1GS3A

High resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVENPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAFWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of a Low-Barrier Hydrogen Bond to Catalysis by Delta-5-3-Ketosteroid Isomerase is not Extremely High Compared to that of an Ordinary Hydrogen Bond. Low-Barrier Hydrogen Bond of Pi Ksi
rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2001-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gs3A00
3B8LA 1Z1SA 3LZAA 3Q90A 4HM6B 5IEPA 3OV4A 2YFLB 1JB4A 4STDA 5IG0A 4H3UA 1ZO2A 3F8XA 3FF2A 3G16A 1OH0A 1ULJB 4LMIA 4XBYA 1W6YA 3JUPA 4L8PA 2Z77A 3EHCA 2HMMB 5AEUB 5IERA 2STDA 5DREA 3FLJA 5JPPA 3EC9A 1NU3A 4LGQA 2OWPA 1SJWA 2INXA 2A15A 1W02A 3FH1A 2XRXB 3KKGA 4ORLA 5IEOA 3G8ZA 2HMLB 5CF1A 4J8TA 3JUQA 2QGUA 2UX0A 3OWYA 1EG9B 3DUKA 4HM2B 4HZ9B 3VGNA 5KP4A 1TUHA 3MG1A 2RGQA 3MSOA 4HM1B 3F14A 3B4PA 2YFJB 1W00A 1JKGB 2BMRB 3IPTA 5FW5A 3JUMA 2JQ5A 2HMKB 3D9RA 4KVHA 3UJMA 1O7PB 1GY6A 1S5AA 3SEDA 1E3RA 1ZX2A 2B24B 2GEYA 3A76A 1O7NB 5JPUA 1Q40A 3MYTA 4WYKA 3EQQB 1JN5A 3EBTA 1E97A 4HJLB 1O7HB 1DMMA 3DXOA 3NV0A 5AIGA 3H3HA 2XSOB 3B7CA 3MG2A 3NV0B 1C7HA 1STDA 2PZVA 5CXOA 3MG3A 5D82A 3CNXA 4MJDA 5AIFA 4RZMA 3EX9A 3BLZA 3GZRA 4IIAA 2HMOB 7STDA 1UUWB 5CF2A 4K1VA 4R1KA 2Z76A 3GWRA 3SOYA 2RFRA 1DMQA 2I9WA 3M8CA 5KP3A 1JN5B 5IF6A 3JUNA 3KSPA 1NDOB 1Q40B 3RGAA 5STDA 3RGRA 1OHPA 3K7CA 4N3VA 4FCMA 1OF5A 1U5OA 3MHEA 3CNMA 3F9SA 5IG3A 2GBWB 3E99A 5BVBA 4HM0B 1W01A 1O7MB 3GZXB 2GBXB 2XSHB 3FGYA 4PEJA 2W2CA 3ER7A 5IG5A 3ROBA 5CK6A 1OUNA 5HGRA 2BMQB 1ISKA 1GS3A 3NUVA 3MKIA 3UNLA 4HM4B 3EBYA 2F98A 2XR8B 3DZLA 4XDWA 3B4OA 1IDPA 1ULIB 3F7SA 4OVMA 4XBXA 4L8OA 1GY7A 2Z7AA 1UUVB 3H51A 2F86B 4XBTA 1WQLB 5IENA 3G0KA 1Q42A 3ECFA 1GY5A 3HX8A 3SOAA 1HKXA 2HMNB 2RCDA 3DM8A 3F7XA 2CKFB 3KE7A 4X2HA 3STDA 3CU3A 3T8UA 3F8HA 1VZZA 1O7GB 3NHXA 5AEWB 1ASKA 3OXAA 3LYGA 4HM3B 1OHOA 4Q53A 3JUOA 3HK4A 2R4IA 3KZTA 4J9AA 1GYBA 4L7KA 4U13A 2B1XB 2GXFA 3CPOA 5DRVA 3OX9A 2IMJA 1OCVA 4XM4A 4R9LA 5IG4A 1QMAA 3EJVA 4XDVA 4HM5B 5AIHA 1JB5A 4HVNA 2BMOB 3T8NA 1OF5B 1TP6A 2BNGA 2GEXA 5D83A 4X2OA 3EN1B 5G2GA 5TGNA 1EA2A 3BB9A 1AR0A 5AI1A 4OUQA 3GRDA 1OGXA 4GB5A 3I0YA 3FF0A 4HM7B 4I4KA 4XB5A 5D81A 1OHSA 3GZBA 4HM8B 5CLKA 1E3VA 4WWUC 3OWUA 1CQSA 1QJGA 3WMDA 3NXJA 1DMNA 2K54A 2QIYA 1K41A 3K0ZA 4WYKB 3FZWA 3FSDA 3FKAA 3NBRA 3HZPA 3NM2A 4WP5A 3DMCA 5AIIA 4FCJA 4HKVB 3VSYA 5EVHA 4LEHA 6STDA 1OGZA 3F40A 1OPYA 2HMJB 1JKGA 2YFIB 1BUQA 3OWSA 1JB2A 1NWWA 8CHOA 5BXQA 4HZBB 3EF8A 2CHCA 1O7WB 4K1UA 4R9KA 4CDLA 5KP1A 1A2KA 2F99A 3GZYB 3EN8A 3S5CA
chains in the Genus database with same CATH superfamily
3B8LA 1Z1SA 3S27A 1IV7A 4HM6B 5IEPA 2CW9A 3HOHA 1IQ8A 4H3UA 3G16A 1I2GA 1ULJB 5IERA 1RTUA 3EHCA 3NQYA 4L8PA 3RDEA 1DYUA 1IVXA 5AEUB 3FLJA 1SIHA 1W5ZA 1AVKA 1D6YA 1RMSA 1U8CB 3EC9A 4EC6A 3KKGA 2BIRA 1BRJA 2E2UA 4J8TA 3BNBA 2XF3A 3JUQA 2QGUA 2Z6BA 2UX0A 1UDII 1C54A 2KRTA 1TUHA 3MSOA 2RGQA 3ALAA 3DGMA 3F14A 4N6NB 1B21A 2YFJB 1W00A 1JKGB 7RNTA 1T5YA 2ZHXB 1V74A 1I8VA 1VQK3 1CYUA 4LZIA 1FUWA 1E3RA 3PS8A 4NHFA 1Q40A 1KC84 3EBTA 3DXOA 1VQM3 1Q9EA 1RGCA 5AIGA 3SXXA 1I3FA 3H3HA 4O02B 1IVUA 1STDA 3O8YA 3X3YA 1KD14 3CNXA 2MC8A 5BU4A 1BGSA 2OQEA 5M19A 4R1KA 2RFRA 1BNSA 1DMQA 1SPUA 2IY2A 3M8CA 1JN5B 4JF8A 4MMZB 3KSPA 5KP3A 5IF6A 1NDOB 2LQVA 1DVCA 2W9PA 4EW5A 1F8NA 1OF5A 2CC3A 4CJNA 2KF3A 1WMOA 4KFFA 1RGLA 1AY7A 4BL3A 1SIIA 1W01A 4QWTA 2L1SA 2GBXB 2XSHB 4EBGA 1RN1A 2E2VA 3D4AA 1TFOA 1B2UA 1ZGXA 3ER7A 3N54B 3NX0A 2CFDA 3ROBA 4KT3B 5I97A 1IU7A 3CCU3 3MKIA 4HM4B 5M18A 1AV4A 2F98A 3B4OA 1IDPA 1GOYA 3S67A 1RNTA 4L8OA 2F5MA 3CCS3 2F5WA 2F86B 3G0KA 1BRNL 1GY5A 2CX0A 2P38A 3PXMA 4EV5A 2WOHA 1HKXA 3AHSA 3HIGA 2CG1A 1NB3I 2RCDA 3STDA 1BRIA 3F8HA 5AEWB 3WA3A 1ASKA 1IVWA 2W0QA 1JBSA 3LYGA 4BU4A 6RNTA 3EE1A 3WR2A 1V58A 2JDIH 1YIJ3 1TRQA 3JUOA 3MPHA 4I5QA 3ZG5A 2K3DA 2R4IA 4J9AA 1RRLA 4N6UA 1PFPA 1RGAA 3J7Yd 1PYLA 1MGRA 2IMJA 1STFI 5IG4A 1QMAA 2CIUA 4N6OB 3IMAB 2UGIA 1JB5A 1G02A 1EUIC 1OF5B 1RLSA 5EEOA 1SQWA 3EN1B 4X2OA 1IK3A 1Q864 5G2GA 1K9M4 1D6UA 4DKIA 3Q2PA 2LYXA 4HM7B 1OHSA 5CLKA 4HM8B 3WOEB 1FA3A 4RNTA 2KF6A 4BIRA 1B27A 1BOXA 2K54A 3PZWA 4G1MB 1K41A 4AEQA 1UCIA 3S28A 2OTL3 5ELJA 3NBRA 2P0XA 4NPBA 2KCDA 2HOHA 1VQ83 5EVHA 3CCE3 1N5HA 1JKGA 1UGHI 1JB2A 4TX4A 1RNBA 4K1UA 1O7WB 2XEPA 1SARA 3S5CA 1GOVA 1VQ93 1NO3A 4O8SA 1EQKA 3F8XA 3DGNA 1OH0A 1A90A 3KFQC 3WHOA 3ZG0A 2Z77A 1QAFA 4FMDA 1LOWA 2STDA 3LTBA 2ML6A 1W2B2 1R4CA 1NU3A 2J8XB 3BIRA 3DGYA 1K734 2A15A 1W02A 4ORLA 2ZA4A 3LTAA 3FG3A 5IEOA 2CFGA 1X1YA 1QVG2 3QRDA 3S29A 1M1K4 5KP4A 3DUKA 4HM2B 4HZ9B 3MG1A 4NREA 3UB1A 1LRAA 3K5TA 3B4PA 1BRHA 5FW5A 2BMRB 4RBNA 3ZFZA 2HMKB 3UL6A 1IT7A 3X3XA 3D9RA 2CWVA 4KVHA 3SEDA 1BSEA 1ZX2A 1M1XB 4HAAA 2K0MA 1US1A 3MYTA 3TDGA 4LYLB 1B2MA 1NNVA 1O7HB 1UCKA 3NV0A 3CC73 2CX1A 2D42A 3T0UA 5G1LA 3KCHA 1VQO3 4BTWA 4HYZA 1RN7A 2CFLA 3BLZA 2OOVA 3U1WA 2HMOB 7STDA 1UUWB 5RNTA 1NJI4 2YX9A 3Q1CA 3SOYA 2Z76A 3KIIA 4EXRA 2I9WA 1YNVX 3JUNA 1YJN3 5STDA 3RGRA 4BTXA 2OQEC 1LQMB 2C10A 5IG3A 1RGGA 2CK3H 2GBWB 4FCZA 3CME3 3CC43 3LTDA 3HIIA 4FMAA 3V92A 1KSIA 5EQLA 3IJEB 1ISKA 1FUSA 1FGMA 2W6JH 5CK6A 1MWSA 3PYJA 2XR8B 1PU4A 1ULIB 4EYCA 3F7SA 1KQS2 2Z7AA 5IENA 1Q42A 1TTOA 4KFEA 3NM7A 3G6E3 3DM8A 3T8UA 1AQZA 3CU3A 3SX1A 3L0RA 1LQGC 3PGBA 5LC7A 1DETA 2CWTA 8RNTA 2IYJA 1JBRA 5FGOA 1N8R4 3HK4A 1JV2B 1GYBA 4U13A 1TRPA 1RCLA 1D6ZA 4JRFA 1B2ZA 3CPOA 1FZUA 3VF1A 1RDSA 3OX9A 1I2EA 2FXTA 1QALA 2GU1A 3KSED 3PCRA 1MOLA 3EJVA 5AIHA 4HVNA 2BMOB 3SLUA 2BNGA 3NBBA 1CYVA 1UI8A 3N8BA 2AAEA 3LXUX 1EA2A 3BB9A 1AR0A 4AKYA 4HBRA 1IYYA 5AI1A 4XB5A 1CH0A 4I4KA 3FF0A 1TJDA 2XFTA 5D81A 3WMDA 3GZBA 5LC6A 1E3VA 4WWUC 1CQSA 1QJGA 1IVVA 3U97A 1DMNA 1EKMA 4WHAA 1YGWA 3FZWA 3FSDA 3NM2A 1YVBI 5M1AA 3VSYA 2RBIA 4N6V0 1JBTA 3CC23 1LXEA 3OWSA 3CCJ3 4R9KA 4ZM8A 1B20A 1BNEA 2FGTA 5KP1A 2F99A 2CWUA 2KXGA 3GZYB 3X40A 3LT8A 1MWRA 3LZAA 1RSNA 4R80A 1HU9A 1JZDA 3OV4A 2YFLB 1JB4A 4STDA 5BIRA 5DREA 1ZO2A 3FF2A 4XBYA 3CCV3 1AVLA 1BAOA 3JUPA 1W6GA 1BU4A 1R4YA 1BRKA 1ROAA 1A2VA 1FGOA 1I3IA 2GSPA 4FMBA 3G713 2OWPA 1RGHA 2INXA 3FH1A 2XRXB 1JNQA 2D1WA 3G8ZA 2HMLB 5CF1A 1VQN3 1Q814 1HZ1A 2PNCA 3OWYA 1EG9B 3VGNA 1OACA 1T3BA 4FMCA 4KZ1A 1TIJA 3OW22 1W7CA 1W6CA 4K90B 1A67A 1BNGA 1VQP3 1BSBA 3UJMA 2B24B 2GEYA 4O3VA 3A5EA 5JPUA 2L4VA 1FW7A 1EEJA 1BSAA 2WGOA 1X1XA 3EQQB 4IPBA 3G4S3 1ROVA 2H0HA 1E97A 4HJLB 1GMQA 2XH9A 3EB8A 1JJ22 2V1LA 2XSOB 3B7CA 5D82A 3WODG 1C7HA 1LOVA 2PZVA 5CXOA 3MG3A 1IQXA 4MJDA 4RZMA 3EX9A 3GZRA 1CEWI 2CH9A 2RNTA 1JZOA 1KWIA 1N9JA 1Q40B 4K61A 3RGAA 1GD3A 3K7CA 1I0VA 3SVAA 2W04A 3MHEA 4OK0A 3CNMA 1RRHA 3PCSA 1FYSA 3V99A 2BO9B 3RNTA 1O7MB 3BNEA 3GZXB 3K63A 4LSOA 3N9HA 9RNTA 2WO0A 4PEJA 2Q07A 2P09A 5HGRA 3NQZA 1B2SA 2F4YA 2O9UX 3GAXA 3NUVA 3UNLA 4N6TA 3EBYA 1GOUA 4OVMA 4O2HA 3WOFB 3D5IA 1T2IA 1UUVB 3H51A 4XBTA 1A2PA 1WQLB 3X42A 1FGTA 4GL6A 3HX8A 3SOAA 1UUGB 4BTYA 3DGLA 4ILFA 3CD63 3F7XA 4X2HA 1W2ZA 1MNLA 5ELUA 1Q7Y4 1VZZA 3NHXA 1UCLA 3LMLA 3I563 1TU5A 6GSPA 2CFWA 4FR9A 4HM3B 1G0TA 2ML5A 4MMYB 2BHMA 1OHOA 2W9QA 3X41A 4BL2A 3CCQ3 3DH2A 7GSPA 1VQ73 3JVCA 2B1XB 4CCVA 3CXC2 3AMOA 3CCR3 2OCTA 1Q7HA 4GHOA 1L5GB 4XM4A 1T2HA 3MWZA 4HM5B 3LTCA 3T8NA 1UCJA 2GEXA 3CCM3 4EV2A 5TGNA 1YVSA 2F56A 1RJOA 2H0GA 1FUTA 1LOXA 4GB5A 3CMA3 1M9GA 3I0YA 5GSPA 2RSXA 1VQ53 1N9EA 3NXJA 1W4NA 2FNQA 3DGOA 1VQ43 1BANA 1GMRA 1V57A 1WMNA 3K0ZA 4WYKB 3QK9A 3HZPA 3D3LA 3DMCA 5AIIA 3WDGB 1IT8A 1B2XA 1MGWA 1HYFA 1OGZA 2XGNA 3F40A 4MMXB 1GSPA 1RGKA 2YFIB 3FCSB 1NWWA 8CHOA 3EF8A 3Q3FA 1YI23 2AADA 1VQL3 4MEIA 3EN8A 4J5KA 3Q90A 4CPKA 3HI7A 5IW9A 5IG0A 2C11A 1M904 4LMIA 2O3OA 1W6YA 1BNJA 1GD4A 4KFDA 2HMMB 4RNYA 1N5PA 1BUJA 3CCL3 5JPPA 1N8QA 4LGQA 1UI7A 3LT9A 1SJWA 6STDA 3BNDA 3LH4A 1VQQA 1YJ93 1WNHA 3D5GA 4N6MA 5HOHA 3I553 3DY5A 2C4BA 3BU4A 4HOHA 1S723 2E2TA 3V98A 1BNRA 1LNHA 2KAAA 4HM1B 2W56A 5IG5A 2Y74A 3IPTA 1RGFA 2W56B 1RKYA 3JUMA 2JQ5A 1I2FA 1I70A 1BVIA 1O7PB 1GY6A 1S5AA 2OOVC 3A76A 1O7NB 3K9MC 4WYKA 1LVNA 1JN5A 1DMMA 4RNZA 3MG2A 2KF5A 3NV0B 1BSCA 2UUGC 2IUJA 1BNIA 2KF4A 5AIFA 2CFKA 1MWUA 2H0IA 1K28A 4IIAA 3CPW2 5CF2A 1WMPA 4K1VA 1G96A 3GWRA 2WOFA 4GSPA 2CG0A 1OHPA 4N3VA 4FCMA 2MF7A 1U5OA 3FG4A 1RN4A 1UGIA 3AGOA 3F9SA 3AMOB 3E99A 1QAKA 1LNIA 3WA2X 5BVBA 4HM0B 2ZL8A 3UL5A 1QVF2 3D79A 2M7OA 1I0XA 2IA7A 2WGQA 2QA43 1BSDA 2W2CA 4J5GA 1OUNA 2BMQB 1X1WA 1GS3A 1ZS7A 1IV9A 2R41A 2OTJ3 3DZLA 1UW1A 1YGEA 1WTHA 2BT3A 4XBXA 4XDWA 3SYUA 5JBSA 1YJW3 1GY7A 1TFKA 4H61A 1RGEA 3ECFA 1X1UA 2P05A 2P0MA 1VQ63 2GU3A 3GSPA 1BRGA 5AYRB 2HMNB 1DE3A 2CKFB 3KE7A 1O7GB 3AGNA 1FGQA 3OXAA 1IQYA 1LOYA 4Q53A 1JRQA 3KN4A 4L7KA 3KZTA 4IT7A 1RHLA 2GXFA 5DRVA 4WFOA 2XFSA 5A0OB 1OCVA 4R9LA 2W03A 1K8A4 1B3SA 4XDVA 5AYSC 2ZDJA 3AHWA 1TP6A 4R4KA 5D83A 1NB5I 1BNFA 2SARA 5G1KA 4AKZA 1YIT3 4N6LA 4OUQA 3GRDA 1OGXA 2Y73A 3X3ZA 2QEX3 1RCKA 3LOYA 3OWUA 3URPA 2IUKA 1MWTA 3NBJA 2QIYA 1Y4KA 3FKAA 2SBLA 4WP5A 3FG1A 1YHQ3 1DVDA 1FGRA 1BRSA 4FCJA 4HKVB 4LEHA 2XGLA 1GMPA 1OPYA 2HMJB 1PY3A 1BUQA 2BU4A 3BNCA 1BIRA 5BXQA 4HZBB 2CHCA 4CDLA 1Q824 1A2KA 1J2BA 3FGYA
chains in the Genus database with same CATH topology
3B8LA 1Z1SA 3S27A 1IV7A 4HM6B 5IEPA 2CW9A 1IQ8A 4H3UA 3G16A 1ULJB 5IERA 4L8PA 3EHCA 3NQYA 3RDEA 5AEUB 1DYUA 1IVXA 3FLJA 1SIHA 1W5ZA 1AVKA 1D6YA 3EC9A 1U8CB 4EC6A 3KKGA 2E2UA 4J8TA 3BNBA 2XF3A 3JUQA 2QGUA 2Z6BA 2UX0A 2KRTA 1TUHA 3MSOA 2RGQA 3ALAA 3DGMA 3F14A 4N6NB 2YFJB 1W00A 1JKGB 1T5YA 1V74A 1VQK3 1CYUA 4LZIA 1FUWA 1E3RA 3PS8A 4NHFA 1Q40A 1KC84 3EBTA 3DXOA 1VQM3 5AIGA 3SXXA 3H3HA 4O02B 1IVUA 1STDA 3O8YA 3X3YA 1KD14 3CNXA 2MC8A 2OQEA 4R1KA 2RFRA 1YHQ3 1DMQA 1SPUA 3M8CA 4JF8A 1JN5B 4MMZB 5KP3A 3KSPA 5IF6A 1NDOB 2LQVA 1DVCA 2W9PA 1F8NA 1OF5A 2CC3A 1WMOA 4KFFA 1SIIA 1W01A 4QWTA 2GBXB 2XSHB 4EBGA 2E2VA 5IG5A 1TFOA 3ER7A 3N54B 3ROBA 5I97A 3NX0A 2CFDA 3CCU3 1IU7A 3MKIA 4HM4B 1AV4A 2F98A 3B4OA 1IDPA 3S67A 4L8OA 3CCS3 2F86B 3G0KA 1GY5A 2P38A 3PXMA 4EV5A 2WOHA 1HKXA 3HIGA 2CG1A 1NB3I 2RCDA 3STDA 3F8HA 5AEWB 3WA3A 1ASKA 1IVWA 2W0QA 3LYGA 3EE1A 2JDIH 1YIJ3 3MPHA 3JUOA 2R4IA 4J9AA 1RRLA 4N6UA 1PFPA 3J7Yd 2IMJA 1STFI 5IG4A 1QMAA 2CIUA 4N6OB 3IMAB 1JB5A 1OF5B 5EEOA 1NJI4 1IK3A 1SQWA 3EN1B 4X2OA 1Q864 5G2GA 1K9M4 1D6UA 3Q2PA 2LYXA 4HM7B 1OHSA 5CLKA 4HM8B 3WOEB 1FA3A 2K54A 3PZWA 4G1MB 4AEQA 1K41A 3S28A 2OTL3 5ELJA 3NBRA 2P0XA 2KCDA 1VQ83 5EVHA 3CCE3 1N5HA 1JKGA 1JB2A 4TX4A 4K1UA 1O7WB 2XEPA 3S5CA 1VQ93 1NO3A 4O8SA 1EQKA 3F8XA 3DGNA 1OH0A 1A90A 3KFQC 2Z77A 1QAFA 4FMDA 3LTBA 2STDA 2ML6A 1W2B2 1R4CA 1NU3A 1K734 2A15A 1W02A 4ORLA 3LTAA 5IEOA 3FG3A 2CFGA 1QVG2 3QRDA 3S29A 1M1K4 5KP4A 3DUKA 4HM2B 4HZ9B 3MG1A 4NREA 3UB1A 3K5TA 3B4PA 5FW5A 2BMRB 4RBNA 2HMKB 3UL6A 1IT7A 3X3XA 3D9RA 2CWVA 4KVHA 3SEDA 1ZX2A 1M1XB 2K0MA 1US1A 3MYTA 3TDGA 1O7HB 3NV0A 3CC73 2D42A 3T0UA 1VQO3 4BTWA 4HYZA 1RN7A 2CFLA 3BLZA 2OOVA 3U1WA 2HMOB 7STDA 1UUWB 2YX9A 3Q1CA 3SOYA 2Z76A 3KIIA 4EXRA 2I9WA 3JUNA 1YJN3 5STDA 3RGRA 4BTXA 2OQEC 2C10A 5IG3A 2CK3H 2GBWB 4FCZA 3CME3 3CC43 3LTDA 3HIIA 4FMAA 3V92A 1KSIA 5EQLA 3IJEB 1ISKA 5CK6A 1FGMA 2W6JH 3PYJA 2XR8B 1PU4A 1ULIB 4EYCA 3F7SA 1KQS2 2Z7AA 5IENA 1Q42A 4KFEA 3NM7A 3G6E3 3DM8A 3T8UA 3CU3A 3SX1A 3L0RA 3PGBA 5LC7A 2CWTA 5FGOA 1N8R4 3HK4A 1JV2B 1GYBA 4U13A 1D6ZA 4JRFA 3CPOA 3VF1A 3OX9A 2FXTA 1QALA 2GU1A 3KSED 3PCRA 1MOLA 3EJVA 5AIHA 4HVNA 2BMOB 3SLUA 2BNGA 3NBBA 1CYVA 1UI8A 3N8BA 3LXUX 1EA2A 3BB9A 1AR0A 4AKYA 4HBRA 5AI1A 4XB5A 4I4KA 3FF0A 2XFTA 5D81A 3WMDA 3GZBA 5LC6A 1E3VA 4WWUC 1CQSA 1QJGA 1IVVA 3U97A 1DMNA 1EKMA 4WHAA 3FZWA 3FSDA 3NM2A 1YVBI 3VSYA 4N6V0 3CC23 1LXEA 3OWSA 3CCJ3 4R9KA 4ZM8A 2FGTA 5KP1A 2KXGA 2F99A 2CWUA 3GZYB 3X40A 3LT8A 3LZAA 4R80A 1HU9A 3OV4A 2YFLB 1JB4A 4STDA 5DREA 1ZO2A 3FF2A 4XBYA 3CCV3 1AVLA 3JUPA 1W6GA 1ROAA 1A2VA 1FGOA 4FMBA 3G713 2OWPA 3FH1A 2INXA 2XRXB 1JNQA 2D1WA 3G8ZA 2HMLB 5CF1A 1VQN3 1Q814 2PNCA 3OWYA 1EG9B 3VGNA 1OACA 4FMCA 4KZ1A 1TIJA 3OW22 1W7CA 1W6CA 4K90B 1A67A 1VQP3 3UJMA 2B24B 2GEYA 4O3VA 5JPUA 2L4VA 4IPBA 2WGOA 3EQQB 3G4S3 1ROVA 1E97A 4HJLB 2XH9A 3EB8A 1JJ22 2V1LA 2XSOB 3B7CA 5D82A 3WODG 1C7HA 2PZVA 5CXOA 3MG3A 1IQXA 4MJDA 4RZMA 3EX9A 3GZRA 1CEWI 2CH9A 1KWIA 1N9JA 1Q40B 4K61A 3RGAA 1GD3A 3K7CA 3SVAA 2W04A 3MHEA 4OK0A 3CNMA 1RRHA 3PCSA 3V99A 2BO9B 1O7MB 3BNEA 3GZXB 3K63A 4LSOA 3N9HA 2WO0A 4PEJA 2Q07A 2P09A 5HGRA 3NQZA 2O9UX 3GAXA 3NUVA 3UNLA 4N6TA 3EBYA 4OVMA 4O2HA 3WOFB 1UUVB 3H51A 4XBTA 1WQLB 3X42A 1FGTA 4GL6A 3HX8A 3SOAA 4BTYA 3DGLA 3CD63 3F7XA 4X2HA 1W2ZA 1MNLA 5ELUA 1Q7Y4 1VZZA 3NHXA 3LMLA 3I563 1TU5A 2CFWA 4FR9A 4HM3B 2ML5A 4MMYB 2BHMA 1OHOA 2W9QA 3X41A 3CCQ3 1VQ73 3JVCA 2B1XB 4CCVA 3CXC2 3AMOA 3CCR3 2OCTA 1L5GB 4XM4A 3MWZA 4HM5B 3LTCA 3T8NA 2GEXA 3CCM3 4EV2A 5TGNA 1RJOA 1LOXA 4GB5A 3CMA3 1M9GA 3I0YA 2RSXA 1VQ53 1N9EA 3NXJA 1W4NA 2FNQA 3DGOA 1VQ43 1WMNA 3K0ZA 4WYKB 3QK9A 3HZPA 3D3LA 3DMCA 5AIIA 3WDGB 1IT8A 1OGZA 3F40A 2XGNA 4MMXB 2YFIB 3FCSB 1NWWA 8CHOA 3EF8A 1YI23 1VQL3 4MEIA 3EN8A 3Q90A 3HI7A 5IW9A 5IG0A 2C11A 1M904 4LMIA 2O3OA 1W6YA 1GD4A 4KFDA 2HMMB 4RNYA 1N5PA 3CCL3 5JPPA 1N8QA 4LGQA 1UI7A 3LT9A 1SJWA 6STDA 3BNDA 3LH4A 1YJ93 1WNHA 4N6MA 3I553 3DY5A 1S723 2E2TA 3V98A 1LNHA 4HM1B 2W56A 2Y74A 3IPTA 2W56B 1RKYA 3JUMA 2JQ5A 1O7PB 1GY6A 1S5AA 2OOVC 3A76A 1O7NB 3K9MC 4WYKA 1LVNA 1JN5A 1DMMA 4RNZA 3MG2A 3NV0B 2IUJA 5AIFA 2CFKA 1K28A 4IIAA 3CPW2 5CF2A 1WMPA 4K1VA 1G96A 3GWRA 2WOFA 2CG0A 1OHPA 4N3VA 4FCMA 2MF7A 1U5OA 3FG4A 3F9SA 3AMOB 3E99A 1QAKA 5BVBA 3WA2X 1QVF2 4HM0B 2ZL8A 3UL5A 2M7OA 2IA7A 2WGQA 2QA43 2W2CA 1OUNA 2BMQB 1GS3A 1IV9A 2OTJ3 3DZLA 1UW1A 1YGEA 1WTHA 2BT3A 4XBXA 4XDWA 5JBSA 1YJW3 1GY7A 1TFKA 4H61A 3ECFA 2P05A 2P0MA 1VQ63 2GU3A 5AYRB 2HMNB 2CKFB 3KE7A 1O7GB 1FGQA 3OXAA 1IQYA 4Q53A 1JRQA 3KN4A 4L7KA 3KZTA 4IT7A 2GXFA 5DRVA 4WFOA 2XFSA 5A0OB 1OCVA 4R9LA 2W03A 1K8A4 4XDVA 5AYSC 2ZDJA 1TP6A 4R4KA 5D83A 1NB5I 4AKZA 1YIT3 4N6LA 4OUQA 3GRDA 1OGXA 2Y73A 3X3ZA 2QEX3 3LOYA 3OWUA 2IUKA 3NBJA 2QIYA 1Y4KA 3FKAA 2SBLA 4WP5A 3FG1A 1DVDA 1FGRA 4FCJA 4HKVB 4LEHA 2XGLA 1OPYA 2HMJB 1BUQA 3BNCA 5BXQA 4HZBB 2CHCA 4CDLA 1Q824 1A2KA 1J2BA 3FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8L A;  1Z1S A;  3LZA A;  3Q90 A;  4HM6 B;  5IEP A;  3OV4 A;  2YFL B;  1JB4 A;  4STD A;  5IG0 A;  4H3U A;  1ZO2 A;  3F8X A;  3FF2 A;  3G16 A;  1OH0 A;  1ULJ B;  4LMI A;  4XBY A;  1W6Y A;  3JUP A;  4L8P A;  2Z77 A;  3EHC A;  2HMM B;  5AEU B;  5IER A;  2STD A;  5DRE A;  3FLJ A;  5JPP A;  3EC9 A;  1NU3 A;  4LGQ A;  2OWP A;  1SJW A;  2INX A;  2A15 A;  1W02 A;  3FH1 A;  2XRX B;  3KKG A;  4ORL A;  5IEO A;  3G8Z A;  2HML B;  5CF1 A;  4J8T A;  3JUQ A;  2QGU A;  2UX0 A;  3OWY A;  1EG9 B;  3DUK A;  4HM2 B;  4HZ9 B;  3VGN A;  5KP4 A;  1TUH A;  3MG1 A;  2RGQ A;  3MSO A;  4HM1 B;  3F14 A;  3B4P A;  2YFJ B;  1W00 A;  1JKG B;  2BMR B;  3IPT A;  5FW5 A;  3JUM A;  2JQ5 A;  2HMK B;  3D9R A;  4KVH A;  3UJM A;  1O7P B;  1GY6 A;  1S5A A;  3SED A;  1E3R A;  1ZX2 A;  2B24 B;  2GEY A;  3A76 A;  1O7N B;  5JPU A;  1Q40 A;  3MYT A;  4WYK A;  3EQQ B;  1JN5 A;  3EBT A;  1E97 A;  4HJL B;  1O7H B;  1DMM A;  3DXO A;  3NV0 A;  5AIG A;  3H3H A;  2XSO B;  3B7C A;  3MG2 A;  3NV0 B;  1C7H A;  1STD A;  2PZV A;  5CXO A;  3MG3 A;  5D82 A;  3CNX A;  4MJD A;  5AIF A;  4RZM A;  3EX9 A;  3BLZ A;  3GZR A;  4IIA A;  2HMO B;  7STD A;  1UUW B;  5CF2 A;  4K1V A;  4R1K A;  2Z76 A;  3GWR A;  3SOY A;  2RFR A;  1DMQ A;  2I9W A;  3M8C A;  5KP3 A;  1JN5 B;  5IF6 A;  3JUN A;  3KSP A;  1NDO B;  1Q40 B;  3RGA A;  5STD A;  3RGR A;  1OHP A;  3K7C A;  4N3V A;  4FCM A;  1OF5 A;  1U5O A;  3MHE A;  3CNM A;  3F9S A;  5IG3 A;  2GBW B;  3E99 A;  5BVB A;  4HM0 B;  1W01 A;  1O7M B;  3GZX B;  2GBX B;  2XSH B;  3FGY A;  4PEJ A;  2W2C A;  3ER7 A;  5IG5 A;  3ROB A;  5CK6 A;  1OUN A;  5HGR A;  2BMQ B;  1ISK A;  1GS3 A;  3NUV A;  3MKI A;  3UNL A;  4HM4 B;  3EBY A;  2F98 A;  2XR8 B;  3DZL A;  4XDW A;  3B4O A;  1IDP A;  1ULI B;  3F7S A;  4OVM A;  4XBX A;  4L8O A;  1GY7 A;  2Z7A A;  1UUV B;  3H51 A;  2F86 B;  4XBT A;  1WQL B;  5IEN A;  3G0K A;  1Q42 A;  3ECF A;  1GY5 A;  3HX8 A;  3SOA A;  1HKX A;  2HMN B;  2RCD A;  3DM8 A;  3F7X A;  2CKF B;  3KE7 A;  4X2H A;  3STD A;  3CU3 A;  3T8U A;  3F8H A;  1VZZ A;  1O7G B;  3NHX A;  5AEW B;  1ASK A;  3OXA A;  3LYG A;  4HM3 B;  1OHO A;  4Q53 A;  3JUO A;  3HK4 A;  2R4I A;  3KZT A;  4J9A A;  1GYB A;  4L7K A;  4U13 A;  2B1X B;  2GXF A;  3CPO A;  5DRV A;  3OX9 A;  2IMJ A;  1OCV A;  4XM4 A;  4R9L A;  5IG4 A;  1QMA A;  3EJV A;  4XDV A;  4HM5 B;  5AIH A;  1JB5 A;  4HVN A;  2BMO B;  3T8N A;  1OF5 B;  1TP6 A;  2BNG A;  2GEX A;  5D83 A;  4X2O A;  3EN1 B;  5G2G A;  5TGN A;  1EA2 A;  3BB9 A;  1AR0 A;  5AI1 A;  4OUQ A;  3GRD A;  1OGX A;  4GB5 A;  3I0Y A;  3FF0 A;  4HM7 B;  4I4K A;  4XB5 A;  5D81 A;  1OHS A;  3GZB A;  4HM8 B;  5CLK A;  1E3V A;  4WWU C;  3OWU A;  1CQS A;  1QJG A;  3WMD A;  3NXJ A;  1DMN A;  2K54 A;  2QIY A;  1K41 A;  3K0Z A;  4WYK B;  3FZW A;  3FSD A;  3FKA A;  3NBR A;  3HZP A;  3NM2 A;  4WP5 A;  3DMC A;  5AII A;  4FCJ A;  4HKV B;  3VSY A;  5EVH A;  4LEH A;  6STD A;  1OGZ A;  3F40 A;  1OPY A;  2HMJ B;  1JKG A;  2YFI B;  1BUQ A;  3OWS A;  1JB2 A;  1NWW A;  8CHO A;  5BXQ A;  4HZB B;  3EF8 A;  2CHC A;  1O7W B;  4K1U A;  4R9K A;  4CDL A;  5KP1 A;  1A2K A;  2F99 A;  3GZY B;  3EN8 A;  3S5C A; 
#chains in the Genus database with same CATH topology
 3B8L A;  1Z1S A;  3S27 A;  1IV7 A;  4HM6 B;  5IEP A;  2CW9 A;  3HOH A;  1IQ8 A;  4H3U A;  3G16 A;  1I2G A;  1ULJ B;  5IER A;  1RTU A;  3EHC A;  3NQY A;  4L8P A;  3RDE A;  1DYU A;  1IVX A;  5AEU B;  3FLJ A;  1SIH A;  1W5Z A;  1AVK A;  1D6Y A;  1RMS A;  1U8C B;  3EC9 A;  4EC6 A;  3KKG A;  2BIR A;  1BRJ A;  2E2U A;  4J8T A;  3BNB A;  2XF3 A;  3JUQ A;  2QGU A;  2Z6B A;  2UX0 A;  1UDI I;  1C54 A;  2KRT A;  1TUH A;  3MSO A;  2RGQ A;  3ALA A;  3DGM A;  3F14 A;  4N6N B;  1B21 A;  2YFJ B;  1W00 A;  1JKG B;  7RNT A;  1T5Y A;  2ZHX B;  1V74 A;  1I8V A;  1VQK 3;  1CYU A;  4LZI A;  1FUW A;  1E3R A;  3PS8 A;  4NHF A;  1Q40 A;  1KC8 4;  3EBT A;  3DXO A;  1VQM 3;  1Q9E A;  1RGC A;  5AIG A;  3SXX A;  1I3F A;  3H3H A;  4O02 B;  1IVU A;  1STD A;  3O8Y A;  3X3Y A;  1KD1 4;  3CNX A;  2MC8 A;  5BU4 A;  1BGS A;  2OQE A;  5M19 A;  4R1K A;  2RFR A;  1BNS A;  1DMQ A;  1SPU A;  2IY2 A;  3M8C A;  1JN5 B;  4JF8 A;  4MMZ B;  3KSP A;  5KP3 A;  5IF6 A;  1NDO B;  2LQV A;  1DVC A;  2W9P A;  4EW5 A;  1F8N A;  1OF5 A;  2CC3 A;  4CJN A;  2KF3 A;  1WMO A;  4KFF A;  1RGL A;  1AY7 A;  4BL3 A;  1SII A;  1W01 A;  4QWT A;  2L1S A;  2GBX B;  2XSH B;  4EBG A;  1RN1 A;  2E2V A;  3D4A A;  1TFO A;  1B2U A;  1ZGX A;  3ER7 A;  3N54 B;  3NX0 A;  2CFD A;  3ROB A;  4KT3 B;  5I97 A;  1IU7 A;  3CCU 3;  3MKI A;  4HM4 B;  5M18 A;  1AV4 A;  2F98 A;  3B4O A;  1IDP A;  1GOY A;  3S67 A;  1RNT A;  4L8O A;  2F5M A;  3CCS 3;  2F5W A;  2F86 B;  3G0K A;  1BRN L;  1GY5 A;  2CX0 A;  2P38 A;  3PXM A;  4EV5 A;  2WOH A;  1HKX A;  3AHS A;  3HIG A;  2CG1 A;  1NB3 I;  2RCD A;  3STD A;  1BRI A;  3F8H A;  5AEW B;  3WA3 A;  1ASK A;  1IVW A;  2W0Q A;  1JBS A;  3LYG A;  4BU4 A;  6RNT A;  3EE1 A;  3WR2 A;  1V58 A;  2JDI H;  1YIJ 3;  1TRQ A;  3JUO A;  3MPH A;  4I5Q A;  3ZG5 A;  2K3D A;  2R4I A;  4J9A A;  1RRL A;  4N6U A;  1PFP A;  1RGA A;  3J7Y d;  1PYL A;  1MGR A;  2IMJ A;  1STF I;  5IG4 A;  1QMA A;  2CIU A;  4N6O B;  3IMA B;  2UGI A;  1JB5 A;  1G02 A;  1EUI C;  1OF5 B;  1RLS A;  5EEO A;  1SQW A;  3EN1 B;  4X2O A;  1IK3 A;  1Q86 4;  5G2G A;  1K9M 4;  1D6U A;  4DKI A;  3Q2P A;  2LYX A;  4HM7 B;  1OHS A;  5CLK A;  4HM8 B;  3WOE B;  1FA3 A;  4RNT A;  2KF6 A;  4BIR A;  1B27 A;  1BOX A;  2K54 A;  3PZW A;  4G1M B;  1K41 A;  4AEQ A;  1UCI A;  3S28 A;  2OTL 3;  5ELJ A;  3NBR A;  2P0X A;  4NPB A;  2KCD A;  2HOH A;  1VQ8 3;  5EVH A;  3CCE 3;  1N5H A;  1JKG A;  1UGH I;  1JB2 A;  4TX4 A;  1RNB A;  4K1U A;  1O7W B;  2XEP A;  1SAR A;  3S5C A;  1GOV A;  1VQ9 3;  1NO3 A;  4O8S A;  1EQK A;  3F8X A;  3DGN A;  1OH0 A;  1A90 A;  3KFQ C;  3WHO A;  3ZG0 A;  2Z77 A;  1QAF A;  4FMD A;  1LOW A;  2STD A;  3LTB A;  2ML6 A;  1W2B 2;  1R4C A;  1NU3 A;  2J8X B;  3BIR A;  3DGY A;  1K73 4;  2A15 A;  1W02 A;  4ORL A;  2ZA4 A;  3LTA A;  3FG3 A;  5IEO A;  2CFG A;  1X1Y A;  1QVG 2;  3QRD A;  3S29 A;  1M1K 4;  5KP4 A;  3DUK A;  4HM2 B;  4HZ9 B;  3MG1 A;  4NRE A;  3UB1 A;  1LRA A;  3K5T A;  3B4P A;  1BRH A;  5FW5 A;  2BMR B;  4RBN A;  3ZFZ A;  2HMK B;  3UL6 A;  1IT7 A;  3X3X A;  3D9R A;  2CWV A;  4KVH A;  3SED A;  1BSE A;  1ZX2 A;  1M1X B;  4HAA A;  2K0M A;  1US1 A;  3MYT A;  3TDG A;  4LYL B;  1B2M A;  1NNV A;  1O7H B;  1UCK A;  3NV0 A;  3CC7 3;  2CX1 A;  2D42 A;  3T0U A;  5G1L A;  3KCH A;  1VQO 3;  4BTW A;  4HYZ A;  1RN7 A;  2CFL A;  3BLZ A;  2OOV A;  3U1W A;  2HMO B;  7STD A;  1UUW B;  5RNT A;  1NJI 4;  2YX9 A;  3Q1C A;  3SOY A;  2Z76 A;  3KII A;  4EXR A;  2I9W A;  1YNV X;  3JUN A;  1YJN 3;  5STD A;  3RGR A;  4BTX A;  2OQE C;  1LQM B;  2C10 A;  5IG3 A;  1RGG A;  2CK3 H;  2GBW B;  4FCZ A;  3CME 3;  3CC4 3;  3LTD A;  3HII A;  4FMA A;  3V92 A;  1KSI A;  5EQL A;  3IJE B;  1ISK A;  1FUS A;  1FGM A;  2W6J H;  5CK6 A;  1MWS A;  3PYJ A;  2XR8 B;  1PU4 A;  1ULI B;  4EYC A;  3F7S A;  1KQS 2;  2Z7A A;  5IEN A;  1Q42 A;  1TTO A;  4KFE A;  3NM7 A;  3G6E 3;  3DM8 A;  3T8U A;  1AQZ A;  3CU3 A;  3SX1 A;  3L0R A;  1LQG C;  3PGB A;  5LC7 A;  1DET A;  2CWT A;  8RNT A;  2IYJ A;  1JBR A;  5FGO A;  1N8R 4;  3HK4 A;  1JV2 B;  1GYB A;  4U13 A;  1TRP A;  1RCL A;  1D6Z A;  4JRF A;  1B2Z A;  3CPO A;  1FZU A;  3VF1 A;  1RDS A;  3OX9 A;  1I2E A;  2FXT A;  1QAL A;  2GU1 A;  3KSE D;  3PCR A;  1MOL A;  3EJV A;  5AIH A;  4HVN A;  2BMO B;  3SLU A;  2BNG A;  3NBB A;  1CYV A;  1UI8 A;  3N8B A;  2AAE A;  3LXU X;  1EA2 A;  3BB9 A;  1AR0 A;  4AKY A;  4HBR A;  1IYY A;  5AI1 A;  4XB5 A;  1CH0 A;  4I4K A;  3FF0 A;  1TJD A;  2XFT A;  5D81 A;  3WMD A;  3GZB A;  5LC6 A;  1E3V A;  4WWU C;  1CQS A;  1QJG A;  1IVV A;  3U97 A;  1DMN A;  1EKM A;  4WHA A;  1YGW A;  3FZW A;  3FSD A;  3NM2 A;  1YVB I;  5M1A A;  3VSY A;  2RBI A;  4N6V 0;  1JBT A;  3CC2 3;  1LXE A;  3OWS A;  3CCJ 3;  4R9K A;  4ZM8 A;  1B20 A;  1BNE A;  2FGT A;  5KP1 A;  2F99 A;  2CWU A;  2KXG A;  3GZY B;  3X40 A;  3LT8 A;  1MWR A;  3LZA A;  1RSN A;  4R80 A;  1HU9 A;  1JZD A;  3OV4 A;  2YFL B;  1JB4 A;  4STD A;  5BIR A;  5DRE A;  1ZO2 A;  3FF2 A;  4XBY A;  3CCV 3;  1AVL A;  1BAO A;  3JUP A;  1W6G A;  1BU4 A;  1R4Y A;  1BRK A;  1ROA A;  1A2V A;  1FGO A;  1I3I A;  2GSP A;  4FMB A;  3G71 3;  2OWP A;  1RGH A;  2INX A;  3FH1 A;  2XRX B;  1JNQ A;  2D1W A;  3G8Z A;  2HML B;  5CF1 A;  1VQN 3;  1Q81 4;  1HZ1 A;  2PNC A;  3OWY A;  1EG9 B;  3VGN A;  1OAC A;  1T3B A;  4FMC A;  4KZ1 A;  1TIJ A;  3OW2 2;  1W7C A;  1W6C A;  4K90 B;  1A67 A;  1BNG A;  1VQP 3;  1BSB A;  3UJM A;  2B24 B;  2GEY A;  4O3V A;  3A5E A;  5JPU A;  2L4V A;  1FW7 A;  1EEJ A;  1BSA A;  2WGO A;  1X1X A;  3EQQ B;  4IPB A;  3G4S 3;  1ROV A;  2H0H A;  1E97 A;  4HJL B;  1GMQ A;  2XH9 A;  3EB8 A;  1JJ2 2;  2V1L A;  2XSO B;  3B7C A;  5D82 A;  3WOD G;  1C7H A;  1LOV A;  2PZV A;  5CXO A;  3MG3 A;  1IQX A;  4MJD A;  4RZM A;  3EX9 A;  3GZR A;  1CEW I;  2CH9 A;  2RNT A;  1JZO A;  1KWI A;  1N9J A;  1Q40 B;  4K61 A;  3RGA A;  1GD3 A;  3K7C A;  1I0V A;  3SVA A;  2W04 A;  3MHE A;  4OK0 A;  3CNM A;  1RRH A;  3PCS A;  1FYS A;  3V99 A;  2BO9 B;  3RNT A;  1O7M B;  3BNE A;  3GZX B;  3K63 A;  4LSO A;  3N9H A;  9RNT A;  2WO0 A;  4PEJ A;  2Q07 A;  2P09 A;  5HGR A;  3NQZ A;  1B2S A;  2F4Y A;  2O9U X;  3GAX A;  3NUV A;  3UNL A;  4N6T A;  3EBY A;  1GOU A;  4OVM A;  4O2H A;  3WOF B;  3D5I A;  1T2I A;  1UUV B;  3H51 A;  4XBT A;  1A2P A;  1WQL B;  3X42 A;  1FGT A;  4GL6 A;  3HX8 A;  3SOA A;  1UUG B;  4BTY A;  3DGL A;  4ILF A;  3CD6 3;  3F7X A;  4X2H A;  1W2Z A;  1MNL A;  5ELU A;  1Q7Y 4;  1VZZ A;  3NHX A;  1UCL A;  3LML A;  3I56 3;  1TU5 A;  6GSP A;  2CFW A;  4FR9 A;  4HM3 B;  1G0T A;  2ML5 A;  4MMY B;  2BHM A;  1OHO A;  2W9Q A;  3X41 A;  4BL2 A;  3CCQ 3;  3DH2 A;  7GSP A;  1VQ7 3;  3JVC A;  2B1X B;  4CCV A;  3CXC 2;  3AMO A;  3CCR 3;  2OCT A;  1Q7H A;  4GHO A;  1L5G B;  4XM4 A;  1T2H A;  3MWZ A;  4HM5 B;  3LTC A;  3T8N A;  1UCJ A;  2GEX A;  3CCM 3;  4EV2 A;  5TGN A;  1YVS A;  2F56 A;  1RJO A;  2H0G A;  1FUT A;  1LOX A;  4GB5 A;  3CMA 3;  1M9G A;  3I0Y A;  5GSP A;  2RSX A;  1VQ5 3;  1N9E A;  3NXJ A;  1W4N A;  2FNQ A;  3DGO A;  1VQ4 3;  1BAN A;  1GMR A;  1V57 A;  1WMN A;  3K0Z A;  4WYK B;  3QK9 A;  3HZP A;  3D3L A;  3DMC A;  5AII A;  3WDG B;  1IT8 A;  1B2X A;  1MGW A;  1HYF A;  1OGZ A;  2XGN A;  3F40 A;  4MMX B;  1GSP A;  1RGK A;  2YFI B;  3FCS B;  1NWW A;  8CHO A;  3EF8 A;  3Q3F A;  1YI2 3;  2AAD A;  1VQL 3;  4MEI A;  3EN8 A;  4J5K A;  3Q90 A;  4CPK A;  3HI7 A;  5IW9 A;  5IG0 A;  2C11 A;  1M90 4;  4LMI A;  2O3O A;  1W6Y A;  1BNJ A;  1GD4 A;  4KFD A;  2HMM B;  4RNY A;  1N5P A;  1BUJ A;  3CCL 3;  5JPP A;  1N8Q A;  4LGQ A;  1UI7 A;  3LT9 A;  1SJW A;  6STD A;  3BND A;  3LH4 A;  1VQQ A;  1YJ9 3;  1WNH A;  3D5G A;  4N6M A;  5HOH A;  3I55 3;  3DY5 A;  2C4B A;  3BU4 A;  4HOH A;  1S72 3;  2E2T A;  3V98 A;  1BNR A;  1LNH A;  2KAA A;  4HM1 B;  2W56 A;  5IG5 A;  2Y74 A;  3IPT A;  1RGF A;  2W56 B;  1RKY A;  3JUM A;  2JQ5 A;  1I2F A;  1I70 A;  1BVI A;  1O7P B;  1GY6 A;  1S5A A;  2OOV C;  3A76 A;  1O7N B;  3K9M C;  4WYK A;  1LVN A;  1JN5 A;  1DMM A;  4RNZ A;  3MG2 A;  2KF5 A;  3NV0 B;  1BSC A;  2UUG C;  2IUJ A;  1BNI A;  2KF4 A;  5AIF A;  2CFK A;  1MWU A;  2H0I A;  1K28 A;  4IIA A;  3CPW 2;  5CF2 A;  1WMP A;  4K1V A;  1G96 A;  3GWR A;  2WOF A;  4GSP A;  2CG0 A;  1OHP A;  4N3V A;  4FCM A;  2MF7 A;  1U5O A;  3FG4 A;  1RN4 A;  1UGI A;  3AGO A;  3F9S A;  3AMO B;  3E99 A;  1QAK A;  1LNI A;  3WA2 X;  5BVB A;  4HM0 B;  2ZL8 A;  3UL5 A;  1QVF 2;  3D79 A;  2M7O A;  1I0X A;  2IA7 A;  2WGQ A;  2QA4 3;  1BSD A;  2W2C A;  4J5G A;  1OUN A;  2BMQ B;  1X1W A;  1GS3 A;  1ZS7 A;  1IV9 A;  2R41 A;  2OTJ 3;  3DZL A;  1UW1 A;  1YGE A;  1WTH A;  2BT3 A;  4XBX A;  4XDW A;  3SYU A;  5JBS A;  1YJW 3;  1GY7 A;  1TFK A;  4H61 A;  1RGE A;  3ECF A;  1X1U A;  2P05 A;  2P0M A;  1VQ6 3;  2GU3 A;  3GSP A;  1BRG A;  5AYR B;  2HMN B;  1DE3 A;  2CKF B;  3KE7 A;  1O7G B;  3AGN A;  1FGQ A;  3OXA A;  1IQY A;  1LOY A;  4Q53 A;  1JRQ A;  3KN4 A;  4L7K A;  3KZT A;  4IT7 A;  1RHL A;  2GXF A;  5DRV A;  4WFO A;  2XFS A;  5A0O B;  1OCV A;  4R9L A;  2W03 A;  1K8A 4;  1B3S A;  4XDV A;  5AYS C;  2ZDJ A;  3AHW A;  1TP6 A;  4R4K A;  5D83 A;  1NB5 I;  1BNF A;  2SAR A;  5G1K A;  4AKZ A;  1YIT 3;  4N6L A;  4OUQ A;  3GRD A;  1OGX A;  2Y73 A;  3X3Z A;  2QEX 3;  1RCK A;  3LOY A;  3OWU A;  3URP A;  2IUK A;  1MWT A;  3NBJ A;  2QIY A;  1Y4K A;  3FKA A;  2SBL A;  4WP5 A;  3FG1 A;  1YHQ 3;  1DVD A;  1FGR A;  1BRS A;  4FCJ A;  4HKV B;  4LEH A;  2XGL A;  1GMP A;  1OPY A;  2HMJ B;  1PY3 A;  1BUQ A;  2BU4 A;  3BNC A;  1BIR A;  5BXQ A;  4HZB B;  2CHC A;  4CDL A;  1Q82 4;  1A2K A;  1J2B A;  3FGY A; 
#chains in the Genus database with same CATH homology
 3B8L A;  1Z1S A;  3S27 A;  1IV7 A;  4HM6 B;  5IEP A;  2CW9 A;  1IQ8 A;  4H3U A;  3G16 A;  1ULJ B;  5IER A;  4L8P A;  3EHC A;  3NQY A;  3RDE A;  5AEU B;  1DYU A;  1IVX A;  3FLJ A;  1SIH A;  1W5Z A;  1AVK A;  1D6Y A;  3EC9 A;  1U8C B;  4EC6 A;  3KKG A;  2E2U A;  4J8T A;  3BNB A;  2XF3 A;  3JUQ A;  2QGU A;  2Z6B A;  2UX0 A;  2KRT A;  1TUH A;  3MSO A;  2RGQ A;  3ALA A;  3DGM A;  3F14 A;  4N6N B;  2YFJ B;  1W00 A;  1JKG B;  1T5Y A;  1V74 A;  1VQK 3;  1CYU A;  4LZI A;  1FUW A;  1E3R A;  3PS8 A;  4NHF A;  1Q40 A;  1KC8 4;  3EBT A;  3DXO A;  1VQM 3;  5AIG A;  3SXX A;  3H3H A;  4O02 B;  1IVU A;  1STD A;  3O8Y A;  3X3Y A;  1KD1 4;  3CNX A;  2MC8 A;  2OQE A;  4R1K A;  2RFR A;  1YHQ 3;  1DMQ A;  1SPU A;  3M8C A;  4JF8 A;  1JN5 B;  4MMZ B;  5KP3 A;  3KSP A;  5IF6 A;  1NDO B;  2LQV A;  1DVC A;  2W9P A;  1F8N A;  1OF5 A;  2CC3 A;  1WMO A;  4KFF A;  1SII A;  1W01 A;  4QWT A;  2GBX B;  2XSH B;  4EBG A;  2E2V A;  5IG5 A;  1TFO A;  3ER7 A;  3N54 B;  3ROB A;  5I97 A;  3NX0 A;  2CFD A;  3CCU 3;  1IU7 A;  3MKI A;  4HM4 B;  1AV4 A;  2F98 A;  3B4O A;  1IDP A;  3S67 A;  4L8O A;  3CCS 3;  2F86 B;  3G0K A;  1GY5 A;  2P38 A;  3PXM A;  4EV5 A;  2WOH A;  1HKX A;  3HIG A;  2CG1 A;  1NB3 I;  2RCD A;  3STD A;  3F8H A;  5AEW B;  3WA3 A;  1ASK A;  1IVW A;  2W0Q A;  3LYG A;  3EE1 A;  2JDI H;  1YIJ 3;  3MPH A;  3JUO A;  2R4I A;  4J9A A;  1RRL A;  4N6U A;  1PFP A;  3J7Y d;  2IMJ A;  1STF I;  5IG4 A;  1QMA A;  2CIU A;  4N6O B;  3IMA B;  1JB5 A;  1OF5 B;  5EEO A;  1NJI 4;  1IK3 A;  1SQW A;  3EN1 B;  4X2O A;  1Q86 4;  5G2G A;  1K9M 4;  1D6U A;  3Q2P A;  2LYX A;  4HM7 B;  1OHS A;  5CLK A;  4HM8 B;  3WOE B;  1FA3 A;  2K54 A;  3PZW A;  4G1M B;  4AEQ A;  1K41 A;  3S28 A;  2OTL 3;  5ELJ A;  3NBR A;  2P0X A;  2KCD A;  1VQ8 3;  5EVH A;  3CCE 3;  1N5H A;  1JKG A;  1JB2 A;  4TX4 A;  4K1U A;  1O7W B;  2XEP A;  3S5C A;  1VQ9 3;  1NO3 A;  4O8S A;  1EQK A;  3F8X A;  3DGN A;  1OH0 A;  1A90 A;  3KFQ C;  2Z77 A;  1QAF A;  4FMD A;  3LTB A;  2STD A;  2ML6 A;  1W2B 2;  1R4C A;  1NU3 A;  1K73 4;  2A15 A;  1W02 A;  4ORL A;  3LTA A;  5IEO A;  3FG3 A;  2CFG A;  1QVG 2;  3QRD A;  3S29 A;  1M1K 4;  5KP4 A;  3DUK A;  4HM2 B;  4HZ9 B;  3MG1 A;  4NRE A;  3UB1 A;  3K5T A;  3B4P A;  5FW5 A;  2BMR B;  4RBN A;  2HMK B;  3UL6 A;  1IT7 A;  3X3X A;  3D9R A;  2CWV A;  4KVH A;  3SED A;  1ZX2 A;  1M1X B;  2K0M A;  1US1 A;  3MYT A;  3TDG A;  1O7H B;  3NV0 A;  3CC7 3;  2D42 A;  3T0U A;  1VQO 3;  4BTW A;  4HYZ A;  1RN7 A;  2CFL A;  3BLZ A;  2OOV A;  3U1W A;  2HMO B;  7STD A;  1UUW B;  2YX9 A;  3Q1C A;  3SOY A;  2Z76 A;  3KII A;  4EXR A;  2I9W A;  3JUN A;  1YJN 3;  5STD A;  3RGR A;  4BTX A;  2OQE C;  2C10 A;  5IG3 A;  2CK3 H;  2GBW B;  4FCZ A;  3CME 3;  3CC4 3;  3LTD A;  3HII A;  4FMA A;  3V92 A;  1KSI A;  5EQL A;  3IJE B;  1ISK A;  5CK6 A;  1FGM A;  2W6J H;  3PYJ A;  2XR8 B;  1PU4 A;  1ULI B;  4EYC A;  3F7S A;  1KQS 2;  2Z7A A;  5IEN A;  1Q42 A;  4KFE A;  3NM7 A;  3G6E 3;  3DM8 A;  3T8U A;  3CU3 A;  3SX1 A;  3L0R A;  3PGB A;  5LC7 A;  2CWT A;  5FGO A;  1N8R 4;  3HK4 A;  1JV2 B;  1GYB A;  4U13 A;  1D6Z A;  4JRF A;  3CPO A;  3VF1 A;  3OX9 A;  2FXT A;  1QAL A;  2GU1 A;  3KSE D;  3PCR A;  1MOL A;  3EJV A;  5AIH A;  4HVN A;  2BMO B;  3SLU A;  2BNG A;  3NBB A;  1CYV A;  1UI8 A;  3N8B A;  3LXU X;  1EA2 A;  3BB9 A;  1AR0 A;  4AKY A;  4HBR A;  5AI1 A;  4XB5 A;  4I4K A;  3FF0 A;  2XFT A;  5D81 A;  3WMD A;  3GZB A;  5LC6 A;  1E3V A;  4WWU C;  1CQS A;  1QJG A;  1IVV A;  3U97 A;  1DMN A;  1EKM A;  4WHA A;  3FZW A;  3FSD A;  3NM2 A;  1YVB I;  3VSY A;  4N6V 0;  3CC2 3;  1LXE A;  3OWS A;  3CCJ 3;  4R9K A;  4ZM8 A;  2FGT A;  5KP1 A;  2KXG A;  2F99 A;  2CWU A;  3GZY B;  3X40 A;  3LT8 A;  3LZA A;  4R80 A;  1HU9 A;  3OV4 A;  2YFL B;  1JB4 A;  4STD A;  5DRE A;  1ZO2 A;  3FF2 A;  4XBY A;  3CCV 3;  1AVL A;  3JUP A;  1W6G A;  1ROA A;  1A2V A;  1FGO A;  4FMB A;  3G71 3;  2OWP A;  3FH1 A;  2INX A;  2XRX B;  1JNQ A;  2D1W A;  3G8Z A;  2HML B;  5CF1 A;  1VQN 3;  1Q81 4;  2PNC A;  3OWY A;  1EG9 B;  3VGN A;  1OAC A;  4FMC A;  4KZ1 A;  1TIJ A;  3OW2 2;  1W7C A;  1W6C A;  4K90 B;  1A67 A;  1VQP 3;  3UJM A;  2B24 B;  2GEY A;  4O3V A;  5JPU A;  2L4V A;  4IPB A;  2WGO A;  3EQQ B;  3G4S 3;  1ROV A;  1E97 A;  4HJL B;  2XH9 A;  3EB8 A;  1JJ2 2;  2V1L A;  2XSO B;  3B7C A;  5D82 A;  3WOD G;  1C7H A;  2PZV A;  5CXO A;  3MG3 A;  1IQX A;  4MJD A;  4RZM A;  3EX9 A;  3GZR A;  1CEW I;  2CH9 A;  1KWI A;  1N9J A;  1Q40 B;  4K61 A;  3RGA A;  1GD3 A;  3K7C A;  3SVA A;  2W04 A;  3MHE A;  4OK0 A;  3CNM A;  1RRH A;  3PCS A;  3V99 A;  2BO9 B;  1O7M B;  3BNE A;  3GZX B;  3K63 A;  4LSO A;  3N9H A;  2WO0 A;  4PEJ A;  2Q07 A;  2P09 A;  5HGR A;  3NQZ A;  2O9U X;  3GAX A;  3NUV A;  3UNL A;  4N6T A;  3EBY A;  4OVM A;  4O2H A;  3WOF B;  1UUV B;  3H51 A;  4XBT A;  1WQL B;  3X42 A;  1FGT A;  4GL6 A;  3HX8 A;  3SOA A;  4BTY A;  3DGL A;  3CD6 3;  3F7X A;  4X2H A;  1W2Z A;  1MNL A;  5ELU A;  1Q7Y 4;  1VZZ A;  3NHX A;  3LML A;  3I56 3;  1TU5 A;  2CFW A;  4FR9 A;  4HM3 B;  2ML5 A;  4MMY B;  2BHM A;  1OHO A;  2W9Q A;  3X41 A;  3CCQ 3;  1VQ7 3;  3JVC A;  2B1X B;  4CCV A;  3CXC 2;  3AMO A;  3CCR 3;  2OCT A;  1L5G B;  4XM4 A;  3MWZ A;  4HM5 B;  3LTC A;  3T8N A;  2GEX A;  3CCM 3;  4EV2 A;  5TGN A;  1RJO A;  1LOX A;  4GB5 A;  3CMA 3;  1M9G A;  3I0Y A;  2RSX A;  1VQ5 3;  1N9E A;  3NXJ A;  1W4N A;  2FNQ A;  3DGO A;  1VQ4 3;  1WMN A;  3K0Z A;  4WYK B;  3QK9 A;  3HZP A;  3D3L A;  3DMC A;  5AII A;  3WDG B;  1IT8 A;  1OGZ A;  3F40 A;  2XGN A;  4MMX B;  2YFI B;  3FCS B;  1NWW A;  8CHO A;  3EF8 A;  1YI2 3;  1VQL 3;  4MEI A;  3EN8 A;  3Q90 A;  3HI7 A;  5IW9 A;  5IG0 A;  2C11 A;  1M90 4;  4LMI A;  2O3O A;  1W6Y A;  1GD4 A;  4KFD A;  2HMM B;  4RNY A;  1N5P A;  3CCL 3;  5JPP A;  1N8Q A;  4LGQ A;  1UI7 A;  3LT9 A;  1SJW A;  6STD A;  3BND A;  3LH4 A;  1YJ9 3;  1WNH A;  4N6M A;  3I55 3;  3DY5 A;  1S72 3;  2E2T A;  3V98 A;  1LNH A;  4HM1 B;  2W56 A;  2Y74 A;  3IPT A;  2W56 B;  1RKY A;  3JUM A;  2JQ5 A;  1O7P B;  1GY6 A;  1S5A A;  2OOV C;  3A76 A;  1O7N B;  3K9M C;  4WYK A;  1LVN A;  1JN5 A;  1DMM A;  4RNZ A;  3MG2 A;  3NV0 B;  2IUJ A;  5AIF A;  2CFK A;  1K28 A;  4IIA A;  3CPW 2;  5CF2 A;  1WMP A;  4K1V A;  1G96 A;  3GWR A;  2WOF A;  2CG0 A;  1OHP A;  4N3V A;  4FCM A;  2MF7 A;  1U5O A;  3FG4 A;  3F9S A;  3AMO B;  3E99 A;  1QAK A;  5BVB A;  3WA2 X;  1QVF 2;  4HM0 B;  2ZL8 A;  3UL5 A;  2M7O A;  2IA7 A;  2WGQ A;  2QA4 3;  2W2C A;  1OUN A;  2BMQ B;  1GS3 A;  1IV9 A;  2OTJ 3;  3DZL A;  1UW1 A;  1YGE A;  1WTH A;  2BT3 A;  4XBX A;  4XDW A;  5JBS A;  1YJW 3;  1GY7 A;  1TFK A;  4H61 A;  3ECF A;  2P05 A;  2P0M A;  1VQ6 3;  2GU3 A;  5AYR B;  2HMN B;  2CKF B;  3KE7 A;  1O7G B;  1FGQ A;  3OXA A;  1IQY A;  4Q53 A;  1JRQ A;  3KN4 A;  4L7K A;  3KZT A;  4IT7 A;  2GXF A;  5DRV A;  4WFO A;  2XFS A;  5A0O B;  1OCV A;  4R9L A;  2W03 A;  1K8A 4;  4XDV A;  5AYS C;  2ZDJ A;  1TP6 A;  4R4K A;  5D83 A;  1NB5 I;  4AKZ A;  1YIT 3;  4N6L A;  4OUQ A;  3GRD A;  1OGX A;  2Y73 A;  3X3Z A;  2QEX 3;  3LOY A;  3OWU A;  2IUK A;  3NBJ A;  2QIY A;  1Y4K A;  3FKA A;  2SBL A;  4WP5 A;  3FG1 A;  1DVD A;  1FGR A;  4FCJ A;  4HKV B;  4LEH A;  2XGL A;  1OPY A;  2HMJ B;  1BUQ A;  3BNC A;  5BXQ A;  4HZB B;  2CHC A;  4CDL A;  1Q82 4;  1A2K A;  1J2B A;  3FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...