1GS3A

High resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVENPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAFWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of a Low-Barrier Hydrogen Bond to Catalysis by Delta-5-3-Ketosteroid Isomerase is not Extremely High Compared to that of an Ordinary Hydrogen Bond. Low-Barrier Hydrogen Bond of Pi Ksi
rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2001-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gs3A00
3JUOA 4HM4B 2XSHB 3EF8A 3VGNA 1WQLB 1BUQA 4LEHA 3UJMA 4HZ9B 4FCJA 1C7HA 3MG1A 3T8NA 3IPTA 4LGQA 3BB9A 2XSOB 3OWSA 1O7PB 2BMOB 3RGAA 2R4IA 1U5OA 5AEUB 2HMNB 1EG9B 3FF2A 5AIFA 1OGXA 5STDA 4XBXA 1ASKA 2GEXA 3NXJA 4XB5A 3WMDA 5AIHA 1Q40A 4PEJA 3EHCA 4IIAA 1OPYA 2QIYA 2INXA 3CPOA 3CNMA 1ISKA 1GY5A 3DMCA 1QJGA 3K0ZA 3LZAA 1DMMA 1TP6A 2BMRB 1DMQA 5AIGA 4N3VA 3FSDA 5CLKA 4XM4A 1NDOB 1HKXA 3K7CA 3STDA 3JUMA 1IDPA 3H3HA 3F7SA 3B8LA 3B4PA 2STDA 4HM6B 6STDA 4HZBB 2Z76A 3FLJA 3EJVA 1GS3A 3OXAA 1ZO2A 4CDLA 3HX8A 2GXFA 4X2OA 4J8TA 4HM5B 4HM3B 2K54A 1GY6A 3F40A 3BLZA 5D83A 1JKGB 1GYBA 5EVHA 2Z7AA 4GB5A 4KVHA 4WYKB 4K1VA 2XRXB 3Q90A 3LYGA 3MG2A 4L7KA 5AEWB 2YFIB 3FKAA 3EN8A 3NHXA 5IF6A 2JQ5A 1O7WB 3MKIA 3S5CA 1E3VA 5CF2A 3G0KA 2BMQB 2UX0A 4HKVB 3EBTA 1OHSA 3NV0B 4I4KA 1OF5B 1ULIB 3DZLA 3KE7A 3B7CA 4HM7B 4LMIA 1UUVB 5CF1A 3SOAA 1W00A 3MHEA 4R9LA 5DRVA 5KP1A 4HM1B 1SJWA 4HM0B 3VSYA 3OX9A 2F86B 1GY7A 3M8CA 2Z77A 1JB4A 3FGYA 1W01A 2RCDA 5IEPA 1A2KA 3D9RA 5FW5A 5JPPA 1OHPA 3FH1A 2XR8B 5CXOA 4K1UA 2B24B 1OGZA 2B1XB 3NM2A 5AIIA 4ORLA 1OH0A 5HGRA 5G2GA 5JPUA 2GBWB 3F9SA 5IENA 2W2CA 1O7NB 1W6YA 1Q40B 3H51A 1CQSA 3OWYA 5TGNA 1JB2A 3UNLA 4L8PA 3JUNA 3EN1B 2PZVA 3EQQB 1EA2A 3GZYB 4XBYA 3F8XA 5KP4A 1Z1SA 3T8UA 4STDA 4J9AA 3ER7A 3EC9A 3G8ZA 1JN5B 1JB5A 2HMKB 3CU3A 1AR0A 2F99A 5BXQA 1O7MB 3OWUA 4WWUC 7STDA 1S5AA 4U13A 3FF0A 3F14A 3NV0A 2I9WA 1Q42A 1OF5A 2CHCA 5D81A 1NWWA 5BVBA 2OWPA 3OV4A 3HZPA 3KKGA 5AI1A 3F8HA 2YFJB 3SOYA 3FZWA 2GBXB 1TUHA 1QMAA 2GEYA 1UUWB 2F98A 4R1KA 3GZXB 4HVNA 3GWRA 8CHOA 3E99A 4L8OA 1OUNA 1DMNA 1STDA 4WP5A 3EX9A 4HJLB 4Q53A 3JUQA 5IG0A 3KSPA 5IERA 4HM2B 3GZRA 5D82A 3A76A 2YFLB 2HMLB 3RGRA 2HMJB 1OCVA 3JUPA 3KZTA 5DREA 3F7XA 1JKGA 2RFRA 1JN5A 1E97A 5KP3A 1O7GB 3MYTA 1O7HB 4X2HA 2HMOB 3NBRA 4WYKA 4OVMA 3MG3A 4HM8B 3HK4A 4OUQA 3DM8A 3I0YA 1K41A 1ZX2A 1E3RA 3ECFA 4XDWA 4H3UA 1W02A 3MSOA 1OHOA 4FCMA 4XDVA 2BNGA 3GRDA 2CKFB 3SEDA 5IG5A 4RZMA 5IG3A 3B4OA 2A15A 3CNXA 5IEOA 5CK6A 4XBTA 3G16A 4R9KA 3NUVA 1ULJB 2QGUA 2IMJA 1NU3A 3EBYA 2RGQA 3ROBA 3GZBA 5IG4A 3DUKA 1VZZA 3DXOA 4MJDA 2HMMB
chains in the Genus database with same CATH superfamily
4N6UA 2WGQA 2CH9A 3JUOA 2ZDJA 1PU4A 4HM4B 2XGLA 3S67A 5HOHA 2XSHB 3EF8A 3NBJA 1WQLB 3VGNA 1UCJA 7GSPA 4LEHA 3UJMA 1BUQA 2W56B 4HZ9B 4FCJA 2QA43 1LQGC 1R4YA 2W03A 2KXGA 1IYYA 4R4KA 1C7HA 1X1XA 3MG1A 3T8NA 4CJNA 4KFEA 3N54B 2H0GA 2IY2A 1BNGA 1YNVX 3IPTA 4LGQA 3BB9A 3WOEB 2FNQA 3KIIA 4GHOA 2P0MA 2WOHA 2XSOB 3OWSA 3CCJ3 1WMOA 2P0XA 4MMZB 1O7PB 2BMOB 3RGAA 2Z6BA 2R4IA 1U5OA 5AEUB 1VQO3 2HMNB 2O3OA 1FYSA 1G0TA 2WGOA 3UB1A 1BRKA 1EG9B 4BL3A 1K734 3FF2A 2YX9A 3LH4A 3U97A 5AIFA 2H0IA 4LZIA 1OGXA 3OW22 2GU1A 5STDA 1HU9A 4XBXA 1RCKA 3LOYA 1ASKA 2GEXA 3NXJA 1UCLA 3X41A 1KWIA 1LNIA 4XB5A 1B2ZA 1Q40A 4PEJA 5AIHA 3WMDA 2J8XB 3EHCA 1F8NA 4IIAA 2CK3H 1FGOA 1UGHI 3LXUX 1BSAA 1BNIA 4HYZA 1OPYA 1W7CA 1MWSA 4O2HA 1BOXA 4KFFA 1M904 9RNTA 2P05A 1A90A 1I0VA 2Q07A 4FMAA 3DGYA 4BU4A 3LTDA 1T2HA 2QIYA 2INXA 1Q824 1JBTA 3CPOA 2LYXA 5GSPA 3CNMA 3TDGA 1SARA 2GU3A 1GY5A 1B21A 1ISKA 3DMCA 2XF3A 1QJGA 3K0ZA 2UUGC 3EB8A 3GAXA 2RBIA 4RNZA 3LZAA 5EQLA 3SXXA 1DMMA 1W5ZA 1RSNA 1LOYA 1TP6A 1RGCA 3U1WA 1TFKA 2BMRB 1RGGA 1DMQA 1JNQA 1UUGB 4KT3B 4EXRA 1VQ93 5AIGA 3CCV3 2L1SA 1YJ93 1ROVA 4JRFA 3KCHA 4N3VA 3FSDA 3PZWA 1BSEA 5CLKA 2C11A 4N6OB 1I3IA 2CG0A 1EEJA 1IVXA 4XM4A 1MGRA 1NDOB 1W4NA 1C54A 4AKZA 1BNFA 3CME3 1NO3A 2D42A 1RGAA 3HI7A 3IMAB 1N9JA 1HKXA 3S28A 3K63A 5BU4A 3DGMA 3K7CA 2IUJA 3STDA 1VQK3 3MWZA 3LMLA 1IVWA 1X1YA 1YIT3 1RRHA 6RNTA 1FW7A 2CWTA 4CCVA 1YI23 2FXTA 3JUMA 1IDPA 4NPBA 1TIJA 3H3HA 3JVCA 3F7SA 1NB5I 4N6MA 2OOVC 3B4PA 2STDA 3B8LA 4HM6B 3D5GA 6STDA 1UCIA 4HZBB 1RRLA 4BTYA 1RGHA 2Z76A 1SIHA 3ZG5A 4FMBA 3FLJA 3EJVA 1GS3A 3OXAA 1ZO2A 1MGWA 4CDLA 4R80A 1V74A 1PFPA 2W9PA 2W04A 3HX8A 3CCE3 2GXFA 1GOUA 4X2OA 2CIUA 4HM5B 4J8TA 4ZM8A 4HM3B 1SQWA 2K54A 1GY6A 1AVKA 3BLZA 3F40A 1BRSA 4J5KA 5D83A 1N9EA 2F5MA 3CCR3 5LC6A 2IYJA 1JKGB 5AYRB 1WMPA 1UGIA 1GYBA 8RNTA 1YGWA 1IQ8A 1A2PA 3FG3A 3D4AA 5EVHA 1RN7A 2Z7AA 4GB5A 2C4BA 1OACA 2CX0A 1YVBI 4KVHA 4WYKB 4K1VA 2XRXB 3WR2A 2CX1A 3Q90A 3LYGA 4EYCA 4NHFA 3MG2A 1Q7HA 4L7KA 1MWRA 1T5YA 5AEWB 1WNHA 2YFIB 3FKAA 1I70A 3PYJA 4ILFA 3AHSA 4O8SA 1JZOA 3EN8A 4EBGA 2WO0A 3NHXA 2W0QA 7RNTA 3PXMA 2KF6A 2JQ5A 5IF6A 3CCM3 1BSBA 1BUJA 1O7WB 2RSXA 3GSPA 4FR9A 1RGLA 4HBRA 2JDIH 3MKIA 3S5CA 4RNTA 3D79A 3HIIA 2KF3A 2CW9A 2GSPA 3NQZA 2SBLA 1MOLA 3WHOA 2AADA 2P09A 1E3VA 1X1UA 1BRHA 4OK0A 3LTBA 5CF2A 1JZDA 3G0KA 3DY5A 1WTHA 2BMQB 2UX0A 4HKVB 1RGKA 3J7Yd 2E2TA 3S27A 1YJW3 1RTUA 3EBTA 3PCRA 3VF1A 1A2VA 3CC73 1OHSA 4MEIA 2W6JH 3NV0B 2W9QA 4I4KA 2M7OA 1OF5B 3QK9A 1RNTA 1I2EA 1ULIB 1UI7A 5BIRA 3CPW2 3DZLA 3KE7A 3B7CA 3A5EA 1D6UA 4HM7B 4LMIA 4BL2A 3LTCA 3PS8A 3CCQ3 1ROAA 1US1A 1J2BA 1JBRA 4FCZA 3K5TA 2OTL3 3L0RA 1VQN3 1UUVB 1BANA 1ZGXA 4EW5A 1UCKA 3CD63 5CF1A 1RLSA 3NBBA 3BNDA 3CMA3 1JBSA 2OQEA 1V57A 4H61A 4MMYB 3V98A 3SOAA 1W00A 3MHEA 4R9LA 1QAFA 5DRVA 3X3XA 3CCL3 1JV2B 5KP1A 4HM1B 1SJWA 4HM0B 3VSYA 1AV4A 2BO9B 2QEX3 1GSPA 1BGSA 2CFDA 2OTJ3 3SYUA 2ML6A 3BNCA 3OX9A 1GOYA 1KSIA 1RN4A 2F86B 2K3DA 1L5GB 2ZA4A 2KF4A 1GY7A 6GSPA 1TFOA 3M8CA 1TTOA 2Z77A 1JB4A 3N9HA 1LOVA 3FGYA 4N6NB 1W01A 2RCDA 1VQP3 1PY3A 5IEPA 1A2KA 1RDSA 3D9RA 5FW5A 5JPPA 3D3LA 1OHPA 4FMCA 1VQ63 1W2ZA 1RMSA 3FH1A 2BHMA 2XR8B 2F4YA 5CXOA 1VQM3 4K1UA 2B24B 3N8BA 2PNCA 3AMOA 1OGZA 3ZFZA 1G96A 1G02A 2B1XB 3NM2A 5AIIA 5M18A 4ORLA 1OH0A 4G1MB 1U8CB 5HGRA 1WMNA 1B20A 1X1WA 5G2GA 5JPUA 4QWTA 2GBWB 1VQQA 3F9SA 4HAAA 5IENA 3HOHA 1W6CA 4EV5A 1EUIC 1MNLA 2W2CA 1Q814 2F5WA 1O7NB 3ALAA 1LOXA 1IVUA 1GMPA 1B3SA 1Q40B 1W6YA 1CQSA 2CFGA 3H51A 3OWYA 5TGNA 4AEQA 5IW9A 1UI8A 1JB2A 3WOFB 1TU5A 1NJI4 5FGOA 4WFOA 4JF8A 2XEPA 1LOWA 3UNLA 2CFLA 4L8PA 1IV7A 4EC6A 3JUNA 3EN1B 1TRPA 1NNVA 2PZVA 1N5PA 3EQQB 1EA2A 2MC8A 3V99A 3GZYB 1BRGA 4XBYA 1RKYA 2CG1A 3D5IA 3F8XA 1FUSA 1RGEA 5KP4A 1CH0A 1I2GA 1Z1SA 3T8UA 2BIRA 1K9M4 4STDA 1BAOA 1B27A 4J9AA 2XFSA 3ER7A 3T0UA 1VQL3 2W56A 3BNBA 3EC9A 3G8ZA 4HOHA 3Q1CA 1JN5B 2CWUA 3K9MC 3Q2PA 2XGNA 3I563 1AVLA 4WHAA 1I8VA 3G713 1JB5A 2LQVA 4GL6A 1IT8A 4N6V0 1LRAA 3RDEA 1RJOA 2HMKB 2L4VA 3CU3A 3DGLA 1AR0A 2F99A 3CCU3 5BXQA 1Q864 1VQ43 1GMRA 1O7MB 1RCLA 3OWUA 3V92A 4RNYA 2BT3A 4WWUC 7STDA 1S5AA 4U13A 3FF0A 3F14A 3NV0A 2I9WA 1Q42A 1Y4KA 4AKYA 1OF5A 3HIGA 4BTXA 1FUWA 1IVVA 1K8A4 2MF7A 1K28A 2CHCA 5D81A 4NREA 1NWWA 3UL6A 1EQKA 1T2IA 3WODG 1YHQ3 5BVBA 1BNJA 4TX4A 4MMXB 3CCS3 1CYUA 2OWPA 3OV4A 1MWUA 1DVCA 4DKIA 2H0HA 1PYLA 3UL5A 4I5QA 3X3YA 2XH9A 3HZPA 5G1LA 2KRTA 1YVSA 3X42A 3AGNA 3DH2A 3G4S3 4O3VA 1DETA 3LTAA 1DYUA 2XFTA 3O8YA 1W2B2 1KQS2 5G1KA 1A67A 2ZHXB 3RNTA 3AHWA 3KKGA 3SLUA 4BIRA 1S723 4RBNA 1D6YA 5AI1A 1R4CA 3LT9A 3F8HA 2YFJB 3FZWA 3SOYA 2GBXB 1BNEA 1NB3I 1TUHA 2FGTA 1QMAA 4EV2A 1BU4A 1STFI 4O02B 3URPA 1Q7Y4 3KN4A 2OCTA 2C10A 1FA3A 3SVAA 2Y74A 1B2XA 2OOVA 2ML5A 2GEYA 1IQXA 1BRNL 1UUWB 4N6LA 2F98A 3X40A 1TJDA 3S29A 4R1KA 3GZXB 3BIRA 4J5GA 4HVNA 3GWRA 8CHOA 3E99A 4L8OA 1OUNA 3BU4A 1T3BA 1RHLA 1DMNA 1FGMA 1I2FA 1YGEA 3FG4A 1VQ73 2KF5A 1I3FA 2Y73A 1STDA 4N6TA 1RNBA 1VQ53 1IK3A 4WP5A 3CXC2 2IUKA 1QAKA 2HMMB 2AAEA 1HZ1A 2BU4A 3KSED 1RN1A 2K0MA 1FZUA 3EX9A 5I97A 1Q9EA 4HJLB 3G6E3 4K61A 1MWTA 4Q53A 5M19A 3PGBA 3JUQA 1JRQA 3PCSA 3LT8A 4LSOA 2E2UA 1TRQA 5IG0A 1B2SA 2V1LA 3KSPA 3WA3A 5IERA 1BRIA 1CYVA 4HM2B 1N5HA 3GZRA 5D82A 2HOHA 3A76A 5JBSA 2YFLB 2HMLB 2SARA 3DGNA 5ELJA 1GOVA 1CEWI 1B2UA 3RGRA 3Q3FA 1QALA 1D6ZA 1LQMB 1AQZA 2HMJB 1OCVA 1VQ83 1IV9A 1LXEA 3JUPA 3EE1A 3KZTA 5DREA 3KFQC 3F7XA 1JKGA 2RFRA 1JN5A 1E97A 4IPBA 1BSDA 3I553 5KP3A 1DVDA 1BRJA 1O7GB 3MYTA 1M1XB 3NM7A 1O7HB 4X2HA 2HMOB 3NBRA 4WYKA 3SX1A 4OVMA 1LVNA 2CWVA 1N8QA 1ZS7A 3MG3A 4HM8B 3HK4A 3FCSB 4OUQA 1FGTA 3DM8A 1LNHA 3I0YA 1E3RA 1K41A 1RGFA 1ZX2A 1M9GA 2WOFA 3ECFA 4LYLB 1UW1A 3WDGB 5LC7A 1JJ22 4IT7A 3MPHA 3AGOA 4XDWA 1KC84 1GD4A 1SIIA 3NX0A 5AYSC 1KD14 4KFDA 1B2MA 1HYFA 1IT7A 5EEOA 1BSCA 2ZL8A 2IA7A 4H3UA 1QVF2 3FG1A 4KZ1A 5A0OB 1GD3A 1W02A 2CC3A 1IU7A 2P38A 4BTWA 1YIJ3 3CC43 1AY7A 1YJN3 3ZG0A 3MSOA 1OHOA 1BVIA 4FCMA 1BNRA 1FGRA 2OQEC 1FUTA 4XDVA 2BNGA 1M1K4 1FGQA 2RNTA 1BIRA 2F56A 1EKMA 3GRDA 2CFKA 1UDII 2CKFB 1DE3A 3AMOB 3SEDA 5IG5A 4RZMA 5IG3A 4CPKA 3B4OA 2A15A 2R41A 3CNXA 3QRDA 5IEOA 5CK6A 4XBTA 3G16A 4R9KA 3BNEA 2D1WA 2KAAA 4FMDA 2O9UX 3NUVA 4GSPA 3CC23 3X3ZA 1SPUA 1N8R4 1ULJB 2QGUA 2IMJA 5ELUA 5RNTA 1NU3A 3NQYA 1BNSA 3EBYA 1I0XA 3WA2X 2CFWA 2KCDA 2RGQA 3ROBA 1QVG2 3GZBA 1IQYA 3DGOA 3DUKA 5IG4A 5M1AA 1VZZA 3IJEB 3DXOA 2E2VA 4K90B 4MJDA 2UGIA 1V58A 1W6GA 1GMQA
chains in the Genus database with same CATH topology
4N6UA 2WGQA 2CH9A 3JUOA 2ZDJA 1PU4A 4HM4B 2XGLA 3S67A 2XSHB 3EF8A 3NBJA 1WQLB 3VGNA 1BUQA 4LEHA 3UJMA 2W56B 4HZ9B 4FCJA 2QA43 2W03A 2KXGA 4R4KA 1C7HA 3MG1A 3T8NA 4KFEA 3N54B 3IPTA 4LGQA 3BB9A 3WOEB 2FNQA 3KIIA 2P0MA 2WOHA 2XSOB 3OWSA 3CCJ3 1WMOA 2P0XA 4MMZB 1O7PB 2BMOB 3RGAA 2Z6BA 2R4IA 1U5OA 5AEUB 1VQO3 2HMNB 2O3OA 3UB1A 2WGOA 1EG9B 1K734 3FF2A 2YX9A 3LH4A 3U97A 5AIFA 4LZIA 3OW22 1OGXA 2GU1A 5STDA 1HU9A 4XBXA 3LOYA 1ASKA 2GEXA 3NXJA 3X41A 1KWIA 4XB5A 3WMDA 5AIHA 1Q40A 4PEJA 3EHCA 1F8NA 4IIAA 2CK3H 1FGOA 3LXUX 4HYZA 1OPYA 1W7CA 1M904 4O2HA 4KFFA 1A90A 2P05A 2Q07A 4FMAA 3LTDA 2QIYA 1Q824 2INXA 3CPOA 2LYXA 3TDGA 3CNMA 1ISKA 2GU3A 1GY5A 3DMCA 2XF3A 1QJGA 3K0ZA 5EQLA 3EB8A 3GAXA 4RNZA 3SXXA 3LZAA 1DMMA 1W5ZA 1TP6A 3U1WA 1TFKA 2BMRB 1DMQA 1JNQA 4EXRA 1VQ93 5AIGA 3CCV3 1YJ93 1ROVA 4JRFA 4N3VA 3FSDA 3PZWA 5CLKA 2C11A 4N6OB 2CG0A 1IVXA 4XM4A 1NDOB 1W4NA 4AKZA 3CME3 1NO3A 2D42A 3HI7A 3IMAB 1N9JA 1HKXA 3S28A 3K63A 3DGMA 3K7CA 2IUJA 3STDA 1VQK3 3MWZA 3LMLA 1IVWA 1YIT3 1RRHA 2CWTA 4CCVA 1YI23 2FXTA 3JUMA 1IDPA 1TIJA 3H3HA 3JVCA 3F7SA 1NB5I 4N6MA 2OOVC 3B4PA 2STDA 3B8LA 4HM6B 6STDA 4HZBB 1RRLA 4BTYA 2Z76A 1SIHA 4FMBA 3FLJA 3EJVA 1GS3A 3OXAA 1ZO2A 4CDLA 4R80A 1V74A 1PFPA 2W9PA 2W04A 3HX8A 3CCE3 2GXFA 4X2OA 2CIUA 4HM5B 4J8TA 4ZM8A 4HM3B 1SQWA 2K54A 1GY6A 1AVKA 3BLZA 3F40A 5D83A 1N9EA 3CCR3 5LC6A 1JKGB 5AYRB 1WMPA 1GYBA 1IQ8A 3FG3A 5EVHA 1RN7A 2Z7AA 4GB5A 1OACA 1YVBI 4KVHA 4WYKB 4K1VA 2XRXB 3Q90A 3LYGA 4EYCA 4NHFA 3MG2A 4L7KA 1T5YA 5AEWB 1WNHA 2YFIB 3FKAA 3PYJA 4O8SA 3EN8A 4EBGA 2WO0A 3NHXA 2W0QA 3PXMA 5IF6A 2JQ5A 3CCM3 1O7WB 2RSXA 4FR9A 4HBRA 2JDIH 3MKIA 3S5CA 3HIIA 2CW9A 3NQZA 2SBLA 1MOLA 2P09A 1E3VA 4OK0A 3LTBA 5CF2A 3G0KA 3DY5A 1WTHA 2BMQB 2UX0A 4HKVB 3J7Yd 2E2TA 3S27A 1YJW3 3CC73 3EBTA 3PCRA 3VF1A 1A2VA 1OHSA 4MEIA 2W6JH 3NV0B 2W9QA 4I4KA 2M7OA 1OF5B 3QK9A 1ULIB 1UI7A 3CPW2 3DZLA 3KE7A 3B7CA 3CCQ3 1D6UA 4HM7B 4LMIA 3LTCA 3PS8A 1J2BA 1ROAA 1US1A 4FCZA 3K5TA 2OTL3 3L0RA 1VQN3 1UUVB 3CD63 5CF1A 3NBBA 3BNDA 2OQEA 4H61A 4MMYB 3V98A 3SOAA 1W00A 3MHEA 4R9LA 1QAFA 5DRVA 3X3XA 1JV2B 5KP1A 4HM1B 1SJWA 4HM0B 3VSYA 1AV4A 2BO9B 2QEX3 3CCL3 2OTJ3 2CFDA 2ML6A 3BNCA 3OX9A 1KSIA 2F86B 1L5GB 1GY7A 1TFOA 3M8CA 2Z77A 4N6NB 1JB4A 3N9HA 1VQP3 3FGYA 1W01A 2RCDA 5IEPA 1A2KA 3D9RA 5FW5A 5JPPA 3D3LA 1OHPA 4FMCA 1VQ63 1W2ZA 3FH1A 2BHMA 2XR8B 5CXOA 1VQM3 4K1UA 2B24B 3N8BA 2PNCA 3AMOA 1OGZA 1G96A 2B1XB 3NM2A 5AIIA 4ORLA 1OH0A 4G1MB 1U8CB 5HGRA 1WMNA 5G2GA 5JPUA 4QWTA 2GBWB 3F9SA 5IENA 1W6CA 4EV5A 1MNLA 2W2CA 1Q814 1O7NB 3ALAA 1LOXA 1IVUA 1W6YA 1Q40B 2CFGA 3H51A 1CQSA 3OWYA 4AEQA 5IW9A 5TGNA 1UI8A 1JB2A 3WOFB 1TU5A 1NJI4 5FGOA 4WFOA 4JF8A 2XEPA 3UNLA 2CFLA 4L8PA 1IV7A 4EC6A 3JUNA 3EN1B 2PZVA 1N5PA 3EQQB 1EA2A 2MC8A 3V99A 3GZYB 4XBYA 1RKYA 2CG1A 3F8XA 5KP4A 1Z1SA 3T8UA 1K9M4 4STDA 4J9AA 2XFSA 3ER7A 3T0UA 1VQL3 2W56A 3BNBA 3EC9A 3G8ZA 3Q1CA 1JN5B 2CWUA 3K9MC 3Q2PA 2XGNA 3I563 1AVLA 4WHAA 3G713 1JB5A 2LQVA 4GL6A 1IT8A 4N6V0 3RDEA 1RJOA 2HMKB 2L4VA 3CU3A 3DGLA 1AR0A 2F99A 3CCU3 5BXQA 1Q864 1VQ43 1O7MB 3V92A 3OWUA 4RNYA 2BT3A 4WWUC 7STDA 1S5AA 4U13A 3FF0A 3F14A 3NV0A 2I9WA 1Q42A 1Y4KA 4AKYA 1OF5A 3HIGA 4BTXA 1FUWA 1IVVA 1K8A4 2MF7A 1K28A 2CHCA 5D81A 4NREA 1NWWA 3UL6A 1EQKA 3WODG 1YHQ3 5BVBA 4TX4A 4MMXB 3CCS3 1CYUA 2OWPA 3OV4A 1DVCA 3UL5A 3X3YA 2XH9A 3HZPA 2KRTA 3X42A 3G4S3 4O3VA 3LTAA 1DYUA 2XFTA 3O8YA 1W2B2 1KQS2 1A67A 3KKGA 3SLUA 1S723 4RBNA 1D6YA 5AI1A 1R4CA 3LT9A 3F8HA 2YFJB 3FZWA 3SOYA 2GBXB 1NB3I 2FGTA 1TUHA 1QMAA 4EV2A 1STFI 4O02B 1Q7Y4 3KN4A 2OCTA 2C10A 1FA3A 3SVAA 2Y74A 2OOVA 2ML5A 2GEYA 1IQXA 1UUWB 4N6LA 2F98A 3X40A 3S29A 4R1KA 3GZXB 4HVNA 3GWRA 8CHOA 3E99A 4L8OA 1OUNA 1DMNA 1FGMA 1YGEA 3FG4A 1VQ73 2Y73A 1STDA 4N6TA 1VQ53 1IK3A 4WP5A 3CXC2 2IUKA 1QAKA 3KSED 2K0MA 3EX9A 5I97A 4HJLB 3G6E3 4K61A 4Q53A 3PGBA 3JUQA 1JRQA 3PCSA 3LT8A 4LSOA 2E2UA 5IG0A 2V1LA 3KSPA 3WA3A 5IERA 1CYVA 4HM2B 1N5HA 3GZRA 5D82A 3A76A 5JBSA 2YFLB 2HMLB 3DGNA 5ELJA 3RGRA 1CEWI 1QALA 1D6ZA 2HMJB 1OCVA 1VQ83 1IV9A 1LXEA 3JUPA 3EE1A 3KZTA 5DREA 3KFQC 3F7XA 1JKGA 2RFRA 1JN5A 1E97A 4IPBA 3I553 5KP3A 1DVDA 1O7GB 3MYTA 1M1XB 3NM7A 1O7HB 4X2HA 2HMOB 3NBRA 4WYKA 3SX1A 4OVMA 1LVNA 2CWVA 1N8QA 3MG3A 4HM8B 3HK4A 3FCSB 4OUQA 1FGTA 3DM8A 1LNHA 3I0YA 1E3RA 1K41A 1ZX2A 3ECFA 1M9GA 2WOFA 3WDGB 1JJ22 1UW1A 3CMA3 5LC7A 4IT7A 3MPHA 1KC84 4XDWA 1GD4A 1SIIA 3NX0A 5AYSC 1KD14 4KFDA 1IT7A 5EEOA 2ZL8A 2IA7A 4H3UA 1QVF2 3FG1A 4KZ1A 5A0OB 1GD3A 1W02A 2CC3A 1IU7A 2P38A 4BTWA 1YIJ3 3CC43 1YJN3 3MSOA 1OHOA 4FCMA 1FGRA 2OQEC 4XDVA 2BNGA 1M1K4 1FGQA 1EKMA 3GRDA 2CFKA 2CKFB 3AMOB 3SEDA 5IG5A 4RZMA 5IG3A 3B4OA 2A15A 3CNXA 3QRDA 5IEOA 5CK6A 4XBTA 3G16A 4R9KA 3BNEA 2D1WA 4FMDA 2O9UX 3NUVA 3CC23 3X3ZA 1SPUA 1N8R4 1ULJB 2QGUA 2IMJA 5ELUA 1NU3A 3NQYA 3EBYA 3WA2X 2CFWA 2KCDA 2RGQA 3ROBA 1QVG2 3GZBA 1IQYA 3DGOA 3DUKA 5IG4A 1VZZA 3IJEB 3DXOA 2E2VA 4K90B 4MJDA 1W6GA 2HMMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUO A;  4HM4 B;  2XSH B;  3EF8 A;  3VGN A;  1WQL B;  1BUQ A;  4LEH A;  3UJM A;  4HZ9 B;  4FCJ A;  1C7H A;  3MG1 A;  3T8N A;  3IPT A;  4LGQ A;  3BB9 A;  2XSO B;  3OWS A;  1O7P B;  2BMO B;  3RGA A;  2R4I A;  1U5O A;  5AEU B;  2HMN B;  1EG9 B;  3FF2 A;  5AIF A;  1OGX A;  5STD A;  4XBX A;  1ASK A;  2GEX A;  3NXJ A;  4XB5 A;  3WMD A;  5AIH A;  1Q40 A;  4PEJ A;  3EHC A;  4IIA A;  1OPY A;  2QIY A;  2INX A;  3CPO A;  3CNM A;  1ISK A;  1GY5 A;  3DMC A;  1QJG A;  3K0Z A;  3LZA A;  1DMM A;  1TP6 A;  2BMR B;  1DMQ A;  5AIG A;  4N3V A;  3FSD A;  5CLK A;  4XM4 A;  1NDO B;  1HKX A;  3K7C A;  3STD A;  3JUM A;  1IDP A;  3H3H A;  3F7S A;  3B8L A;  3B4P A;  2STD A;  4HM6 B;  6STD A;  4HZB B;  2Z76 A;  3FLJ A;  3EJV A;  1GS3 A;  3OXA A;  1ZO2 A;  4CDL A;  3HX8 A;  2GXF A;  4X2O A;  4J8T A;  4HM5 B;  4HM3 B;  2K54 A;  1GY6 A;  3F40 A;  3BLZ A;  5D83 A;  1JKG B;  1GYB A;  5EVH A;  2Z7A A;  4GB5 A;  4KVH A;  4WYK B;  4K1V A;  2XRX B;  3Q90 A;  3LYG A;  3MG2 A;  4L7K A;  5AEW B;  2YFI B;  3FKA A;  3EN8 A;  3NHX A;  5IF6 A;  2JQ5 A;  1O7W B;  3MKI A;  3S5C A;  1E3V A;  5CF2 A;  3G0K A;  2BMQ B;  2UX0 A;  4HKV B;  3EBT A;  1OHS A;  3NV0 B;  4I4K A;  1OF5 B;  1ULI B;  3DZL A;  3KE7 A;  3B7C A;  4HM7 B;  4LMI A;  1UUV B;  5CF1 A;  3SOA A;  1W00 A;  3MHE A;  4R9L A;  5DRV A;  5KP1 A;  4HM1 B;  1SJW A;  4HM0 B;  3VSY A;  3OX9 A;  2F86 B;  1GY7 A;  3M8C A;  2Z77 A;  1JB4 A;  3FGY A;  1W01 A;  2RCD A;  5IEP A;  1A2K A;  3D9R A;  5FW5 A;  5JPP A;  1OHP A;  3FH1 A;  2XR8 B;  5CXO A;  4K1U A;  2B24 B;  1OGZ A;  2B1X B;  3NM2 A;  5AII A;  4ORL A;  1OH0 A;  5HGR A;  5G2G A;  5JPU A;  2GBW B;  3F9S A;  5IEN A;  2W2C A;  1O7N B;  1W6Y A;  1Q40 B;  3H51 A;  1CQS A;  3OWY A;  5TGN A;  1JB2 A;  3UNL A;  4L8P A;  3JUN A;  3EN1 B;  2PZV A;  3EQQ B;  1EA2 A;  3GZY B;  4XBY A;  3F8X A;  5KP4 A;  1Z1S A;  3T8U A;  4STD A;  4J9A A;  3ER7 A;  3EC9 A;  3G8Z A;  1JN5 B;  1JB5 A;  2HMK B;  3CU3 A;  1AR0 A;  2F99 A;  5BXQ A;  1O7M B;  3OWU A;  4WWU C;  7STD A;  1S5A A;  4U13 A;  3FF0 A;  3F14 A;  3NV0 A;  2I9W A;  1Q42 A;  1OF5 A;  2CHC A;  5D81 A;  1NWW A;  5BVB A;  2OWP A;  3OV4 A;  3HZP A;  3KKG A;  5AI1 A;  3F8H A;  2YFJ B;  3SOY A;  3FZW A;  2GBX B;  1TUH A;  1QMA A;  2GEY A;  1UUW B;  2F98 A;  4R1K A;  3GZX B;  4HVN A;  3GWR A;  8CHO A;  3E99 A;  4L8O A;  1OUN A;  1DMN A;  1STD A;  4WP5 A;  3EX9 A;  4HJL B;  4Q53 A;  3JUQ A;  5IG0 A;  3KSP A;  5IER A;  4HM2 B;  3GZR A;  5D82 A;  3A76 A;  2YFL B;  2HML B;  3RGR A;  2HMJ B;  1OCV A;  3JUP A;  3KZT A;  5DRE A;  3F7X A;  1JKG A;  2RFR A;  1JN5 A;  1E97 A;  5KP3 A;  1O7G B;  3MYT A;  1O7H B;  4X2H A;  2HMO B;  3NBR A;  4WYK A;  4OVM A;  3MG3 A;  4HM8 B;  3HK4 A;  4OUQ A;  3DM8 A;  3I0Y A;  1K41 A;  1ZX2 A;  1E3R A;  3ECF A;  4XDW A;  4H3U A;  1W02 A;  3MSO A;  1OHO A;  4FCM A;  4XDV A;  2BNG A;  3GRD A;  2CKF B;  3SED A;  5IG5 A;  4RZM A;  5IG3 A;  3B4O A;  2A15 A;  3CNX A;  5IEO A;  5CK6 A;  4XBT A;  3G16 A;  4R9K A;  3NUV A;  1ULJ B;  2QGU A;  2IMJ A;  1NU3 A;  3EBY A;  2RGQ A;  3ROB A;  3GZB A;  5IG4 A;  3DUK A;  1VZZ A;  3DXO A;  4MJD A;  2HMM B; 
#chains in the Genus database with same CATH topology
 4N6U A;  2WGQ A;  2CH9 A;  3JUO A;  2ZDJ A;  1PU4 A;  4HM4 B;  2XGL A;  3S67 A;  5HOH A;  2XSH B;  3EF8 A;  3NBJ A;  1WQL B;  3VGN A;  1UCJ A;  7GSP A;  4LEH A;  3UJM A;  1BUQ A;  2W56 B;  4HZ9 B;  4FCJ A;  2QA4 3;  1LQG C;  1R4Y A;  2W03 A;  2KXG A;  1IYY A;  4R4K A;  1C7H A;  1X1X A;  3MG1 A;  3T8N A;  4CJN A;  4KFE A;  3N54 B;  2H0G A;  2IY2 A;  1BNG A;  1YNV X;  3IPT A;  4LGQ A;  3BB9 A;  3WOE B;  2FNQ A;  3KII A;  4GHO A;  2P0M A;  2WOH A;  2XSO B;  3OWS A;  3CCJ 3;  1WMO A;  2P0X A;  4MMZ B;  1O7P B;  2BMO B;  3RGA A;  2Z6B A;  2R4I A;  1U5O A;  5AEU B;  1VQO 3;  2HMN B;  2O3O A;  1FYS A;  1G0T A;  2WGO A;  3UB1 A;  1BRK A;  1EG9 B;  4BL3 A;  1K73 4;  3FF2 A;  2YX9 A;  3LH4 A;  3U97 A;  5AIF A;  2H0I A;  4LZI A;  1OGX A;  3OW2 2;  2GU1 A;  5STD A;  1HU9 A;  4XBX A;  1RCK A;  3LOY A;  1ASK A;  2GEX A;  3NXJ A;  1UCL A;  3X41 A;  1KWI A;  1LNI A;  4XB5 A;  1B2Z A;  1Q40 A;  4PEJ A;  5AIH A;  3WMD A;  2J8X B;  3EHC A;  1F8N A;  4IIA A;  2CK3 H;  1FGO A;  1UGH I;  3LXU X;  1BSA A;  1BNI A;  4HYZ A;  1OPY A;  1W7C A;  1MWS A;  4O2H A;  1BOX A;  4KFF A;  1M90 4;  9RNT A;  2P05 A;  1A90 A;  1I0V A;  2Q07 A;  4FMA A;  3DGY A;  4BU4 A;  3LTD A;  1T2H A;  2QIY A;  2INX A;  1Q82 4;  1JBT A;  3CPO A;  2LYX A;  5GSP A;  3CNM A;  3TDG A;  1SAR A;  2GU3 A;  1GY5 A;  1B21 A;  1ISK A;  3DMC A;  2XF3 A;  1QJG A;  3K0Z A;  2UUG C;  3EB8 A;  3GAX A;  2RBI A;  4RNZ A;  3LZA A;  5EQL A;  3SXX A;  1DMM A;  1W5Z A;  1RSN A;  1LOY A;  1TP6 A;  1RGC A;  3U1W A;  1TFK A;  2BMR B;  1RGG A;  1DMQ A;  1JNQ A;  1UUG B;  4KT3 B;  4EXR A;  1VQ9 3;  5AIG A;  3CCV 3;  2L1S A;  1YJ9 3;  1ROV A;  4JRF A;  3KCH A;  4N3V A;  3FSD A;  3PZW A;  1BSE A;  5CLK A;  2C11 A;  4N6O B;  1I3I A;  2CG0 A;  1EEJ A;  1IVX A;  4XM4 A;  1MGR A;  1NDO B;  1W4N A;  1C54 A;  4AKZ A;  1BNF A;  3CME 3;  1NO3 A;  2D42 A;  1RGA A;  3HI7 A;  3IMA B;  1N9J A;  1HKX A;  3S28 A;  3K63 A;  5BU4 A;  3DGM A;  3K7C A;  2IUJ A;  3STD A;  1VQK 3;  3MWZ A;  3LML A;  1IVW A;  1X1Y A;  1YIT 3;  1RRH A;  6RNT A;  1FW7 A;  2CWT A;  4CCV A;  1YI2 3;  2FXT A;  3JUM A;  1IDP A;  4NPB A;  1TIJ A;  3H3H A;  3JVC A;  3F7S A;  1NB5 I;  4N6M A;  2OOV C;  3B4P A;  2STD A;  3B8L A;  4HM6 B;  3D5G A;  6STD A;  1UCI A;  4HZB B;  1RRL A;  4BTY A;  1RGH A;  2Z76 A;  1SIH A;  3ZG5 A;  4FMB A;  3FLJ A;  3EJV A;  1GS3 A;  3OXA A;  1ZO2 A;  1MGW A;  4CDL A;  4R80 A;  1V74 A;  1PFP A;  2W9P A;  2W04 A;  3HX8 A;  3CCE 3;  2GXF A;  1GOU A;  4X2O A;  2CIU A;  4HM5 B;  4J8T A;  4ZM8 A;  4HM3 B;  1SQW A;  2K54 A;  1GY6 A;  1AVK A;  3BLZ A;  3F40 A;  1BRS A;  4J5K A;  5D83 A;  1N9E A;  2F5M A;  3CCR 3;  5LC6 A;  2IYJ A;  1JKG B;  5AYR B;  1WMP A;  1UGI A;  1GYB A;  8RNT A;  1YGW A;  1IQ8 A;  1A2P A;  3FG3 A;  3D4A A;  5EVH A;  1RN7 A;  2Z7A A;  4GB5 A;  2C4B A;  1OAC A;  2CX0 A;  1YVB I;  4KVH A;  4WYK B;  4K1V A;  2XRX B;  3WR2 A;  2CX1 A;  3Q90 A;  3LYG A;  4EYC A;  4NHF A;  3MG2 A;  1Q7H A;  4L7K A;  1MWR A;  1T5Y A;  5AEW B;  1WNH A;  2YFI B;  3FKA A;  1I70 A;  3PYJ A;  4ILF A;  3AHS A;  4O8S A;  1JZO A;  3EN8 A;  4EBG A;  2WO0 A;  3NHX A;  2W0Q A;  7RNT A;  3PXM A;  2KF6 A;  2JQ5 A;  5IF6 A;  3CCM 3;  1BSB A;  1BUJ A;  1O7W B;  2RSX A;  3GSP A;  4FR9 A;  1RGL A;  4HBR A;  2JDI H;  3MKI A;  3S5C A;  4RNT A;  3D79 A;  3HII A;  2KF3 A;  2CW9 A;  2GSP A;  3NQZ A;  2SBL A;  1MOL A;  3WHO A;  2AAD A;  2P09 A;  1E3V A;  1X1U A;  1BRH A;  4OK0 A;  3LTB A;  5CF2 A;  1JZD A;  3G0K A;  3DY5 A;  1WTH A;  2BMQ B;  2UX0 A;  4HKV B;  1RGK A;  3J7Y d;  2E2T A;  3S27 A;  1YJW 3;  1RTU A;  3EBT A;  3PCR A;  3VF1 A;  1A2V A;  3CC7 3;  1OHS A;  4MEI A;  2W6J H;  3NV0 B;  2W9Q A;  4I4K A;  2M7O A;  1OF5 B;  3QK9 A;  1RNT A;  1I2E A;  1ULI B;  1UI7 A;  5BIR A;  3CPW 2;  3DZL A;  3KE7 A;  3B7C A;  3A5E A;  1D6U A;  4HM7 B;  4LMI A;  4BL2 A;  3LTC A;  3PS8 A;  3CCQ 3;  1ROA A;  1US1 A;  1J2B A;  1JBR A;  4FCZ A;  3K5T A;  2OTL 3;  3L0R A;  1VQN 3;  1UUV B;  1BAN A;  1ZGX A;  4EW5 A;  1UCK A;  3CD6 3;  5CF1 A;  1RLS A;  3NBB A;  3BND A;  3CMA 3;  1JBS A;  2OQE A;  1V57 A;  4H61 A;  4MMY B;  3V98 A;  3SOA A;  1W00 A;  3MHE A;  4R9L A;  1QAF A;  5DRV A;  3X3X A;  3CCL 3;  1JV2 B;  5KP1 A;  4HM1 B;  1SJW A;  4HM0 B;  3VSY A;  1AV4 A;  2BO9 B;  2QEX 3;  1GSP A;  1BGS A;  2CFD A;  2OTJ 3;  3SYU A;  2ML6 A;  3BNC A;  3OX9 A;  1GOY A;  1KSI A;  1RN4 A;  2F86 B;  2K3D A;  1L5G B;  2ZA4 A;  2KF4 A;  1GY7 A;  6GSP A;  1TFO A;  3M8C A;  1TTO A;  2Z77 A;  1JB4 A;  3N9H A;  1LOV A;  3FGY A;  4N6N B;  1W01 A;  2RCD A;  1VQP 3;  1PY3 A;  5IEP A;  1A2K A;  1RDS A;  3D9R A;  5FW5 A;  5JPP A;  3D3L A;  1OHP A;  4FMC A;  1VQ6 3;  1W2Z A;  1RMS A;  3FH1 A;  2BHM A;  2XR8 B;  2F4Y A;  5CXO A;  1VQM 3;  4K1U A;  2B24 B;  3N8B A;  2PNC A;  3AMO A;  1OGZ A;  3ZFZ A;  1G96 A;  1G02 A;  2B1X B;  3NM2 A;  5AII A;  5M18 A;  4ORL A;  1OH0 A;  4G1M B;  1U8C B;  5HGR A;  1WMN A;  1B20 A;  1X1W A;  5G2G A;  5JPU A;  4QWT A;  2GBW B;  1VQQ A;  3F9S A;  4HAA A;  5IEN A;  3HOH A;  1W6C A;  4EV5 A;  1EUI C;  1MNL A;  2W2C A;  1Q81 4;  2F5W A;  1O7N B;  3ALA A;  1LOX A;  1IVU A;  1GMP A;  1B3S A;  1Q40 B;  1W6Y A;  1CQS A;  2CFG A;  3H51 A;  3OWY A;  5TGN A;  4AEQ A;  5IW9 A;  1UI8 A;  1JB2 A;  3WOF B;  1TU5 A;  1NJI 4;  5FGO A;  4WFO A;  4JF8 A;  2XEP A;  1LOW A;  3UNL A;  2CFL A;  4L8P A;  1IV7 A;  4EC6 A;  3JUN A;  3EN1 B;  1TRP A;  1NNV A;  2PZV A;  1N5P A;  3EQQ B;  1EA2 A;  2MC8 A;  3V99 A;  3GZY B;  1BRG A;  4XBY A;  1RKY A;  2CG1 A;  3D5I A;  3F8X A;  1FUS A;  1RGE A;  5KP4 A;  1CH0 A;  1I2G A;  1Z1S A;  3T8U A;  2BIR A;  1K9M 4;  4STD A;  1BAO A;  1B27 A;  4J9A A;  2XFS A;  3ER7 A;  3T0U A;  1VQL 3;  2W56 A;  3BNB A;  3EC9 A;  3G8Z A;  4HOH A;  3Q1C A;  1JN5 B;  2CWU A;  3K9M C;  3Q2P A;  2XGN A;  3I56 3;  1AVL A;  4WHA A;  1I8V A;  3G71 3;  1JB5 A;  2LQV A;  4GL6 A;  1IT8 A;  4N6V 0;  1LRA A;  3RDE A;  1RJO A;  2HMK B;  2L4V A;  3CU3 A;  3DGL A;  1AR0 A;  2F99 A;  3CCU 3;  5BXQ A;  1Q86 4;  1VQ4 3;  1GMR A;  1O7M B;  1RCL A;  3OWU A;  3V92 A;  4RNY A;  2BT3 A;  4WWU C;  7STD A;  1S5A A;  4U13 A;  3FF0 A;  3F14 A;  3NV0 A;  2I9W A;  1Q42 A;  1Y4K A;  4AKY A;  1OF5 A;  3HIG A;  4BTX A;  1FUW A;  1IVV A;  1K8A 4;  2MF7 A;  1K28 A;  2CHC A;  5D81 A;  4NRE A;  1NWW A;  3UL6 A;  1EQK A;  1T2I A;  3WOD G;  1YHQ 3;  5BVB A;  1BNJ A;  4TX4 A;  4MMX B;  3CCS 3;  1CYU A;  2OWP A;  3OV4 A;  1MWU A;  1DVC A;  4DKI A;  2H0H A;  1PYL A;  3UL5 A;  4I5Q A;  3X3Y A;  2XH9 A;  3HZP A;  5G1L A;  2KRT A;  1YVS A;  3X42 A;  3AGN A;  3DH2 A;  3G4S 3;  4O3V A;  1DET A;  3LTA A;  1DYU A;  2XFT A;  3O8Y A;  1W2B 2;  1KQS 2;  5G1K A;  1A67 A;  2ZHX B;  3RNT A;  3AHW A;  3KKG A;  3SLU A;  4BIR A;  1S72 3;  4RBN A;  1D6Y A;  5AI1 A;  1R4C A;  3LT9 A;  3F8H A;  2YFJ B;  3FZW A;  3SOY A;  2GBX B;  1BNE A;  1NB3 I;  1TUH A;  2FGT A;  1QMA A;  4EV2 A;  1BU4 A;  1STF I;  4O02 B;  3URP A;  1Q7Y 4;  3KN4 A;  2OCT A;  2C10 A;  1FA3 A;  3SVA A;  2Y74 A;  1B2X A;  2OOV A;  2ML5 A;  2GEY A;  1IQX A;  1BRN L;  1UUW B;  4N6L A;  2F98 A;  3X40 A;  1TJD A;  3S29 A;  4R1K A;  3GZX B;  3BIR A;  4J5G A;  4HVN A;  3GWR A;  8CHO A;  3E99 A;  4L8O A;  1OUN A;  3BU4 A;  1T3B A;  1RHL A;  1DMN A;  1FGM A;  1I2F A;  1YGE A;  3FG4 A;  1VQ7 3;  2KF5 A;  1I3F A;  2Y73 A;  1STD A;  4N6T A;  1RNB A;  1VQ5 3;  1IK3 A;  4WP5 A;  3CXC 2;  2IUK A;  1QAK A;  2HMM B;  2AAE A;  1HZ1 A;  2BU4 A;  3KSE D;  1RN1 A;  2K0M A;  1FZU A;  3EX9 A;  5I97 A;  1Q9E A;  4HJL B;  3G6E 3;  4K61 A;  1MWT A;  4Q53 A;  5M19 A;  3PGB A;  3JUQ A;  1JRQ A;  3PCS A;  3LT8 A;  4LSO A;  2E2U A;  1TRQ A;  5IG0 A;  1B2S A;  2V1L A;  3KSP A;  3WA3 A;  5IER A;  1BRI A;  1CYV A;  4HM2 B;  1N5H A;  3GZR A;  5D82 A;  2HOH A;  3A76 A;  5JBS A;  2YFL B;  2HML B;  2SAR A;  3DGN A;  5ELJ A;  1GOV A;  1CEW I;  1B2U A;  3RGR A;  3Q3F A;  1QAL A;  1D6Z A;  1LQM B;  1AQZ A;  2HMJ B;  1OCV A;  1VQ8 3;  1IV9 A;  1LXE A;  3JUP A;  3EE1 A;  3KZT A;  5DRE A;  3KFQ C;  3F7X A;  1JKG A;  2RFR A;  1JN5 A;  1E97 A;  4IPB A;  1BSD A;  3I55 3;  5KP3 A;  1DVD A;  1BRJ A;  1O7G B;  3MYT A;  1M1X B;  3NM7 A;  1O7H B;  4X2H A;  2HMO B;  3NBR A;  4WYK A;  3SX1 A;  4OVM A;  1LVN A;  2CWV A;  1N8Q A;  1ZS7 A;  3MG3 A;  4HM8 B;  3HK4 A;  3FCS B;  4OUQ A;  1FGT A;  3DM8 A;  1LNH A;  3I0Y A;  1E3R A;  1K41 A;  1RGF A;  1ZX2 A;  1M9G A;  2WOF A;  3ECF A;  4LYL B;  1UW1 A;  3WDG B;  5LC7 A;  1JJ2 2;  4IT7 A;  3MPH A;  3AGO A;  4XDW A;  1KC8 4;  1GD4 A;  1SII A;  3NX0 A;  5AYS C;  1KD1 4;  4KFD A;  1B2M A;  1HYF A;  1IT7 A;  5EEO A;  1BSC A;  2ZL8 A;  2IA7 A;  4H3U A;  1QVF 2;  3FG1 A;  4KZ1 A;  5A0O B;  1GD3 A;  1W02 A;  2CC3 A;  1IU7 A;  2P38 A;  4BTW A;  1YIJ 3;  3CC4 3;  1AY7 A;  1YJN 3;  3ZG0 A;  3MSO A;  1OHO A;  1BVI A;  4FCM A;  1BNR A;  1FGR A;  2OQE C;  1FUT A;  4XDV A;  2BNG A;  1M1K 4;  1FGQ A;  2RNT A;  1BIR A;  2F56 A;  1EKM A;  3GRD A;  2CFK A;  1UDI I;  2CKF B;  1DE3 A;  3AMO B;  3SED A;  5IG5 A;  4RZM A;  5IG3 A;  4CPK A;  3B4O A;  2A15 A;  2R41 A;  3CNX A;  3QRD A;  5IEO A;  5CK6 A;  4XBT A;  3G16 A;  4R9K A;  3BNE A;  2D1W A;  2KAA A;  4FMD A;  2O9U X;  3NUV A;  4GSP A;  3CC2 3;  3X3Z A;  1SPU A;  1N8R 4;  1ULJ B;  2QGU A;  2IMJ A;  5ELU A;  5RNT A;  1NU3 A;  3NQY A;  1BNS A;  3EBY A;  1I0X A;  3WA2 X;  2CFW A;  2KCD A;  2RGQ A;  3ROB A;  1QVG 2;  3GZB A;  1IQY A;  3DGO A;  3DUK A;  5IG4 A;  5M1A A;  1VZZ A;  3IJE B;  3DXO A;  2E2V A;  4K90 B;  4MJD A;  2UGI A;  1V58 A;  1W6G A;  1GMQ A; 
#chains in the Genus database with same CATH homology
 4N6U A;  2WGQ A;  2CH9 A;  3JUO A;  2ZDJ A;  1PU4 A;  4HM4 B;  2XGL A;  3S67 A;  2XSH B;  3EF8 A;  3NBJ A;  1WQL B;  3VGN A;  1BUQ A;  4LEH A;  3UJM A;  2W56 B;  4HZ9 B;  4FCJ A;  2QA4 3;  2W03 A;  2KXG A;  4R4K A;  1C7H A;  3MG1 A;  3T8N A;  4KFE A;  3N54 B;  3IPT A;  4LGQ A;  3BB9 A;  3WOE B;  2FNQ A;  3KII A;  2P0M A;  2WOH A;  2XSO B;  3OWS A;  3CCJ 3;  1WMO A;  2P0X A;  4MMZ B;  1O7P B;  2BMO B;  3RGA A;  2Z6B A;  2R4I A;  1U5O A;  5AEU B;  1VQO 3;  2HMN B;  2O3O A;  3UB1 A;  2WGO A;  1EG9 B;  1K73 4;  3FF2 A;  2YX9 A;  3LH4 A;  3U97 A;  5AIF A;  4LZI A;  3OW2 2;  1OGX A;  2GU1 A;  5STD A;  1HU9 A;  4XBX A;  3LOY A;  1ASK A;  2GEX A;  3NXJ A;  3X41 A;  1KWI A;  4XB5 A;  3WMD A;  5AIH A;  1Q40 A;  4PEJ A;  3EHC A;  1F8N A;  4IIA A;  2CK3 H;  1FGO A;  3LXU X;  4HYZ A;  1OPY A;  1W7C A;  1M90 4;  4O2H A;  4KFF A;  1A90 A;  2P05 A;  2Q07 A;  4FMA A;  3LTD A;  2QIY A;  1Q82 4;  2INX A;  3CPO A;  2LYX A;  3TDG A;  3CNM A;  1ISK A;  2GU3 A;  1GY5 A;  3DMC A;  2XF3 A;  1QJG A;  3K0Z A;  5EQL A;  3EB8 A;  3GAX A;  4RNZ A;  3SXX A;  3LZA A;  1DMM A;  1W5Z A;  1TP6 A;  3U1W A;  1TFK A;  2BMR B;  1DMQ A;  1JNQ A;  4EXR A;  1VQ9 3;  5AIG A;  3CCV 3;  1YJ9 3;  1ROV A;  4JRF A;  4N3V A;  3FSD A;  3PZW A;  5CLK A;  2C11 A;  4N6O B;  2CG0 A;  1IVX A;  4XM4 A;  1NDO B;  1W4N A;  4AKZ A;  3CME 3;  1NO3 A;  2D42 A;  3HI7 A;  3IMA B;  1N9J A;  1HKX A;  3S28 A;  3K63 A;  3DGM A;  3K7C A;  2IUJ A;  3STD A;  1VQK 3;  3MWZ A;  3LML A;  1IVW A;  1YIT 3;  1RRH A;  2CWT A;  4CCV A;  1YI2 3;  2FXT A;  3JUM A;  1IDP A;  1TIJ A;  3H3H A;  3JVC A;  3F7S A;  1NB5 I;  4N6M A;  2OOV C;  3B4P A;  2STD A;  3B8L A;  4HM6 B;  6STD A;  4HZB B;  1RRL A;  4BTY A;  2Z76 A;  1SIH A;  4FMB A;  3FLJ A;  3EJV A;  1GS3 A;  3OXA A;  1ZO2 A;  4CDL A;  4R80 A;  1V74 A;  1PFP A;  2W9P A;  2W04 A;  3HX8 A;  3CCE 3;  2GXF A;  4X2O A;  2CIU A;  4HM5 B;  4J8T A;  4ZM8 A;  4HM3 B;  1SQW A;  2K54 A;  1GY6 A;  1AVK A;  3BLZ A;  3F40 A;  5D83 A;  1N9E A;  3CCR 3;  5LC6 A;  1JKG B;  5AYR B;  1WMP A;  1GYB A;  1IQ8 A;  3FG3 A;  5EVH A;  1RN7 A;  2Z7A A;  4GB5 A;  1OAC A;  1YVB I;  4KVH A;  4WYK B;  4K1V A;  2XRX B;  3Q90 A;  3LYG A;  4EYC A;  4NHF A;  3MG2 A;  4L7K A;  1T5Y A;  5AEW B;  1WNH A;  2YFI B;  3FKA A;  3PYJ A;  4O8S A;  3EN8 A;  4EBG A;  2WO0 A;  3NHX A;  2W0Q A;  3PXM A;  5IF6 A;  2JQ5 A;  3CCM 3;  1O7W B;  2RSX A;  4FR9 A;  4HBR A;  2JDI H;  3MKI A;  3S5C A;  3HII A;  2CW9 A;  3NQZ A;  2SBL A;  1MOL A;  2P09 A;  1E3V A;  4OK0 A;  3LTB A;  5CF2 A;  3G0K A;  3DY5 A;  1WTH A;  2BMQ B;  2UX0 A;  4HKV B;  3J7Y d;  2E2T A;  3S27 A;  1YJW 3;  3CC7 3;  3EBT A;  3PCR A;  3VF1 A;  1A2V A;  1OHS A;  4MEI A;  2W6J H;  3NV0 B;  2W9Q A;  4I4K A;  2M7O A;  1OF5 B;  3QK9 A;  1ULI B;  1UI7 A;  3CPW 2;  3DZL A;  3KE7 A;  3B7C A;  3CCQ 3;  1D6U A;  4HM7 B;  4LMI A;  3LTC A;  3PS8 A;  1J2B A;  1ROA A;  1US1 A;  4FCZ A;  3K5T A;  2OTL 3;  3L0R A;  1VQN 3;  1UUV B;  3CD6 3;  5CF1 A;  3NBB A;  3BND A;  2OQE A;  4H61 A;  4MMY B;  3V98 A;  3SOA A;  1W00 A;  3MHE A;  4R9L A;  1QAF A;  5DRV A;  3X3X A;  1JV2 B;  5KP1 A;  4HM1 B;  1SJW A;  4HM0 B;  3VSY A;  1AV4 A;  2BO9 B;  2QEX 3;  3CCL 3;  2OTJ 3;  2CFD A;  2ML6 A;  3BNC A;  3OX9 A;  1KSI A;  2F86 B;  1L5G B;  1GY7 A;  1TFO A;  3M8C A;  2Z77 A;  4N6N B;  1JB4 A;  3N9H A;  1VQP 3;  3FGY A;  1W01 A;  2RCD A;  5IEP A;  1A2K A;  3D9R A;  5FW5 A;  5JPP A;  3D3L A;  1OHP A;  4FMC A;  1VQ6 3;  1W2Z A;  3FH1 A;  2BHM A;  2XR8 B;  5CXO A;  1VQM 3;  4K1U A;  2B24 B;  3N8B A;  2PNC A;  3AMO A;  1OGZ A;  1G96 A;  2B1X B;  3NM2 A;  5AII A;  4ORL A;  1OH0 A;  4G1M B;  1U8C B;  5HGR A;  1WMN A;  5G2G A;  5JPU A;  4QWT A;  2GBW B;  3F9S A;  5IEN A;  1W6C A;  4EV5 A;  1MNL A;  2W2C A;  1Q81 4;  1O7N B;  3ALA A;  1LOX A;  1IVU A;  1W6Y A;  1Q40 B;  2CFG A;  3H51 A;  1CQS A;  3OWY A;  4AEQ A;  5IW9 A;  5TGN A;  1UI8 A;  1JB2 A;  3WOF B;  1TU5 A;  1NJI 4;  5FGO A;  4WFO A;  4JF8 A;  2XEP A;  3UNL A;  2CFL A;  4L8P A;  1IV7 A;  4EC6 A;  3JUN A;  3EN1 B;  2PZV A;  1N5P A;  3EQQ B;  1EA2 A;  2MC8 A;  3V99 A;  3GZY B;  4XBY A;  1RKY A;  2CG1 A;  3F8X A;  5KP4 A;  1Z1S A;  3T8U A;  1K9M 4;  4STD A;  4J9A A;  2XFS A;  3ER7 A;  3T0U A;  1VQL 3;  2W56 A;  3BNB A;  3EC9 A;  3G8Z A;  3Q1C A;  1JN5 B;  2CWU A;  3K9M C;  3Q2P A;  2XGN A;  3I56 3;  1AVL A;  4WHA A;  3G71 3;  1JB5 A;  2LQV A;  4GL6 A;  1IT8 A;  4N6V 0;  3RDE A;  1RJO A;  2HMK B;  2L4V A;  3CU3 A;  3DGL A;  1AR0 A;  2F99 A;  3CCU 3;  5BXQ A;  1Q86 4;  1VQ4 3;  1O7M B;  3V92 A;  3OWU A;  4RNY A;  2BT3 A;  4WWU C;  7STD A;  1S5A A;  4U13 A;  3FF0 A;  3F14 A;  3NV0 A;  2I9W A;  1Q42 A;  1Y4K A;  4AKY A;  1OF5 A;  3HIG A;  4BTX A;  1FUW A;  1IVV A;  1K8A 4;  2MF7 A;  1K28 A;  2CHC A;  5D81 A;  4NRE A;  1NWW A;  3UL6 A;  1EQK A;  3WOD G;  1YHQ 3;  5BVB A;  4TX4 A;  4MMX B;  3CCS 3;  1CYU A;  2OWP A;  3OV4 A;  1DVC A;  3UL5 A;  3X3Y A;  2XH9 A;  3HZP A;  2KRT A;  3X42 A;  3G4S 3;  4O3V A;  3LTA A;  1DYU A;  2XFT A;  3O8Y A;  1W2B 2;  1KQS 2;  1A67 A;  3KKG A;  3SLU A;  1S72 3;  4RBN A;  1D6Y A;  5AI1 A;  1R4C A;  3LT9 A;  3F8H A;  2YFJ B;  3FZW A;  3SOY A;  2GBX B;  1NB3 I;  2FGT A;  1TUH A;  1QMA A;  4EV2 A;  1STF I;  4O02 B;  1Q7Y 4;  3KN4 A;  2OCT A;  2C10 A;  1FA3 A;  3SVA A;  2Y74 A;  2OOV A;  2ML5 A;  2GEY A;  1IQX A;  1UUW B;  4N6L A;  2F98 A;  3X40 A;  3S29 A;  4R1K A;  3GZX B;  4HVN A;  3GWR A;  8CHO A;  3E99 A;  4L8O A;  1OUN A;  1DMN A;  1FGM A;  1YGE A;  3FG4 A;  1VQ7 3;  2Y73 A;  1STD A;  4N6T A;  1VQ5 3;  1IK3 A;  4WP5 A;  3CXC 2;  2IUK A;  1QAK A;  3KSE D;  2K0M A;  3EX9 A;  5I97 A;  4HJL B;  3G6E 3;  4K61 A;  4Q53 A;  3PGB A;  3JUQ A;  1JRQ A;  3PCS A;  3LT8 A;  4LSO A;  2E2U A;  5IG0 A;  2V1L A;  3KSP A;  3WA3 A;  5IER A;  1CYV A;  4HM2 B;  1N5H A;  3GZR A;  5D82 A;  3A76 A;  5JBS A;  2YFL B;  2HML B;  3DGN A;  5ELJ A;  3RGR A;  1CEW I;  1QAL A;  1D6Z A;  2HMJ B;  1OCV A;  1VQ8 3;  1IV9 A;  1LXE A;  3JUP A;  3EE1 A;  3KZT A;  5DRE A;  3KFQ C;  3F7X A;  1JKG A;  2RFR A;  1JN5 A;  1E97 A;  4IPB A;  3I55 3;  5KP3 A;  1DVD A;  1O7G B;  3MYT A;  1M1X B;  3NM7 A;  1O7H B;  4X2H A;  2HMO B;  3NBR A;  4WYK A;  3SX1 A;  4OVM A;  1LVN A;  2CWV A;  1N8Q A;  3MG3 A;  4HM8 B;  3HK4 A;  3FCS B;  4OUQ A;  1FGT A;  3DM8 A;  1LNH A;  3I0Y A;  1E3R A;  1K41 A;  1ZX2 A;  3ECF A;  1M9G A;  2WOF A;  3WDG B;  1JJ2 2;  1UW1 A;  3CMA 3;  5LC7 A;  4IT7 A;  3MPH A;  1KC8 4;  4XDW A;  1GD4 A;  1SII A;  3NX0 A;  5AYS C;  1KD1 4;  4KFD A;  1IT7 A;  5EEO A;  2ZL8 A;  2IA7 A;  4H3U A;  1QVF 2;  3FG1 A;  4KZ1 A;  5A0O B;  1GD3 A;  1W02 A;  2CC3 A;  1IU7 A;  2P38 A;  4BTW A;  1YIJ 3;  3CC4 3;  1YJN 3;  3MSO A;  1OHO A;  4FCM A;  1FGR A;  2OQE C;  4XDV A;  2BNG A;  1M1K 4;  1FGQ A;  1EKM A;  3GRD A;  2CFK A;  2CKF B;  3AMO B;  3SED A;  5IG5 A;  4RZM A;  5IG3 A;  3B4O A;  2A15 A;  3CNX A;  3QRD A;  5IEO A;  5CK6 A;  4XBT A;  3G16 A;  4R9K A;  3BNE A;  2D1W A;  4FMD A;  2O9U X;  3NUV A;  3CC2 3;  3X3Z A;  1SPU A;  1N8R 4;  1ULJ B;  2QGU A;  2IMJ A;  5ELU A;  1NU3 A;  3NQY A;  3EBY A;  3WA2 X;  2CFW A;  2KCD A;  2RGQ A;  3ROB A;  1QVG 2;  3GZB A;  1IQY A;  3DGO A;  3DUK A;  5IG4 A;  1VZZ A;  3IJE B;  3DXO A;  2E2V A;  4K90 B;  4MJD A;  1W6G A;  2HMM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...