF3A 4I4KA 1X1YA 5CK6A 3OW22 3LT8A 3PZWA 1K8A4 3JUNA 2FXTA 2BMOB 2XGNA 5D83A 5M18A 2IYJA 3NHXA 3H3HA 5AIIA 1BUQA 1JB4A 4XBYA 1STFI 3A5EA 3PS8A 5LC7A 3GZXB 1WQLB 3DGNA 2XGLA 2P0XA 4R9KA 1E97A 2M7OA 1DE3A 1RDSA 4FCJA 2MF7A 1VQM3 2L1SA 1JBSA 1TFKA 5AYSC 2F99A 2BMQB 4N6UA 5DREA 1Y4KA 3CPW2 1A90A 3MKIA 1Q40B 3BB9A 1STDA 2RNTA 1CQSA 4CCVA 1CEWI 2CFLA 1EUIC 4BL2A 1W01A 3NBBA 4EC6A 4HM1B 4MMXB 2W6JH 4KZ1A 1GD3A 5AIFA 3VF1A 3O8YA 1EA2A 2YFJB 3I563 2HMMB 3ALAA 1KQS2 3EX9A 4LZIA 4L7KA 1BRGA 3DZLA 3FG3A 6RNTA 5A0OB 1WMNA 3PCSA 2CFDA 1GMQA 2O3OA 3LH4A 2SBLA 2B1XB 4K1UA 2XSOB 4L8OA 1BSBA 2CW9A 2OQEC 5ELJA 3WOEB 2ZL8A 5GSPA 2IUJA 1FA3A 3DGMA 1RMSA 3GAXA 2YFIB 1OH0A 1TUHA 1I8VA 4R4KA 1ULIB 3RGAA 1PY3A 3CC73 3GRDA 5AIGA 4FCMA 3CCR3 5FW5A 3LTCA 4FMDA 1B2SA 7STDA 1Q7Y4 1I0VA 3H51A 4QWTA 3I553 1YGEA 4GSPA 2Z76A 4NREA 5IENA 1OHSA 1Q9EA 3AGOA 2STDA 1N9JA 2I9WA 4N6OB 1X1UA 1MWSA 1BUJA 7GSPA 2C11A 1TFOA 1FGQA 4OK0A 1YJN3 1FGTA 4HKVB 3FCSB 3GZBA 1N8R4 3B7CA 1MWUA 3EN8A 2D42A 2F98A 2E2VA 2ZDJA 2W03A 2WOHA 3CCM3 1RN7A 3F40A 1RTUA 1OF5A 1SARA 3QK9A 3DGLA 4O2HA 4OUQA 4RNYA 3AHSA 3KE7A 8RNTA 3PYJA 1GMRA 2GU3A 2HMOB 2UUGC 3TDGA 2CX1A 3ECFA 3OWUA 3HX8A 2IA7A 3IPTA 4J8TA 1W6GA 5IG3A 3F7SA 1RKYA 3S5CA 1UDII 2IY2A 1JRQA 4AKYA 3EHCA 2A15A 4LSOA 2CC3A 3OXAA 5CLKA 2D1WA 2XF3A 4FCZA 1GS3A 5M1AA 1RSNA 1TP6A 5G1KA 2OOVC 1MWTA 1MOLA 2WGQA 1C7HA 2E2UA 1DETA 4CJNA 1BSAA 3UB1A 3JUMA 4RZMA 1RHLA 2PNCA 1O7MB 1UUWB 1AY7A 3BLZA 1C54A 2BU4A 1NB5I 2CKFB 3Q2PA 3MSOA 4RNZA 3SOAA 4O3VA 1T2HA 3CC43 1NDOB 4HM6B 1RNTA 1PFPA 1ASKA 2QEX3 1FYSA 1VQ93 4MJDA 5AIHA 2HMKB 1E3RA 1TJDA 2GSPA 1IDPA 4HZ9B 3OX9A 1B2UA 1FGOA 2XFTA 1K41A 3DMCA 1B2ZA 3PGBA 1LQMB 1SIHA 1RRHA 1NWWA 4J5GA 8CHOA 5IEOA 1M9GA 1L5GB 1HU9A 4R80A 2GU1A 2BT3A 5KP3A 3SLUA 4MMYB 4BTXA 2XH9A 4LGQA 3K0ZA 1RN4A 3EB8A 4R1KA 2Q07A 2ZA4A 3EC9A 2W9PA 1FGMA 3ZFZA 1ULJB 3AMOB 1RGKA 1I70A 1W7CA 2WO0A 1Q40A 1BNEA 3MG3A 3SOYA 2CK3H 4HM3B 2GBWB 2GXFA 4BL3A 3Q1CA 3M8CA 1RJOA 2P05A 2YX9A 4HM2B 1B27A 3CMA3 3WA2X 4HZBB 5IG5A 1D6YA 2PZVA 3K9MC 5IG0A 2OWPA 5HGRA 1IV9A 1FGRA 3BNEA 3CCE3 2RSXA 1EKMA 2IMJA 5LC6A 2W56A 1SPUA 1BNSA 4IPBA 5EEOA 1I2GA 1OPYA 1WMOA 3LYGA 3VSYA 1GYBA 1UCLA 3OWYA 3S29A 1M1XB 1QMAA 1TTOA 1IYYA 3DXOA 4HM0B 4O02B 3V98A 1RGGA 4H61A 2ZHXB 1KWIA 1PU4A 3D3LA 2BO9B 1I2EA 5JPUA 1BIRA 1I2FA 2GBXB 3DGYA 3K7CA 4KT3B 3WA3A 1FUWA 3NM2A 3VGNA 5AEWB 1NO3A 1RGLA 3HIIA 4XB5A 3PCRA 2P0MA 1RCLA 4CPKA 2WGOA 3F9SA 5IW9A 1E3VA 3MYTA 2F56A 3OV4A 2AADA 1VQK3 1VQO3 1RCKA 2LYXA 1LOWA 3DY5A 2GEYA 3X3YA 4BTYA 3X3ZA 4G1MB 1FUSA 1RRLA 1UGHI 1W4NA 1BVIA 1A2KA 1R4CA 2W04A 3JUQA 2W56B 1LXEA 1U8CB 2BMRB 1UUVB 4XDVA 4EYCA 1W2ZA 2C4BA 1T2IA 3NBRA 1EG9B 2F4YA 5D81A 3EJVA 1QJGA 3D5GA 3MWZA 1VQ73 5AI1A 3N9HA 1LNHA 2HMLB 3MG1A 2RCDA 1O7NB 4RBNA 4DKIA 4ORLA 1K9M4 1X1WA 1JN5B 1TRPA 3NUVA 1HYFA 3LT9A 3F8HA 3QRDA 3LOYA 1AVLA 1QAKA 3NXJA 4HOHA 1V58A 2HOHA 2SARA 3F8XA 1O7HB 3HK4A 3RNTA 1YIT3 2UGIA 3LTAA 3PXMA 1GY7A 1ZX2A 2H0IA 1GOUA 1OCVA 1D6UA 3SX1A 2UX0A 1JKGB 4R9LA 3LTDA 2Y74A 4BTWA 2CG0A 3NX0A 4XBTA 4X2HA 4BU4A 1JZOA 3T8NA 2AAEA 5BU4A 4HVNA 1BRHA 2Z6BA 1BOXA 1IT8A 3JUOA 5EQLA 4EBGA 2CFKA 1RGAA 3I0YA 2B24B 3MHEA 1OGXA 1M1K4 4GL6A 2OTL3 4ILFA 3WHOA 1VQQA 1RGHA 4AKZA 2CX0A 4AEQA 1OACA 3G8ZA 1ISKA 3S27A 2F5WA 1QAFA 4WYKA 4IIAA 1BRJA 1FW7A 4J9AA 1B2XA 3A76A 3AMOA 3LZAA 4EW5A 1NB3I 9RNTA 5KP4A 2RBIA 4H3UA 1YIJ3 4KVHA 2XRXB 1HKXA 2FNQA 3B4OA 4JF8A 1BNGA 2RGQA 3CNMA 2KCDA 3KFQC 1BRSA 1BRIA 1N5HA 1B3SA 3WODG 3X42A 1W02A 1LVNA 1AQZA 4FMAA 1BSCA 3KSPA 1JZDA 1W00A 3ER7A 1F8NA 3UJMA 1UCIA 1UCKA 2JQ5A 1Q864 3X41A 2F86B 3G16A 2H0HA 3DUKA 5G2GA 1N9EA 5STDA 1RGFA 1J2BA
chains in the Genus database with same CATH topology
3KSED 4N6LA 1O7GB 3JVCA 2LQVA 2O9UX 3F14A 3KKGA 1AR0A 1DVCA 2CWUA 1IVUA 1S5AA 1GY5A 4WYKB 4KFDA 3L0RA 5CF2A 1AVKA 5ELUA 3CCS3 1YJW3 3CPOA 2KRTA 2JDIH 4N6MA 4HM8B 4HM7B 1SJWA 4TX4A 3BNBA 5AYRB 1LOXA 2K54A 2ML6A 3B8LA 3V92A 5BVBA 3V99A 3DM8A 4NHFA 4HM5B 1CYVA 3LXUX 3BNDA 2CFGA 1NJI4 2QIYA 1VZZA 5CXOA 3UL5A 3GZRA 1M904 5D82A 1JJ22 4O8SA 3FG1A 3RGRA 3FZWA 1TU5A 4Q53A 1VQL3 2P09A 3UL6A 1W6CA 4FMCA 2OTJ3 4JRFA 4WFOA 4WP5A 1DMMA 1G96A 1JN5A 5EVHA 3NV0A 1DMNA 1QALA 1OGZA 2QGUA 4ZM8A 1YJ93 1VQ53 3S67A 3T8UA 1Q814 3FSDA 4XBXA 4WHAA 3NBJA 3G0KA 3D9RA 3MPHA 2MC8A 3K63A 3CME3 1JKGA 3FGYA 3RDEA 3EN1B 3GZYB 1EQKA 2HMJB 2WOFA 3STDA 1D6ZA 3N54B 1JNQA 1UI7A 2L4VA 4MMZB 1VQN3 3GWRA 4FR9A 5IERA 2QA43 1VQ43 4IT7A 5FGOA 2E2TA 3J7Yd 1GY6A 1WTHA 2CHCA 5TGNA 2XFSA 3S28A 1YHQ3 4FMBA 1IT7A 2CG1A 2OCTA 1QVG2 3B4PA 2OQEA 1CYUA 1W6YA 1DYUA 2Z77A 3WDGB 3NV0B 3IMAB 5IF6A 1DVDA 3CCU3 1W5ZA 4L8PA 1KC84 2K0MA 3DGOA 4OVMA 1MNLA 2GEXA 2XSHB 3HI7A 3KIIA 1W2B2 3IJEB 2KXGA 4HBRA 3KZTA 4N3VA 2P38A 3FF0A 3X3XA 1U5OA 3CD63 3LTBA 1QVF2 1IU7A 3N8BA 3X40A 1VQ63 1SQWA 1VQ83 3JUPA 2CWVA 2CIUA 2W0QA 5BXQA 1YVBI 1JV2B 1IVWA 3U97A 1WMPA 2BNGA 4X2OA 4GB5A 5JBSA 1NU3A 1UW1A 3WOFB 3CC23 1IVXA 3NQZA 1IQ8A 3U1WA 1Z1SA 2Z7AA 3NM7A 2W2CA 1V74A 3EQQB 4HJLB 1OHOA 4XM4A 4STDA 1IQYA 3MG2A 2RFRA 3NQYA 1SIIA 1IK3A 1K734 2C10A 2XR8B 3G4S3 3G6E3 3EF8A 4LEHA 1KD14 4HM4B 1KSIA 3T0UA 3CCQ3 4PEJA 4EV2A 3F7XA 3FG4A 5IEPA 2OOVA 3FLJA 2W9QA 5CF1A 3LMLA 3CCL3 2ML5A 5DRVA 2INXA 1ROAA 4N6V0 4LMIA 1IQXA 1OUNA 3FF2A 1AV4A 6STDA 3SVAA 4K1VA 3CNXA 1JB2A 3HIGA 1DMQA 4MEIA 4KFFA 1YI23 2CH9A 1Q42A 2FGTA 2YFLB 5I97A 2IUKA 3ROBA 1OF5B 3WMDA 5JPPA 1ZO2A 4N6TA 5KP1A 2Y73A 3SEDA 4N6NB 1IV7A 5AEUB 3G713 1IVVA 3BNCA 3SXXA 3EBTA 3CU3A 1UI8A 3OWSA 4XDWA 2R4IA 1S723 3FH1A 2V1LA 4KFEA 4CDLA 4WWUC 1T5YA 1VQP3 3E99A 1N8QA 1WNHA 3EE1A 3FKAA 4HYZA 3EBYA 3HZPA 1GD4A 1OHPA 4U13A 1O7PB 1O7WB 4K90B 4EXRA 5IG4A 1Q824 3CXC2 2XEPA 3K5TA 3UNLA 2HMNB 1ROVA 1A67A 3Q90A 1US1A 4EV5A 1TIJA 1K28A 1N5PA 3CCJ3 1JB5A 4K61A 3CCV3 3KN4A 2CFWA 1A2VA 2BHMA 4I4KA 1K8A4 5CK6A 3OW22 3LT8A 3PZWA 3JUNA 2FXTA 2BMOB 2XGNA 5D83A 3NHXA 3H3HA 5AIIA 1BUQA 1JB4A 4XBYA 1STFI 3PS8A 5LC7A 3GZXB 1WQLB 3DGNA 2XGLA 2P0XA 4R9KA 1E97A 2M7OA 1VQM3 4FCJA 2MF7A 1TFKA 5AYSC 2F99A 2BMQB 4N6UA 5DREA 1Y4KA 3CPW2 1A90A 3MKIA 1Q40B 3BB9A 1STDA 1CQSA 4CCVA 1CEWI 2CFLA 1W01A 3NBBA 4EC6A 4HM1B 4MMXB 2W6JH 4KZ1A 1GD3A 5AIFA 3VF1A 3O8YA 1EA2A 2YFJB 3I563 2HMMB 3ALAA 1KQS2 3EX9A 4LZIA 4L7KA 3DZLA 3FG3A 5A0OB 1WMNA 3PCSA 2CFDA 2O3OA 3LH4A 2SBLA 2B1XB 4K1UA 2XSOB 4L8OA 2CW9A 2OQEC 5ELJA 3WOEB 2ZL8A 2IUJA 1FA3A 3DGMA 3GAXA 2YFIB 1OH0A 1TUHA 4R4KA 3RGAA 1ULIB 3CC73 3GRDA 5AIGA 4FCMA 3CCR3 5FW5A 3LTCA 4FMDA 7STDA 1Q7Y4 3H51A 4QWTA 3I553 1YGEA 2Z76A 4NREA 5IENA 1OHSA 2STDA 1N9JA 2I9WA 4N6OB 2C11A 1TFOA 1FGQA 4OK0A 1YJN3 1FGTA 4HKVB 3FCSB 3GZBA 1N8R4 3B7CA 3EN8A 2D42A 2F98A 2E2VA 2ZDJA 2W03A 2WOHA 3CCM3 1RN7A 3F40A 1OF5A 3QK9A 3DGLA 4O2HA 4OUQA 4RNYA 3KE7A 3PYJA 2GU3A 2HMOB 3TDGA 3ECFA 3OWUA 3HX8A 2IA7A 3IPTA 4J8TA 1W6GA 5IG3A 3F7SA 1RKYA 3S5CA 1JRQA 4AKYA 3EHCA 2A15A 4LSOA 2CC3A 3OXAA 5CLKA 2D1WA 2XF3A 4FCZA 1GS3A 1TP6A 2OOVC 1MOLA 2WGQA 1C7HA 2E2UA 3UB1A 3JUMA 4RZMA 2PNCA 1O7MB 1UUWB 3BLZA 1NB5I 2CKFB 3Q2PA 3MSOA 4RNZA 3SOAA 4O3VA 3CC43 1NDOB 4HM6B 1PFPA 1ASKA 2QEX3 1VQ93 4MJDA 5AIHA 2HMKB 1E3RA 4HZ9B 1IDPA 3OX9A 1FGOA 2XFTA 1K41A 3DMCA 3PGBA 1SIHA 1RRHA 1NWWA 8CHOA 5IEOA 1M9GA 1L5GB 1HU9A 4R80A 2GU1A 2BT3A 5KP3A 3SLUA 4MMYB 4BTXA 2XH9A 4LGQA 3K0ZA 3EB8A 4R1KA 2Q07A 3EC9A 2W9PA 1FGMA 1ULJB 3AMOB 1W7CA 2WO0A 1Q40A 3MG3A 3SOYA 2CK3H 4HM3B 2GBWB 2GXFA 3Q1CA 3M8CA 1RJOA 2P05A 2YX9A 4HM2B 3CMA3 3WA2X 4HZBB 5IG5A 1D6YA 2PZVA 3K9MC 5IG0A 2OWPA 5HGRA 1IV9A 1FGRA 3BNEA 3CCE3 2RSXA 1EKMA 2IMJA 5LC6A 2W56A 1SPUA 4IPBA 5EEOA 1OPYA 1WMOA 3LYGA 3VSYA 1GYBA 3OWYA 3S29A 1M1XB 1QMAA 3DXOA 4HM0B 4O02B 3V98A 4H61A 1PU4A 1KWIA 3D3LA 2BO9B 5JPUA 2GBXB 3K7CA 3WA3A 1FUWA 3NM2A 3VGNA 5AEWB 1NO3A 3HIIA 4XB5A 3PCRA 2P0MA 2WGOA 3F9SA 5IW9A 1E3VA 3MYTA 3OV4A 1VQK3 1VQO3 2LYXA 3DY5A 3X3YA 2GEYA 4BTYA 3X3ZA 4G1MB 1RRLA 1W4NA 1A2KA 1R4CA 2W04A 3JUQA 2W56B 1LXEA 1U8CB 2BMRB 1UUVB 4XDVA 4EYCA 1W2ZA 3NBRA 1EG9B 5D81A 3EJVA 1QJGA 3MWZA 1VQ73 5AI1A 3N9HA 1LNHA 2HMLB 3MG1A 2RCDA 1O7NB 4RBNA 4ORLA 1K9M4 1JN5B 3NUVA 3LT9A 3F8HA 3QRDA 3LOYA 1AVLA 1QAKA 3NXJA 3F8XA 3HK4A 1O7HB 1YIT3 3PXMA 3LTAA 1GY7A 1ZX2A 1OCVA 1D6UA 3SX1A 2UX0A 1JKGB 4R9LA 3LTDA 2Y74A 4BTWA 2CG0A 3NX0A 4XBTA 4X2HA 3T8NA 4HVNA 2Z6BA 1IT8A 3JUOA 5EQLA 4EBGA 2CFKA 3I0YA 2B24B 3MHEA 1OGXA 1M1K4 4GL6A 2OTL3 4AKZA 4AEQA 1ISKA 1OACA 3G8ZA 3S27A 4WYKA 1QAFA 4IIAA 4J9AA 3A76A 3AMOA 3LZAA 1NB3I 5KP4A 4H3UA 1YIJ3 4KVHA 2XRXB 1HKXA 2FNQA 3B4OA 4JF8A 2RGQA 3CNMA 2KCDA 3KFQC 1N5HA 3WODG 3X42A 1W02A 1LVNA 4FMAA 3KSPA 1W00A 3ER7A 1F8NA 3UJMA 1Q864 2JQ5A 3X41A 2F86B 3G16A 5G2GA 3DUKA 1N9EA 5STDA 2CWTA 1J2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0O B;  3KSE D;  4N6L A;  2O9U X;  3LH4 A;  5ELJ A;  1DVC A;  3L0R A;  1FA3 A;  5ELU A;  3GAX A;  4N6M A;  1KWI A;  4TX4 A;  2BO9 B;  1FUW A;  2W9Q A;  1CYV A;  1N9J A;  1ROA A;  4N6V 0;  4N6O B;  3UL5 A;  3SVA A;  1R4C A;  1LXE A;  2CH9 A;  4EYC A;  1RN7 A;  3UL6 A;  1G96 A;  3MWZ A;  3PYJ A;  4N6T A;  4N6N B;  1IV7 A;  4ZM8 A;  3QRD A;  3S67 A;  1MOL A;  3PXM A;  1WNH A;  1EQK A;  1GD4 A;  1NB5 I;  3Q2P A;  4IT7 A;  3NX0 A;  1PFP A;  1A67 A;  5EQL A;  1TIJ A;  1N5P A;  2OCT A;  1CYU A;  3IMA B;  1M9G A;  1DVD A;  1MNL A;  1STF I;  2KXG A;  1NB3 I;  3PS8 A;  5LC7 A;  2W9P A;  4N6U A;  1A90 A;  3KFQ C;  1N5H A;  4CCV A;  1CEW I;  3K9M C;  1YVB I;  1IV9 A;  1GD3 A;  4LZI A;  5LC6 A; 
#chains in the Genus database with same CATH topology
 1ZGX A;  3KSE D;  4N6L A;  1O7G B;  3JVC A;  2LQV A;  2O9U X;  3F14 A;  3KKG A;  1AR0 A;  1DVC A;  2CWU A;  1IVU A;  1S5A A;  1GY5 A;  4WYK B;  4KFD A;  1BGS A;  3L0R A;  1AVK A;  5ELU A;  5CF2 A;  3CCS 3;  3CPO A;  2KRT A;  1YJW 3;  4LYL B;  2JDI H;  4N6M A;  4HM8 B;  4HM7 B;  1SJW A;  4TX4 A;  3BNB A;  5AYR B;  1LOX A;  2K54 A;  3AGN A;  2ML6 A;  3B8L A;  3V92 A;  1FUT A;  5BVB A;  3V99 A;  3DM8 A;  1B20 A;  4NHF A;  4HM5 B;  1CYV A;  1GOV A;  1RLS A;  3LXU X;  3ZG0 A;  3BND A;  2CFG A;  1NJI 4;  2QIY A;  1VZZ A;  5CXO A;  3UL5 A;  1MGR A;  3ZG5 A;  3GZR A;  1M90 4;  5D82 A;  1JJ2 2;  4O8S A;  1I3I A;  3FG1 A;  3RGR A;  3FZW A;  1TU5 A;  1G02 A;  4Q53 A;  1VQL 3;  2P09 A;  3DH2 A;  1W6C A;  3UL6 A;  4FMC A;  2OTJ 3;  4JRF A;  4WFO A;  4WP5 A;  1DMM A;  1G96 A;  2KAA A;  1JN5 A;  1NNV A;  5EVH A;  1GSP A;  3NV0 A;  4RNT A;  1DMN A;  1QAL A;  1OGZ A;  1MGW A;  2KF6 A;  2QGU A;  4ZM8 A;  1YJ9 3;  1VQ5 3;  1R4Y A;  3S67 A;  2CWT A;  3T8U A;  3FSD A;  1Q81 4;  1GMP A;  4XBX A;  4WHA A;  3NBJ A;  3G0K A;  1RGC A;  3D9R A;  3MPH A;  2MC8 A;  3K63 A;  3CME 3;  1LOV A;  1JKG A;  3FGY A;  3RDE A;  3EN1 B;  3GZY B;  5M19 A;  1EQK A;  2HMJ B;  2WOF A;  3STD A;  1D6Z A;  1JBR A;  3N54 B;  1JNQ A;  1HZ1 A;  1UI7 A;  2KF4 A;  2L4V A;  4MMZ B;  3SYU A;  1VQN 3;  3GWR A;  4FR9 A;  5IER A;  2QA4 3;  1VQ4 3;  4IT7 A;  1YGW A;  5FGO A;  2E2T A;  2J8X B;  1GY6 A;  1WTH A;  2CHC A;  3J7Y d;  1UUG B;  5TGN A;  2XFS A;  3S28 A;  1YHQ 3;  4FMB A;  1IT7 A;  2CG1 A;  2OCT A;  1QVG 2;  3B4P A;  2OQE A;  1CYU A;  1W6Y A;  1DYU A;  4J5K A;  2Z77 A;  3WDG B;  3NV0 B;  1BSD A;  3IMA B;  5IF6 A;  1V57 A;  1DVD A;  3CCU 3;  1W5Z A;  1RNB A;  1EEJ A;  4L8P A;  1KC8 4;  1RN1 A;  2K0M A;  1BNI A;  3DGO A;  4OVM A;  1MNL A;  2GEX A;  2XSH B;  3HI7 A;  3KII A;  1W2B 2;  3IJE B;  2KXG A;  2KF5 A;  3KZT A;  4HBR A;  2P38 A;  2R41 A;  4N3V A;  1B2M A;  3FF0 A;  3X3X A;  1U5O A;  3CD6 3;  3LTB A;  1QVF 2;  1IU7 A;  3N8B A;  3X40 A;  1BRN L;  1VQ6 3;  1I0X A;  1SQW A;  3BU4 A;  1VQ8 3;  3JUP A;  2CWV A;  1BAN A;  1LOY A;  2CIU A;  2W0Q A;  3URP A;  5RNT A;  5BXQ A;  1YVB I;  3D4A A;  1JV2 B;  1IVW A;  3U97 A;  1WMP A;  2BNG A;  4X2O A;  4GB5 A;  5JBS A;  1NU3 A;  1UW1 A;  3WOF B;  3GSP A;  3CC2 3;  1IVX A;  3NQZ A;  1IQ8 A;  3U1W A;  1Z1S A;  2Z7A A;  3NM7 A;  2W2C A;  1V74 A;  3EQQ B;  4HJL B;  1OHO A;  4XM4 A;  4GHO A;  4STD A;  1IQY A;  1BNF A;  3MG2 A;  2RFR A;  3NQY A;  1MWR A;  1SII A;  1IK3 A;  1K73 4;  1UGI A;  2C10 A;  2XR8 B;  1Q7H A;  5HOH A;  3G4S 3;  3EF8 A;  3G6E 3;  4LEH A;  4NPB A;  4HM4 B;  1KD1 4;  4HAA A;  1KSI A;  3T0U A;  3CCQ 3;  4PEJ A;  1PYL A;  4EV2 A;  3F7X A;  2K3D A;  3FG4 A;  3Q3F A;  5IEP A;  4I5Q A;  2OOV A;  3FLJ A;  1YNV X;  2W9Q A;  5CF1 A;  3LML A;  3CCL 3;  2ML5 A;  5DRV A;  1G0T A;  1BNJ A;  2INX A;  1ROA A;  4N6V 0;  4LMI A;  1IQX A;  1OUN A;  3FF2 A;  1TRQ A;  3KCH A;  1AV4 A;  1LQG C;  6STD A;  3SVA A;  4K1V A;  3CNX A;  1JB2 A;  2H0G A;  3HIG A;  1DMQ A;  4MEI A;  4KFF A;  5G1L A;  1YI2 3;  1RGE A;  2CH9 A;  1LRA A;  1Q42 A;  2FGT A;  2YFL B;  1JBT A;  5I97 A;  2IUK A;  1X1X A;  1B21 A;  3ROB A;  1OF5 B;  3WMD A;  3AHW A;  5JPP A;  1ZO2 A;  5BIR A;  4N6T A;  5KP1 A;  3D5I A;  2Y73 A;  3SED A;  1I3F A;  4N6N B;  1CH0 A;  1IV7 A;  6GSP A;  5AEU B;  1LNI A;  3G71 3;  1IVV A;  3BNC A;  3SXX A;  3EBT A;  3CU3 A;  1UI8 A;  3OWS A;  4XDW A;  1T3B A;  2R4I A;  1S72 3;  3FH1 A;  2V1L A;  4KFE A;  3BIR A;  4WWU C;  4CDL A;  1T5Y A;  1VQP 3;  3E99 A;  7RNT A;  1N8Q A;  1WNH A;  3EE1 A;  3FKA A;  4HYZ A;  1BU4 A;  3EBY A;  3HZP A;  1GD4 A;  2BIR A;  1BAO A;  4BIR A;  1A2P A;  1OHP A;  4U13 A;  1O7P B;  1O7W B;  1BNR A;  1GOY A;  3WR2 A;  4K90 B;  4EXR A;  3HOH A;  5IG4 A;  1Q82 4;  3CXC 2;  1UCJ A;  2XEP A;  3K5T A;  1YVS A;  3UNL A;  2HMN B;  1ROV A;  1FZU A;  1A67 A;  3Q90 A;  1US1 A;  1ZS7 A;  2F5M A;  3D79 A;  1TIJ A;  4EV5 A;  1K28 A;  1BRK A;  1N5P A;  1JB5 A;  4K61 A;  1BSE A;  3CCJ 3;  3CCV 3;  3KN4 A;  2CFW A;  1A2V A;  2BHM A;  2KF3 A;  4I4K A;  1X1Y A;  5CK6 A;  3OW2 2;  3LT8 A;  3PZW A;  1K8A 4;  3JUN A;  2FXT A;  2BMO B;  2XGN A;  5D83 A;  5M18 A;  2IYJ A;  3NHX A;  3H3H A;  5AII A;  1BUQ A;  1JB4 A;  4XBY A;  1STF I;  3A5E A;  3PS8 A;  5LC7 A;  3GZX B;  1WQL B;  3DGN A;  2XGL A;  2P0X A;  4R9K A;  1E97 A;  2M7O A;  1DE3 A;  1RDS A;  4FCJ A;  2MF7 A;  1VQM 3;  2L1S A;  1JBS A;  1TFK A;  5AYS C;  2F99 A;  2BMQ B;  4N6U A;  5DRE A;  1Y4K A;  3CPW 2;  1A90 A;  3MKI A;  1Q40 B;  3BB9 A;  1STD A;  2RNT A;  1CQS A;  4CCV A;  1CEW I;  2CFL A;  1EUI C;  4BL2 A;  1W01 A;  3NBB A;  4EC6 A;  4HM1 B;  4MMX B;  2W6J H;  4KZ1 A;  1GD3 A;  5AIF A;  3VF1 A;  3O8Y A;  1EA2 A;  2YFJ B;  3I56 3;  2HMM B;  3ALA A;  1KQS 2;  3EX9 A;  4LZI A;  4L7K A;  1BRG A;  3DZL A;  3FG3 A;  6RNT A;  5A0O B;  1WMN A;  3PCS A;  2CFD A;  1GMQ A;  2O3O A;  3LH4 A;  2SBL A;  2B1X B;  4K1U A;  2XSO B;  4L8O A;  1BSB A;  2CW9 A;  2OQE C;  5ELJ A;  3WOE B;  2ZL8 A;  5GSP A;  2IUJ A;  1FA3 A;  3DGM A;  1RMS A;  3GAX A;  2YFI B;  1OH0 A;  1TUH A;  1I8V A;  4R4K A;  1ULI B;  3RGA A;  1PY3 A;  3CC7 3;  3GRD A;  5AIG A;  4FCM A;  3CCR 3;  5FW5 A;  3LTC A;  4FMD A;  1B2S A;  7STD A;  1Q7Y 4;  1I0V A;  3H51 A;  4QWT A;  3I55 3;  1YGE A;  4GSP A;  2Z76 A;  4NRE A;  5IEN A;  1OHS A;  1Q9E A;  3AGO A;  2STD A;  1N9J A;  2I9W A;  4N6O B;  1X1U A;  1MWS A;  1BUJ A;  7GSP A;  2C11 A;  1TFO A;  1FGQ A;  4OK0 A;  1YJN 3;  1FGT A;  4HKV B;  3FCS B;  3GZB A;  1N8R 4;  3B7C A;  1MWU A;  3EN8 A;  2D42 A;  2F98 A;  2E2V A;  2ZDJ A;  2W03 A;  2WOH A;  3CCM 3;  1RN7 A;  3F40 A;  1RTU A;  1OF5 A;  1SAR A;  3QK9 A;  3DGL A;  4O2H A;  4OUQ A;  4RNY A;  3AHS A;  3KE7 A;  8RNT A;  3PYJ A;  1GMR A;  2GU3 A;  2HMO B;  2UUG C;  3TDG A;  2CX1 A;  3ECF A;  3OWU A;  3HX8 A;  2IA7 A;  3IPT A;  4J8T A;  1W6G A;  5IG3 A;  3F7S A;  1RKY A;  3S5C A;  1UDI I;  2IY2 A;  1JRQ A;  4AKY A;  3EHC A;  2A15 A;  4LSO A;  2CC3 A;  3OXA A;  5CLK A;  2D1W A;  2XF3 A;  4FCZ A;  1GS3 A;  5M1A A;  1RSN A;  1TP6 A;  5G1K A;  2OOV C;  1MWT A;  1MOL A;  2WGQ A;  1C7H A;  2E2U A;  1DET A;  4CJN A;  1BSA A;  3UB1 A;  3JUM A;  4RZM A;  1RHL A;  2PNC A;  1O7M B;  1UUW B;  1AY7 A;  3BLZ A;  1C54 A;  2BU4 A;  1NB5 I;  2CKF B;  3Q2P A;  3MSO A;  4RNZ A;  3SOA A;  4O3V A;  1T2H A;  3CC4 3;  1NDO B;  4HM6 B;  1RNT A;  1PFP A;  1ASK A;  2QEX 3;  1FYS A;  1VQ9 3;  4MJD A;  5AIH A;  2HMK B;  1E3R A;  1TJD A;  2GSP A;  1IDP A;  4HZ9 B;  3OX9 A;  1B2U A;  1FGO A;  2XFT A;  1K41 A;  3DMC A;  1B2Z A;  3PGB A;  1LQM B;  1SIH A;  1RRH A;  1NWW A;  4J5G A;  8CHO A;  5IEO A;  1M9G A;  1L5G B;  1HU9 A;  4R80 A;  2GU1 A;  2BT3 A;  5KP3 A;  3SLU A;  4MMY B;  4BTX A;  2XH9 A;  4LGQ A;  3K0Z A;  1RN4 A;  3EB8 A;  4R1K A;  2Q07 A;  2ZA4 A;  3EC9 A;  2W9P A;  1FGM A;  3ZFZ A;  1ULJ B;  3AMO B;  1RGK A;  1I70 A;  1W7C A;  2WO0 A;  1Q40 A;  1BNE A;  3MG3 A;  3SOY A;  2CK3 H;  4HM3 B;  2GBW B;  2GXF A;  4BL3 A;  3Q1C A;  3M8C A;  1RJO A;  2P05 A;  2YX9 A;  4HM2 B;  1B27 A;  3CMA 3;  3WA2 X;  4HZB B;  5IG5 A;  1D6Y A;  2PZV A;  3K9M C;  5IG0 A;  2OWP A;  5HGR A;  1IV9 A;  1FGR A;  3BNE A;  3CCE 3;  2RSX A;  1EKM A;  2IMJ A;  5LC6 A;  2W56 A;  1SPU A;  1BNS A;  4IPB A;  5EEO A;  1I2G A;  1OPY A;  1WMO A;  3LYG A;  3VSY A;  1GYB A;  1UCL A;  3OWY A;  3S29 A;  1M1X B;  1QMA A;  1TTO A;  1IYY A;  3DXO A;  4HM0 B;  4O02 B;  3V98 A;  1RGG A;  4H61 A;  2ZHX B;  1KWI A;  1PU4 A;  3D3L A;  2BO9 B;  1I2E A;  5JPU A;  1BIR A;  1I2F A;  2GBX B;  3DGY A;  3K7C A;  4KT3 B;  3WA3 A;  1FUW A;  3NM2 A;  3VGN A;  5AEW B;  1NO3 A;  1RGL A;  3HII A;  4XB5 A;  3PCR A;  2P0M A;  1RCL A;  4CPK A;  2WGO A;  3F9S A;  5IW9 A;  1E3V A;  3MYT A;  2F56 A;  3OV4 A;  2AAD A;  1VQK 3;  1VQO 3;  1RCK A;  2LYX A;  1LOW A;  3DY5 A;  2GEY A;  3X3Y A;  4BTY A;  3X3Z A;  4G1M B;  1FUS A;  1RRL A;  1UGH I;  1W4N A;  1BVI A;  1A2K A;  1R4C A;  2W04 A;  3JUQ A;  2W56 B;  1LXE A;  1U8C B;  2BMR B;  1UUV B;  4XDV A;  4EYC A;  1W2Z A;  2C4B A;  1T2I A;  3NBR A;  1EG9 B;  2F4Y A;  5D81 A;  3EJV A;  1QJG A;  3D5G A;  3MWZ A;  1VQ7 3;  5AI1 A;  3N9H A;  1LNH A;  2HML B;  3MG1 A;  2RCD A;  1O7N B;  4RBN A;  4DKI A;  4ORL A;  1K9M 4;  1X1W A;  1JN5 B;  1TRP A;  3NUV A;  1HYF A;  3LT9 A;  3F8H A;  3QRD A;  3LOY A;  1AVL A;  1QAK A;  3NXJ A;  4HOH A;  1V58 A;  2HOH A;  2SAR A;  3F8X A;  1O7H B;  3HK4 A;  3RNT A;  1YIT 3;  2UGI A;  3LTA A;  3PXM A;  1GY7 A;  1ZX2 A;  2H0I A;  1GOU A;  1OCV A;  1D6U A;  3SX1 A;  2UX0 A;  1JKG B;  4R9L A;  3LTD A;  2Y74 A;  4BTW A;  2CG0 A;  3NX0 A;  4XBT A;  4X2H A;  4BU4 A;  1JZO A;  3T8N A;  2AAE A;  5BU4 A;  4HVN A;  1BRH A;  2Z6B A;  1BOX A;  1IT8 A;  3JUO A;  5EQL A;  4EBG A;  2CFK A;  1RGA A;  3I0Y A;  2B24 B;  3MHE A;  1OGX A;  1M1K 4;  4GL6 A;  2OTL 3;  4ILF A;  3WHO A;  1VQQ A;  1RGH A;  4AKZ A;  2CX0 A;  4AEQ A;  1OAC A;  3G8Z A;  1ISK A;  3S27 A;  2F5W A;  1QAF A;  4WYK A;  4IIA A;  1BRJ A;  1FW7 A;  4J9A A;  1B2X A;  3A76 A;  3AMO A;  3LZA A;  4EW5 A;  1NB3 I;  9RNT A;  5KP4 A;  2RBI A;  4H3U A;  1YIJ 3;  4KVH A;  2XRX B;  1HKX A;  2FNQ A;  3B4O A;  4JF8 A;  1BNG A;  2RGQ A;  3CNM A;  2KCD A;  3KFQ C;  1BRS A;  1BRI A;  1N5H A;  1B3S A;  3WOD G;  3X42 A;  1W02 A;  1LVN A;  1AQZ A;  4FMA A;  1BSC A;  3KSP A;  1JZD A;  1W00 A;  3ER7 A;  1F8N A;  3UJM A;  1UCI A;  1UCK A;  2JQ5 A;  1Q86 4;  3X41 A;  2F86 B;  3G16 A;  2H0H A;  3DUK A;  5G2G A;  1N9E A;  5STD A;  1RGF A;  1J2B A; 
#chains in the Genus database with same CATH homology
 3KSE D;  4N6L A;  1O7G B;  3JVC A;  2LQV A;  2O9U X;  3F14 A;  3KKG A;  1AR0 A;  1DVC A;  2CWU A;  1IVU A;  1S5A A;  1GY5 A;  4WYK B;  4KFD A;  3L0R A;  5CF2 A;  1AVK A;  5ELU A;  3CCS 3;  1YJW 3;  3CPO A;  2KRT A;  2JDI H;  4N6M A;  4HM8 B;  4HM7 B;  1SJW A;  4TX4 A;  3BNB A;  5AYR B;  1LOX A;  2K54 A;  2ML6 A;  3B8L A;  3V92 A;  5BVB A;  3V99 A;  3DM8 A;  4NHF A;  4HM5 B;  1CYV A;  3LXU X;  3BND A;  2CFG A;  1NJI 4;  2QIY A;  1VZZ A;  5CXO A;  3UL5 A;  3GZR A;  1M90 4;  5D82 A;  1JJ2 2;  4O8S A;  3FG1 A;  3RGR A;  3FZW A;  1TU5 A;  4Q53 A;  1VQL 3;  2P09 A;  3UL6 A;  1W6C A;  4FMC A;  2OTJ 3;  4JRF A;  4WFO A;  4WP5 A;  1DMM A;  1G96 A;  1JN5 A;  5EVH A;  3NV0 A;  1DMN A;  1QAL A;  1OGZ A;  2QGU A;  4ZM8 A;  1YJ9 3;  1VQ5 3;  3S67 A;  3T8U A;  1Q81 4;  3FSD A;  4XBX A;  4WHA A;  3NBJ A;  3G0K A;  3D9R A;  3MPH A;  2MC8 A;  3K63 A;  3CME 3;  1JKG A;  3FGY A;  3RDE A;  3EN1 B;  3GZY B;  1EQK A;  2HMJ B;  2WOF A;  3STD A;  1D6Z A;  3N54 B;  1JNQ A;  1UI7 A;  2L4V A;  4MMZ B;  1VQN 3;  3GWR A;  4FR9 A;  5IER A;  2QA4 3;  1VQ4 3;  4IT7 A;  5FGO A;  2E2T A;  3J7Y d;  1GY6 A;  1WTH A;  2CHC A;  5TGN A;  2XFS A;  3S28 A;  1YHQ 3;  4FMB A;  1IT7 A;  2CG1 A;  2OCT A;  1QVG 2;  3B4P A;  2OQE A;  1CYU A;  1W6Y A;  1DYU A;  2Z77 A;  3WDG B;  3NV0 B;  3IMA B;  5IF6 A;  1DVD A;  3CCU 3;  1W5Z A;  4L8P A;  1KC8 4;  2K0M A;  3DGO A;  4OVM A;  1MNL A;  2GEX A;  2XSH B;  3HI7 A;  3KII A;  1W2B 2;  3IJE B;  2KXG A;  4HBR A;  3KZT A;  4N3V A;  2P38 A;  3FF0 A;  3X3X A;  1U5O A;  3CD6 3;  3LTB A;  1QVF 2;  1IU7 A;  3N8B A;  3X40 A;  1VQ6 3;  1SQW A;  1VQ8 3;  3JUP A;  2CWV A;  2CIU A;  2W0Q A;  5BXQ A;  1YVB I;  1JV2 B;  1IVW A;  3U97 A;  1WMP A;  2BNG A;  4X2O A;  4GB5 A;  5JBS A;  1NU3 A;  1UW1 A;  3WOF B;  3CC2 3;  1IVX A;  3NQZ A;  1IQ8 A;  3U1W A;  1Z1S A;  2Z7A A;  3NM7 A;  2W2C A;  1V74 A;  3EQQ B;  4HJL B;  1OHO A;  4XM4 A;  4STD A;  1IQY A;  3MG2 A;  2RFR A;  3NQY A;  1SII A;  1IK3 A;  1K73 4;  2C10 A;  2XR8 B;  3G4S 3;  3G6E 3;  3EF8 A;  4LEH A;  1KD1 4;  4HM4 B;  1KSI A;  3T0U A;  3CCQ 3;  4PEJ A;  4EV2 A;  3F7X A;  3FG4 A;  5IEP A;  2OOV A;  3FLJ A;  2W9Q A;  5CF1 A;  3LML A;  3CCL 3;  2ML5 A;  5DRV A;  2INX A;  1ROA A;  4N6V 0;  4LMI A;  1IQX A;  1OUN A;  3FF2 A;  1AV4 A;  6STD A;  3SVA A;  4K1V A;  3CNX A;  1JB2 A;  3HIG A;  1DMQ A;  4MEI A;  4KFF A;  1YI2 3;  2CH9 A;  1Q42 A;  2FGT A;  2YFL B;  5I97 A;  2IUK A;  3ROB A;  1OF5 B;  3WMD A;  5JPP A;  1ZO2 A;  4N6T A;  5KP1 A;  2Y73 A;  3SED A;  4N6N B;  1IV7 A;  5AEU B;  3G71 3;  1IVV A;  3BNC A;  3SXX A;  3EBT A;  3CU3 A;  1UI8 A;  3OWS A;  4XDW A;  2R4I A;  1S72 3;  3FH1 A;  2V1L A;  4KFE A;  4CDL A;  4WWU C;  1T5Y A;  1VQP 3;  3E99 A;  1N8Q A;  1WNH A;  3EE1 A;  3FKA A;  4HYZ A;  3EBY A;  3HZP A;  1GD4 A;  1OHP A;  4U13 A;  1O7P B;  1O7W B;  4K90 B;  4EXR A;  5IG4 A;  1Q82 4;  3CXC 2;  2XEP A;  3K5T A;  3UNL A;  2HMN B;  1ROV A;  1A67 A;  3Q90 A;  1US1 A;  4EV5 A;  1TIJ A;  1K28 A;  1N5P A;  3CCJ 3;  1JB5 A;  4K61 A;  3CCV 3;  3KN4 A;  2CFW A;  1A2V A;  2BHM A;  4I4K A;  1K8A 4;  5CK6 A;  3OW2 2;  3LT8 A;  3PZW A;  3JUN A;  2FXT A;  2BMO B;  2XGN A;  5D83 A;  3NHX A;  3H3H A;  5AII A;  1BUQ A;  1JB4 A;  4XBY A;  1STF I;  3PS8 A;  5LC7 A;  3GZX B;  1WQL B;  3DGN A;  2XGL A;  2P0X A;  4R9K A;  1E97 A;  2M7O A;  1VQM 3;  4FCJ A;  2MF7 A;  1TFK A;  5AYS C;  2F99 A;  2BMQ B;  4N6U A;  5DRE A;  1Y4K A;  3CPW 2;  1A90 A;  3MKI A;  1Q40 B;  3BB9 A;  1STD A;  1CQS A;  4CCV A;  1CEW I;  2CFL A;  1W01 A;  3NBB A;  4EC6 A;  4HM1 B;  4MMX B;  2W6J H;  4KZ1 A;  1GD3 A;  5AIF A;  3VF1 A;  3O8Y A;  1EA2 A;  2YFJ B;  3I56 3;  2HMM B;  3ALA A;  1KQS 2;  3EX9 A;  4LZI A;  4L7K A;  3DZL A;  3FG3 A;  5A0O B;  1WMN A;  3PCS A;  2CFD A;  2O3O A;  3LH4 A;  2SBL A;  2B1X B;  4K1U A;  2XSO B;  4L8O A;  2CW9 A;  2OQE C;  5ELJ A;  3WOE B;  2ZL8 A;  2IUJ A;  1FA3 A;  3DGM A;  3GAX A;  2YFI B;  1OH0 A;  1TUH A;  4R4K A;  3RGA A;  1ULI B;  3CC7 3;  3GRD A;  5AIG A;  4FCM A;  3CCR 3;  5FW5 A;  3LTC A;  4FMD A;  7STD A;  1Q7Y 4;  3H51 A;  4QWT A;  3I55 3;  1YGE A;  2Z76 A;  4NRE A;  5IEN A;  1OHS A;  2STD A;  1N9J A;  2I9W A;  4N6O B;  2C11 A;  1TFO A;  1FGQ A;  4OK0 A;  1YJN 3;  1FGT A;  4HKV B;  3FCS B;  3GZB A;  1N8R 4;  3B7C A;  3EN8 A;  2D42 A;  2F98 A;  2E2V A;  2ZDJ A;  2W03 A;  2WOH A;  3CCM 3;  1RN7 A;  3F40 A;  1OF5 A;  3QK9 A;  3DGL A;  4O2H A;  4OUQ A;  4RNY A;  3KE7 A;  3PYJ A;  2GU3 A;  2HMO B;  3TDG A;  3ECF A;  3OWU A;  3HX8 A;  2IA7 A;  3IPT A;  4J8T A;  1W6G A;  5IG3 A;  3F7S A;  1RKY A;  3S5C A;  1JRQ A;  4AKY A;  3EHC A;  2A15 A;  4LSO A;  2CC3 A;  3OXA A;  5CLK A;  2D1W A;  2XF3 A;  4FCZ A;  1GS3 A;  1TP6 A;  2OOV C;  1MOL A;  2WGQ A;  1C7H A;  2E2U A;  3UB1 A;  3JUM A;  4RZM A;  2PNC A;  1O7M B;  1UUW B;  3BLZ A;  1NB5 I;  2CKF B;  3Q2P A;  3MSO A;  4RNZ A;  3SOA A;  4O3V A;  3CC4 3;  1NDO B;  4HM6 B;  1PFP A;  1ASK A;  2QEX 3;  1VQ9 3;  4MJD A;  5AIH A;  2HMK B;  1E3R A;  4HZ9 B;  1IDP A;  3OX9 A;  1FGO A;  2XFT A;  1K41 A;  3DMC A;  3PGB A;  1SIH A;  1RRH A;  1NWW A;  8CHO A;  5IEO A;  1M9G A;  1L5G B;  1HU9 A;  4R80 A;  2GU1 A;  2BT3 A;  5KP3 A;  3SLU A;  4MMY B;  4BTX A;  2XH9 A;  4LGQ A;  3K0Z A;  3EB8 A;  4R1K A;  2Q07 A;  3EC9 A;  2W9P A;  1FGM A;  1ULJ B;  3AMO B;  1W7C A;  2WO0 A;  1Q40 A;  3MG3 A;  3SOY A;  2CK3 H;  4HM3 B;  2GBW B;  2GXF A;  3Q1C A;  3M8C A;  1RJO A;  2P05 A;  2YX9 A;  4HM2 B;  3CMA 3;  3WA2 X;  4HZB B;  5IG5 A;  1D6Y A;  2PZV A;  3K9M C;  5IG0 A;  2OWP A;  5HGR A;  1IV9 A;  1FGR A;  3BNE A;  3CCE 3;  2RSX A;  1EKM A;  2IMJ A;  5LC6 A;  2W56 A;  1SPU A;  4IPB A;  5EEO A;  1OPY A;  1WMO A;  3LYG A;  3VSY A;  1GYB A;  3OWY A;  3S29 A;  1M1X B;  1QMA A;  3DXO A;  4HM0 B;  4O02 B;  3V98 A;  4H61 A;  1PU4 A;  1KWI A;  3D3L A;  2BO9 B;  5JPU A;  2GBX B;  3K7C A;  3WA3 A;  1FUW A;  3NM2 A;  3VGN A;  5AEW B;  1NO3 A;  3HII A;  4XB5 A;  3PCR A;  2P0M A;  2WGO A;  3F9S A;  5IW9 A;  1E3V A;  3MYT A;  3OV4 A;  1VQK 3;  1VQO 3;  2LYX A;  3DY5 A;  3X3Y A;  2GEY A;  4BTY A;  3X3Z A;  4G1M B;  1RRL A;  1W4N A;  1A2K A;  1R4C A;  2W04 A;  3JUQ A;  2W56 B;  1LXE A;  1U8C B;  2BMR B;  1UUV B;  4XDV A;  4EYC A;  1W2Z A;  3NBR A;  1EG9 B;  5D81 A;  3EJV A;  1QJG A;  3MWZ A;  1VQ7 3;  5AI1 A;  3N9H A;  1LNH A;  2HML B;  3MG1 A;  2RCD A;  1O7N B;  4RBN A;  4ORL A;  1K9M 4;  1JN5 B;  3NUV A;  3LT9 A;  3F8H A;  3QRD A;  3LOY A;  1AVL A;  1QAK A;  3NXJ A;  3F8X A;  3HK4 A;  1O7H B;  1YIT 3;  3PXM A;  3LTA A;  1GY7 A;  1ZX2 A;  1OCV A;  1D6U A;  3SX1 A;  2UX0 A;  1JKG B;  4R9L A;  3LTD A;  2Y74 A;  4BTW A;  2CG0 A;  3NX0 A;  4XBT A;  4X2H A;  3T8N A;  4HVN A;  2Z6B A;  1IT8 A;  3JUO A;  5EQL A;  4EBG A;  2CFK A;  3I0Y A;  2B24 B;  3MHE A;  1OGX A;  1M1K 4;  4GL6 A;  2OTL 3;  4AKZ A;  4AEQ A;  1ISK A;  1OAC A;  3G8Z A;  3S27 A;  4WYK A;  1QAF A;  4IIA A;  4J9A A;  3A76 A;  3AMO A;  3LZA A;  1NB3 I;  5KP4 A;  4H3U A;  1YIJ 3;  4KVH A;  2XRX B;  1HKX A;  2FNQ A;  3B4O A;  4JF8 A;  2RGQ A;  3CNM A;  2KCD A;  3KFQ C;  1N5H A;  3WOD G;  3X42 A;  1W02 A;  1LVN A;  4FMA A;  3KSP A;  1W00 A;  3ER7 A;  1F8N A;  3UJM A;  1Q86 4;  2JQ5 A;  3X41 A;  2F86 B;  3G16 A;  5G2G A;  3DUK A;  1N9E A;  5STD A;  2CWT A;  1J2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...