1GS3A

High resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVENPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAFWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of a Low-Barrier Hydrogen Bond to Catalysis by Delta-5-3-Ketosteroid Isomerase is not Extremely High Compared to that of an Ordinary Hydrogen Bond. Low-Barrier Hydrogen Bond of Pi Ksi
rcsb
source organism Pseudomonas putida
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2001-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gs3A00
2YFJB 2A15A 2HMJB 3VGNA 1W00A 3OWUA 1O7MB 3EBTA 1JKGA 3H3HA 3G8ZA 3B7CA 1O7NB 4GB5A 3DXOA 1NDOB 2INXA 5CF1A 3EQQB 4XBTA 3UJMA 1JN5A 4PEJA 5STDA 3HZPA 1QJGA 3JUMA 3D9RA 1NWWA 3FSDA 3OX9A 1HKXA 3GWRA 4HM6B 1JB2A 3EN8A 4OVMA 4N3VA 4XBYA 3EX9A 4WWUC 2GBWB 3DMCA 2YFIB 3GRDA 2F86B 1Q42A 3NXJA 5D81A 2HMLB 3F9SA 3STDA 2RFRA 1O7HB 2HMKB 3RGAA 3EF8A 3JUPA 4CDLA 4J9AA 2STDA 1UUVB 3UNLA 3CPOA 1O7PB 3IPTA 5AEUB 1OCVA 4J8TA 1UUWB 7STDA 1DMQA 2UX0A 2HMNB 5AIHA 3OWSA 2GEYA 1VZZA 4HVNA 1EA2A 2HMMB 2XSHB 3JUNA 5IEOA 5CF2A 3ECFA 1QMAA 5CK6A 5FW5A 5KP1A 4HM3B 5IF6A 1IDPA 3EJVA 4R9LA 3SOAA 3F40A 1E3RA 3OXAA 2GEXA 3CNXA 5CXOA 4ORLA 5IENA 3CNMA 3ER7A 3Q90A 1ULIB 1ZO2A 3FKAA 3T8NA 1DMMA 3B4PA 4L7KA 1ULJB 2GBXB 1E97A 2QGUA 2IMJA 1BUQA 3F14A 4HJLB 1OGXA 5G2GA 3DZLA 5TGNA 2F98A 2W2CA 1OHPA 2YFLB 2XSOB 3F7XA 1WQLB 4XDWA 4HZBB 1DMNA 3OWYA 1Q40B 4HM7B 5KP4A 2Z76A 3LZAA 1OHOA 4HM0B 2QIYA 5IG3A 5AI1A 3NBRA 3HK4A 4K1VA 4XB5A 4LEHA 3DUKA 1OHSA 1GS3A 1AR0A 3KZTA 3FF2A 1C7HA 4HZ9B 3F8HA 3JUQA 1O7WB 4HM5B 1OGZA 3GZBA 4XDVA 3F8XA 4R9KA 4LGQA 1OUNA 4X2HA 2K54A 1OF5B 3EN1B 1ISKA 5HGRA 4STDA 1K41A 4HM2B 5EVHA 2R4IA 3EC9A 1S5AA 2JQ5A 4XBXA 4OUQA 4L8OA 2BNGA 3G0KA 2HMOB 4U13A 1W6YA 3G16A 4HM4B 3EBYA 2BMQB 2OWPA 5IEPA 3MHEA 3HX8A 1SJWA 5JPUA 2RGQA 4WYKB 1JB5A 2BMOB 5AIGA 3KSPA 1OH0A 3RGRA 1O7GB 3SEDA 3FLJA 4XM4A 1TP6A 4RZMA 4KVHA 3FH1A 3K7CA 4MJDA 1NU3A 5KP3A 2Z77A 2XR8B 1U5OA 2PZVA 3MSOA 3CU3A 1W01A 3BLZA 3FGYA 4X2OA 5CLKA 4IIAA 3JUOA 5D82A 1Q40A 1CQSA 3NUVA 3MYTA 5JPPA 5IERA 3EHCA 3GZYB 3M8CA 3NHXA 1ZX2A 3NV0B 1ASKA 5AIIA 5IG0A 3BB9A 2BMRB 4LMIA 1JB4A 2CKFB 1W02A 1Z1SA 3MG1A 1GY6A 4I4KA 1TUHA 3E99A 2B24B 3F7SA 5BXQA 3MG2A 3FF0A 3B4OA 3MKIA 1OF5A 3WMDA 3GZRA 1JKGB 8CHOA 1EG9B 3KKGA 2RCDA 3OV4A 5DREA 3LYGA 5IG5A 1GY7A 2Z7AA 4WP5A 5BVBA 2B1XB 5D83A 1JN5B 2I9WA 3S5CA 4HM1B 1E3VA 3KE7A 5AEWB 1A2KA 6STDA 3K0ZA 4Q53A 3A76A 3NM2A 4FCJA 2GXFA 4H3UA 4WYKA 4HKVB 1GYBA 2CHCA 3SOYA 5IG4A 1GY5A 3T8UA 1OPYA 2F99A 3I0YA 4R1KA 3B8LA 4HM8B 5AIFA 3H51A 1STDA 3DM8A 3ROBA 4L8PA 5DRVA 3FZWA 3NV0A 2XRXB 3VSYA 4K1UA 4FCMA 3GZXB 3MG3A
chains in the Genus database with same CATH superfamily
2YFJB 1R4YA 4AKYA 3LOYA 3D5IA 3S67A 2CX0A 3X3XA 3D79A 2A15A 2P0MA 2V1LA 2WOHA 1FUTA 3NX0A 2XEPA 1BOXA 2HMJB 2KAAA 1TJDA 4WHAA 3VGNA 1QVG2 1IU7A 1W00A 1RGKA 3OWUA 1B2SA 1IT8A 1EKMA 1IVXA 1O7MB 2IYJA 1TIJA 2Z6BA 1M1K4 2XH9A 5GSPA 3EBTA 2CG0A 2CK3H 4IT7A 4I5QA 1W2B2 1KSIA 1JKGA 1RN4A 3H3HA 3G8ZA 3LT8A 3B7CA 4JRFA 1O7NB 4GB5A 4AKZA 1VQ73 1CYUA 3DXOA 1DVDA 1K734 1W2ZA 1NDOB 2INXA 1U8CB 2IUJA 2AADA 5CF1A 1ZGXA 1YJN3 4JF8A 2BIRA 1I8VA 2L4VA 2O3OA 2PNCA 4LYLB 3EQQB 2WO0A 3HOHA 1JN5A 4PEJA 4XBTA 3UJMA 5BIRA 1Q814 5STDA 3HZPA 3CC43 4HOHA 1UI8A 3D4AA 3SX1A 1QJGA 1JBSA 4O3VA 3CCE3 3JUMA 3K9MC 3D9RA 1NWWA 1N5HA 3FSDA 3OX9A 1HKXA 4EV2A 1HYFA 3GWRA 4HM6B 2CFLA 3UB1A 1JB2A 3EN8A 1I2GA 1QAKA 4N3VA 3AHSA 1UGIA 4OVMA 4XBYA 3EX9A 2O9UX 3Q3FA 3D3LA 4WWUC 1A2PA 2BU4A 1N8R4 2GBWB 1SARA 1HU9A 3FG3A 3DMCA 3CC23 2YFIB 3PS8A 3GRDA 2F86B 1Q42A 1T2HA 1BANA 3NXJA 5AYRB 2D42A 3KFQC 2FNQA 5D81A 3LTBA 2HMLB 1HZ1A 1D6YA 3F9SA 3STDA 2UUGC 4TX4A 2R41A 3BNBA 3ZG0A 2RFRA 3CPW2 5I97A 1FGTA 2W9PA 1O7HB 2HMKB 3RGAA 3EF8A 3JUPA 4CDLA 2MF7A 3HI7A 4J9AA 3LTDA 1WTHA 3MPHA 2QEX3 1YGWA 2W9QA 2STDA 1BRSA 1UUVB 3UNLA 1GOUA 3PYJA 3I563 3Q2PA 4O2HA 3CPOA 2RNTA 5EQLA 1RKYA 3AMOB 1W7CA 1JBTA 1O7PB 1NJI4 3IPTA 6GSPA 3T0UA 1OCVA 1SQWA 1RRHA 4J8TA 5AEUB 2IA7A 1UUWB 3X40A 2ZHXB 1YNVX 7STDA 5JBSA 1DMQA 2KF5A 1AQZA 4K61A 2UX0A 3J7Yd 3BNDA 3SYUA 3G4S3 3RNTA 4QWTA 3KCHA 2H0HA 4R4KA 1A90A 2HMNB 3WODG 5AIHA 3OWSA 2GEYA 1VZZA 4HVNA 1YGEA 1BRNL 1EA2A 3DGYA 4N6TA 1ROAA 2HMMB 1W5ZA 1Q7Y4 2XSHB 1GMPA 1SPUA 3JUNA 3K63A 2CC3A 3N9HA 5IEOA 3D5GA 5CF2A 4EBGA 1IVVA 1WNHA 1QMAA 3ECFA 4BTYA 3CMA3 1QVF2 2ML5A 3URPA 2RBIA 3HIIA 2XGNA 5CK6A 3N8BA 3LXUX 5FW5A 1GD4A 5BU4A 3DGNA 2FXTA 5KP1A 3CCR3 4BL2A 4HM3B 1BRHA 1EEJA 2F4YA 1BRGA 2OTJ3 1BNJA 5IF6A 2CH9A 1IDPA 2RSXA 3EJVA 4R9LA 3CXC2 1VQ43 5IW9A 3SOAA 3F40A 1IT7A 1K28A 1E3RA 3OXAA 2GEXA 3CNXA 1UCKA 1W6GA 1CEWI 5CXOA 1NNVA 1X1UA 1MWSA 4IPBA 4ORLA 4EV5A 7RNTA 1BNRA 1RGLA 5IENA 1BNGA 3CNMA 3V98A 1IVWA 1IV7A 1IV9A 1FGQA 1S723 3ER7A 3IMAB 3Q90A 4MEIA 1BVIA 1RN7A 1WMPA 1NO3A 5M1AA 1UUGB 1ULIB 1ZO2A 3U97A 4CJNA 3FKAA 3T8NA 1DMMA 3WDGB 1VQN3 3B4PA 1AV4A 4K90B 3GSPA 4L7KA 2P38A 1B2UA 1ULJB 1Q7HA 2F5WA 2GBXB 1E97A 5LC7A 1UW1A 2QGUA 3G713 1RLSA 5RNTA 2IMJA 2W56B 1BUQA 3F14A 4HJLB 4G1MB 3PCRA 3IJEB 1OGXA 1QAFA 4FMDA 1US1A 3DZLA 5G2GA 5TGNA 2P0XA 2W04A 4FMAA 3DGOA 1BUJA 3FG4A 1X1WA 2F98A 2W2CA 1YJ93 3A5EA 1OHPA 1B2XA 3DY5A 3UL5A 3AHWA 2SBLA 1L5GB 2CIUA 3LTAA 4BIRA 2YFLB 3ZG5A 1B20A 1DYUA 2XSOB 4HAAA 3JVCA 3F7XA 5HOHA 1RSNA 1GMQA 1WQLB 2BO9B 4XDWA 4HZBB 1BAOA 1GD3A 1DMNA 3OWYA 2GU3A 1Q40B 1RHLA 4HM7B 3CD63 5KP4A 2Z76A 3LZAA 1VQ53 1OHOA 1G02A 3DGLA 4HM0B 1G96A 3V99A 1TU5A 2BT3A 1IQ8A 3GAXA 2QIYA 5ELUA 3S27A 5G1KA 2H0IA 5IG3A 5AI1A 3NBRA 2UGIA 5G1LA 3HK4A 4K1VA 1BSDA 4XB5A 3LT9A 1KD14 4LEHA 3DUKA 1OHSA 1GS3A 3WHOA 1AR0A 4LZIA 3ZFZA 2CX1A 4H61A 1IQYA 3KZTA 1UCLA 3FF2A 4N6UA 3L0RA 2M7OA 1C7HA 3ALAA 4NHFA 4HZ9B 4ILFA 2JDIH 4BTWA 2OCTA 1I3IA 2OQEC 3F8HA 2C10A 1O7WB 3JUQA 1I2EA 1FYSA 2GU1A 4HM5B 2ZL8A 1RCKA 2OQEA 1LNIA 2WGOA 3DGMA 3S28A 3SXXA 1RNTA 1PFPA 1OGZA 2E2VA 4BL3A 3WA3A 1VQP3 4MMZB 3GZBA 4XDVA 3F8XA 4KT3B 4R9KA 1RN1A 4LGQA 1OUNA 1YHQ3 4X2HA 2K0MA 7GSPA 2K54A 4O8SA 1VQ83 2Y74A 3NBBA 3CCV3 1RNBA 1R4CA 4KFFA 1OF5B 2CFDA 3OW22 1BSAA 1T2IA 1V57A 1I2FA 3EN1B 2CG1A 1QALA 1ISKA 2HOHA 5HGRA 4STDA 1BNIA 2CFKA 1STFI 5A0OB 1K41A 4FMBA 4HM2B 3SVAA 2LYXA 1M904 1SIHA 4CCVA 5EVHA 1I3FA 1WMNA 2R4IA 3EC9A 1S5AA 2JQ5A 4XBXA 1IVUA 4OUQA 5M19A 1GSPA 1W4NA 1BSCA 4L8OA 1RGGA 2BNGA 1M1XB 1V58A 3G0KA 2HMOB 4U13A 2WGQA 1MGWA 2Y73A 1FA3A 1B27A 2XGLA 1MWUA 1IYYA 3HIGA 3PGBA 1W6YA 1B2MA 1VQ93 3G16A 4HM4B 3EBYA 2BMQB 3LTCA 3VF1A 1RGFA 2BHMA 1X1XA 1LQMB 2OWPA 1I70A 5IEPA 3MHEA 2CWVA 1AY7A 3HX8A 1DE3A 4EW5A 4EXRA 3NBJA 1Q824 2FGTA 1SJWA 3LMLA 5JPUA 2RGQA 2CW9A 2W0QA 4WYKB 1JB5A 2BMOB 5AIGA 1BSEA 1KWIA 1LQGC 1UGHI 1FGMA 3KSPA 8RNTA 1JJ22 1OH0A 2GSPA 3RGRA 1O7GB 3X42A 1YIT3 3EB8A 3CCJ3 3SEDA 3FLJA 4XM4A 9RNTA 1TP6A 4RZMA 4KVHA 1FUSA 3AGNA 1SIIA 3NM7A 2XFSA 3FH1A 3K7CA 4NREA 4MJDA 3CC73 1NU3A 5KP3A 1RMSA 2WOFA 1RCLA 2XR8B 1W6CA 1GOVA 2Z77A 1U5OA 2PZVA 2QA43 3MSOA 3CU3A 3CCL3 3LH4A 1W01A 2OOVC 2P09A 1LOXA 3BU4A 2MC8A 1LOWA 3BLZA 3FGYA 4X2OA 1MWRA 4IIAA 1LXEA 3JUOA 5CLKA 2YX9A 5D82A 3MWZA 1Q40A 3BIRA 2CFWA 1CQSA 2OOVA 3NUVA 3MYTA 5JPPA 4N6NB 2E2UA 3K5TA 1UI7A 2L1SA 5IERA 3EHCA 2KF4A 3GZYB 3BNEA 3M8CA 3CCQ3 3NHXA 3U1WA 1LOYA 1MOLA 4O02B 3I553 1Q864 2W03A 1ZX2A 3KN4A 4EC6A 4GHOA 3NV0B 1ASKA 5AIIA 3QRDA 4MMYB 5IG0A 3X3YA 1NB5I 4N6MA 1N5PA 2IUKA 3BB9A 3O8YA 4KFEA 4RNYA 4J5KA 2BMRB 1I0XA 1RRLA 1TFKA 3NQZA 4LMIA 5ELJA 1MNLA 1BRIA 1DVCA 2AAEA 1JB4A 1BNSA 2CKFB 2KCDA 1VQK3 1J2BA 1W02A 1Z1SA 3DH2A 3KIIA 3TDGA 1RGAA 1GY6A 3MG1A 1BRJA 1PY3A 5LC6A 4I4KA 1TUHA 1BIRA 3E99A 4MMXB 2B24B 3F7SA 4EYCA 4ZM8A 1Y4KA 3SLUA 4RBNA 1Q9EA 3FG1A 2KF3A 3EE1A 1TRPA 1T3BA 5BXQA 3MG2A 3FF0A 1A2VA 1K9M4 1N9JA 2XFTA 1OF5A 2SARA 3B4OA 3MKIA 1JV2B 3WMDA 2IY2A 3PZWA 3V92A 1M9GA 3WR2A 4BTXA 1FZUA 1WMOA 5AYSC 3AMOA 3GZRA 1JKGB 1MGRA 1BNEA 1BSBA 1EG9B 2LQVA 4J5GA 5EEOA 8CHOA 3KKGA 1I0VA 2RCDA 3OV4A 1GOYA 1ZS7A 2ZDJA 2Q07A 1CH0A 4R80A 5DREA 1IQXA 1ROVA 3LYGA 1UCJA 4N6OB 2KXGA 5IG5A 1MWTA 1GY7A 2Z7AA 4WP5A 5BVBA 1AVKA 1DETA 2H0GA 1RGCA 1FW7A 2B1XB 2W6JH 4GSPA 5D83A 1JN5B 4BU4A 2F56A 5FGOA 3S29A 2OTL3 3FCSB 2I9WA 2P05A 3S5CA 4HM1B 1LNHA 1E3VA 3KE7A 1EQKA 5AEWB 1VQO3 1TTOA 4HYZA 1N8QA 1A2KA 4RNZA 6STDA 1JZDA 1BU4A 2D1WA 1B3SA 3K0ZA 4Q53A 4RNTA 3A76A 3KSED 1AVLA 4CPKA 3NM2A 1VQM3 1KQS2 4HBRA 2E2TA 4FCJA 1LRAA 2GXFA 3CCM3 1K8A4 4GL6A 2C4BA 3BNCA 3PXMA 4H3UA 4WYKA 2CFGA 4HKVB 1N9EA 1GYBA 1NB3I 1V74A 1TRQA 3N54B 4NPBA 4DKIA 2CHCA 4FR9A 3WOEB 4AEQA 3WOFB 4KFDA 3X3ZA 5M18A 1YI23 3AGOA 3SOYA 5IG4A 1BGSA 1RJOA 1FGRA 1GY5A 2ML6A 2K3DA 3T8UA 1OPYA 3UL6A 1RGEA 4WFOA 1LVNA 1BNFA 3WA2X 2KRTA 6RNTA 1D6UA 4LSOA 1TFOA 1C54A 1OACA 1KC84 2F99A 4FMCA 1YJW3 1YVSA 1IK3A 2XF3A 1YIJ3 3I0YA 2KF6A 1FUWA 4N6V0 1FGOA 2W56A 1YVBI 1UCIA 2CWTA 1JNQA 3QK9A 1B2ZA 4R1KA 1RGHA 3Q1CA 2F5MA 1JRQA 1LOVA 3B8LA 4HM8B 1G0TA 3RDEA 1B21A 3CCU3 1JBRA 1A67A 5AIFA 3H51A 1STDA 1VQL3 1CYVA 3NQYA 3DM8A 1EUIC 3ROBA 1F8NA 2ZA4A 4L8PA 5DRVA 4N6LA 4OK0A 3FZWA 1RTUA 2C11A 1D6ZA 3G6E3 1PYLA 1PU4A 3NV0A 1UDII 1RDSA 1X1YA 2J8XB 2XRXB 3VSYA 3CME3 1GMRA 4K1UA 3CCS3 4FCMA 1VQQA 4KZ1A 1T5YA 1JZOA 3GZXB 1BRKA 3PCSA 3X41A 4FCZA 2CWUA 3MG3A 1VQ63
chains in the Genus database with same CATH topology
2YFJB 4AKYA 3LOYA 3S67A 3X3XA 2A15A 2P0MA 2V1LA 2WOHA 3NX0A 2XEPA 2HMJB 4WHAA 3VGNA 1QVG2 1IU7A 1W00A 3OWUA 1IT8A 1EKMA 1IVXA 1O7MB 1TIJA 2Z6BA 1M1K4 2XH9A 3EBTA 2CG0A 2CK3H 4IT7A 1W2B2 1KSIA 1JKGA 3H3HA 3G8ZA 3LT8A 3B7CA 4JRFA 1O7NB 4GB5A 4AKZA 1VQ73 1CYUA 3DXOA 1DVDA 1K734 1W2ZA 1NDOB 2INXA 1U8CB 2IUJA 5CF1A 1YJN3 4JF8A 2L4VA 2O3OA 2PNCA 3EQQB 2WO0A 4XBTA 1JN5A 4PEJA 3UJMA 1Q814 5STDA 3HZPA 3CC43 1UI8A 3SX1A 1QJGA 4O3VA 3CCE3 3JUMA 3K9MC 3D9RA 1NWWA 1N5HA 3FSDA 3OX9A 1HKXA 4EV2A 3GWRA 4HM6B 3UB1A 2CFLA 1JB2A 3EN8A 4OVMA 1QAKA 4N3VA 4XBYA 3EX9A 2O9UX 3D3LA 4WWUC 1N8R4 2GBWB 1HU9A 3FG3A 3DMCA 3CC23 2YFIB 3PS8A 3GRDA 2F86B 1Q42A 3NXJA 5AYRB 2D42A 3KFQC 2FNQA 5D81A 3LTBA 2HMLB 3F9SA 1D6YA 3STDA 4TX4A 3BNBA 2RFRA 3CPW2 5I97A 1FGTA 2W9PA 1O7HB 2HMKB 3RGAA 3EF8A 3JUPA 4CDLA 2MF7A 3HI7A 4J9AA 3LTDA 1WTHA 3MPHA 2QEX3 2W9QA 2STDA 1UUVB 3UNLA 3PYJA 3I563 3Q2PA 4O2HA 3CPOA 5EQLA 1RKYA 3AMOB 1W7CA 1O7PB 1NJI4 3IPTA 3T0UA 1OCVA 1SQWA 1RRHA 4J8TA 5AEUB 2IA7A 1UUWB 3X40A 7STDA 5JBSA 1DMQA 4K61A 2UX0A 3J7Yd 3BNDA 3G4S3 4QWTA 4R4KA 1A90A 2HMNB 3WODG 5AIHA 3OWSA 2GEYA 1VZZA 4HVNA 1YGEA 1EA2A 4N6TA 1ROAA 2HMMB 1W5ZA 1Q7Y4 2XSHB 3JUNA 1SPUA 3K63A 2CC3A 3N9HA 5IEOA 5CF2A 1QVF2 4EBGA 1IVVA 1WNHA 1QMAA 3ECFA 4BTYA 3CMA3 2ML5A 3HIIA 2XGNA 5CK6A 3N8BA 3LXUX 5FW5A 1GD4A 5KP1A 3DGNA 2FXTA 3CCR3 4HM3B 5IF6A 2CH9A 1IDPA 2RSXA 3EJVA 4R9LA 3CXC2 1VQ43 5IW9A 3SOAA 3F40A 1IT7A 1K28A 1E3RA 3OXAA 2GEXA 3CNXA 1CEWI 1W6GA 5CXOA 4ORLA 4IPBA 4EV5A 5IENA 3V98A 3CNMA 1IVWA 1IV7A 1IV9A 1FGQA 1S723 3ER7A 3IMAB 3Q90A 4MEIA 1RN7A 1WMPA 1NO3A 3U97A 1ULIB 1ZO2A 3FKAA 3T8NA 1DMMA 3WDGB 1VQN3 3B4PA 1AV4A 4K90B 4L7KA 2P38A 1ULJB 2GBXB 3G713 5LC7A 1E97A 1UW1A 2QGUA 2IMJA 2W56B 1BUQA 3F14A 4HJLB 4G1MB 3PCRA 3IJEB 1OGXA 1QAFA 4FMDA 1US1A 3DZLA 5G2GA 5TGNA 2P0XA 2W04A 4FMAA 3DGOA 3FG4A 2F98A 2W2CA 1YJ93 1OHPA 3DY5A 3UL5A 2SBLA 1L5GB 2CIUA 3LTAA 2YFLB 1DYUA 2XSOB 3JVCA 3F7XA 1WQLB 2BO9B 4XDWA 4HZBB 1GD3A 1DMNA 3OWYA 2GU3A 1Q40B 4HM7B 3CD63 5KP4A 2Z76A 3LZAA 1VQ53 1OHOA 3DGLA 4HM0B 1G96A 3V99A 1TU5A 2BT3A 1IQ8A 3GAXA 2QIYA 5ELUA 3S27A 5IG3A 5AI1A 3NBRA 3HK4A 4K1VA 4XB5A 3LT9A 1KD14 4LEHA 3DUKA 1OHSA 1GS3A 1AR0A 4LZIA 4H61A 1IQYA 3KZTA 3FF2A 4N6UA 3L0RA 2M7OA 1C7HA 3ALAA 4NHFA 4HZ9B 2JDIH 4BTWA 2OCTA 2OQEC 3F8HA 2C10A 1O7WB 3JUQA 2GU1A 4HM5B 2ZL8A 2OQEA 2WGOA 3DGMA 3S28A 3SXXA 1PFPA 1OGZA 2E2VA 3WA3A 1VQP3 4MMZB 3GZBA 4XDVA 3F8XA 4R9KA 4LGQA 1OUNA 1YHQ3 4X2HA 2K0MA 2K54A 4O8SA 1VQ83 2Y74A 3NBBA 3CCV3 1R4CA 4KFFA 1OF5B 2CFDA 3OW22 3EN1B 2CG1A 1QALA 1ISKA 5HGRA 4STDA 2CFKA 1STFI 5A0OB 1K41A 4FMBA 4HM2B 3SVAA 2LYXA 1M904 1SIHA 4CCVA 5EVHA 2R4IA 1WMNA 3EC9A 1S5AA 2JQ5A 4XBXA 1IVUA 4OUQA 1W4NA 4L8OA 2BNGA 1M1XB 3G0KA 2HMOB 4U13A 2WGQA 2Y73A 1FA3A 2XGLA 3HIGA 3PGBA 1W6YA 1VQ93 3G16A 4HM4B 3EBYA 2BMQB 3LTCA 3VF1A 2BHMA 2OWPA 5IEPA 3MHEA 2CWVA 3HX8A 4EXRA 3NBJA 1Q824 2FGTA 1SJWA 3LMLA 5JPUA 2RGQA 2CW9A 2W0QA 4WYKB 1JB5A 2BMOB 5AIGA 1KWIA 3KSPA 1JJ22 1FGMA 1OH0A 3RGRA 1O7GB 3X42A 1YIT3 3EB8A 3CCJ3 3SEDA 3FLJA 4XM4A 1TP6A 4RZMA 4KVHA 1SIIA 3NM7A 2XFSA 3FH1A 3K7CA 4NREA 4MJDA 3CC73 1NU3A 5KP3A 2Z77A 2WOFA 2XR8B 2OTJ3 1W6CA 2QA43 1U5OA 2PZVA 3MSOA 3CU3A 3CCL3 3LH4A 1W01A 2OOVC 2P09A 1LOXA 2MC8A 3BLZA 3FGYA 4X2OA 5CLKA 4IIAA 1LXEA 3JUOA 5D82A 2YX9A 3MWZA 1Q40A 2OOVA 2CFWA 1CQSA 3NUVA 3MYTA 5JPPA 4N6NB 2E2UA 3K5TA 1UI7A 5IERA 3EHCA 3GZYB 3BNEA 3M8CA 3CCQ3 3NHXA 3U1WA 1MOLA 4O02B 3I553 1Q864 2W03A 1ZX2A 3KN4A 4EC6A 3NV0B 1ASKA 5AIIA 3QRDA 4MMYB 5IG0A 3X3YA 1NB5I 4N6MA 1N5PA 2IUKA 3BB9A 3O8YA 4KFEA 4RNYA 2BMRB 1RRLA 1TFKA 4LMIA 3NQZA 5ELJA 1MNLA 1DVCA 1JB4A 2KCDA 2CKFB 1VQK3 1J2BA 1W02A 1Z1SA 3KIIA 3TDGA 3MG1A 1GY6A 5LC6A 4I4KA 1TUHA 3E99A 4ZM8A 4MMXB 2B24B 3F7SA 4EYCA 1Y4KA 3SLUA 4RBNA 3FG1A 3EE1A 5BXQA 3MG2A 3FF0A 1A2VA 1K9M4 1N9JA 3B4OA 1OF5A 2XFTA 3MKIA 3WMDA 1JV2B 4BTXA 3PZWA 3V92A 1M9GA 1WMOA 5AYSC 3AMOA 3GZRA 1JKGB 2LQVA 8CHOA 1EG9B 1VQM3 1KC84 5EEOA 3KKGA 2RCDA 3OV4A 2ZDJA 2Q07A 4R80A 5DREA 1IQXA 1ROVA 3LYGA 4N6OB 2KXGA 5IG5A 1GY7A 2Z7AA 4WP5A 5BVBA 1AVKA 2B1XB 2W6JH 5D83A 1JN5B 5FGOA 3S29A 2OTL3 3FCSB 2I9WA 2P05A 3S5CA 4HM1B 1LNHA 1E3VA 3KE7A 1EQKA 5AEWB 1VQO3 4HYZA 1N8QA 1A2KA 4RNZA 6STDA 2D1WA 3K0ZA 4Q53A 3A76A 3KSED 1AVLA 1KQS2 3NM2A 4HBRA 2E2TA 4FCJA 1K8A4 2GXFA 3CCM3 4GL6A 3BNCA 3PXMA 4H3UA 4WYKA 2CFGA 4HKVB 1N9EA 1GYBA 1NB3I 1V74A 3N54B 2CHCA 4FR9A 3WOEB 4AEQA 3WOFB 4KFDA 3X3ZA 1YI23 3SOYA 5IG4A 1RJOA 1FGRA 1GY5A 2ML6A 3T8UA 3UL6A 1OPYA 4WFOA 1LVNA 3WA2X 2KRTA 1D6UA 4LSOA 1TFOA 1OACA 2F99A 4FMCA 1YJW3 1IK3A 2XF3A 1YIJ3 3I0YA 1FUWA 4N6V0 1FGOA 2W56A 1YVBI 2CWTA 1JNQA 3QK9A 4R1KA 3Q1CA 1JRQA 3B8LA 4HM8B 3CCU3 3RDEA 1A67A 5AIFA 3H51A 1STDA 1VQL3 1CYVA 3NQYA 3DM8A 3ROBA 1F8NA 4L8PA 5DRVA 4N6LA 4OK0A 3FZWA 2C11A 1D6ZA 3G6E3 1PU4A 3NV0A 2XRXB 3VSYA 3CME3 4K1UA 3CCS3 4FCMA 4KZ1A 1T5YA 3GZXB 3PCSA 3X41A 4FCZA 2CWUA 3MG3A 1VQ63
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFJ B;  2A15 A;  2HMJ B;  3VGN A;  1W00 A;  3OWU A;  1O7M B;  3EBT A;  1JKG A;  3H3H A;  3G8Z A;  3B7C A;  1O7N B;  4GB5 A;  3DXO A;  1NDO B;  2INX A;  5CF1 A;  3EQQ B;  4XBT A;  3UJM A;  1JN5 A;  4PEJ A;  5STD A;  3HZP A;  1QJG A;  3JUM A;  3D9R A;  1NWW A;  3FSD A;  3OX9 A;  1HKX A;  3GWR A;  4HM6 B;  1JB2 A;  3EN8 A;  4OVM A;  4N3V A;  4XBY A;  3EX9 A;  4WWU C;  2GBW B;  3DMC A;  2YFI B;  3GRD A;  2F86 B;  1Q42 A;  3NXJ A;  5D81 A;  2HML B;  3F9S A;  3STD A;  2RFR A;  1O7H B;  2HMK B;  3RGA A;  3EF8 A;  3JUP A;  4CDL A;  4J9A A;  2STD A;  1UUV B;  3UNL A;  3CPO A;  1O7P B;  3IPT A;  5AEU B;  1OCV A;  4J8T A;  1UUW B;  7STD A;  1DMQ A;  2UX0 A;  2HMN B;  5AIH A;  3OWS A;  2GEY A;  1VZZ A;  4HVN A;  1EA2 A;  2HMM B;  2XSH B;  3JUN A;  5IEO A;  5CF2 A;  3ECF A;  1QMA A;  5CK6 A;  5FW5 A;  5KP1 A;  4HM3 B;  5IF6 A;  1IDP A;  3EJV A;  4R9L A;  3SOA A;  3F40 A;  1E3R A;  3OXA A;  2GEX A;  3CNX A;  5CXO A;  4ORL A;  5IEN A;  3CNM A;  3ER7 A;  3Q90 A;  1ULI B;  1ZO2 A;  3FKA A;  3T8N A;  1DMM A;  3B4P A;  4L7K A;  1ULJ B;  2GBX B;  1E97 A;  2QGU A;  2IMJ A;  1BUQ A;  3F14 A;  4HJL B;  1OGX A;  5G2G A;  3DZL A;  5TGN A;  2F98 A;  2W2C A;  1OHP A;  2YFL B;  2XSO B;  3F7X A;  1WQL B;  4XDW A;  4HZB B;  1DMN A;  3OWY A;  1Q40 B;  4HM7 B;  5KP4 A;  2Z76 A;  3LZA A;  1OHO A;  4HM0 B;  2QIY A;  5IG3 A;  5AI1 A;  3NBR A;  3HK4 A;  4K1V A;  4XB5 A;  4LEH A;  3DUK A;  1OHS A;  1GS3 A;  1AR0 A;  3KZT A;  3FF2 A;  1C7H A;  4HZ9 B;  3F8H A;  3JUQ A;  1O7W B;  4HM5 B;  1OGZ A;  3GZB A;  4XDV A;  3F8X A;  4R9K A;  4LGQ A;  1OUN A;  4X2H A;  2K54 A;  1OF5 B;  3EN1 B;  1ISK A;  5HGR A;  4STD A;  1K41 A;  4HM2 B;  5EVH A;  2R4I A;  3EC9 A;  1S5A A;  2JQ5 A;  4XBX A;  4OUQ A;  4L8O A;  2BNG A;  3G0K A;  2HMO B;  4U13 A;  1W6Y A;  3G16 A;  4HM4 B;  3EBY A;  2BMQ B;  2OWP A;  5IEP A;  3MHE A;  3HX8 A;  1SJW A;  5JPU A;  2RGQ A;  4WYK B;  1JB5 A;  2BMO B;  5AIG A;  3KSP A;  1OH0 A;  3RGR A;  1O7G B;  3SED A;  3FLJ A;  4XM4 A;  1TP6 A;  4RZM A;  4KVH A;  3FH1 A;  3K7C A;  4MJD A;  1NU3 A;  5KP3 A;  2Z77 A;  2XR8 B;  1U5O A;  2PZV A;  3MSO A;  3CU3 A;  1W01 A;  3BLZ A;  3FGY A;  4X2O A;  5CLK A;  4IIA A;  3JUO A;  5D82 A;  1Q40 A;  1CQS A;  3NUV A;  3MYT A;  5JPP A;  5IER A;  3EHC A;  3GZY B;  3M8C A;  3NHX A;  1ZX2 A;  3NV0 B;  1ASK A;  5AII A;  5IG0 A;  3BB9 A;  2BMR B;  4LMI A;  1JB4 A;  2CKF B;  1W02 A;  1Z1S A;  3MG1 A;  1GY6 A;  4I4K A;  1TUH A;  3E99 A;  2B24 B;  3F7S A;  5BXQ A;  3MG2 A;  3FF0 A;  3B4O A;  3MKI A;  1OF5 A;  3WMD A;  3GZR A;  1JKG B;  8CHO A;  1EG9 B;  3KKG A;  2RCD A;  3OV4 A;  5DRE A;  3LYG A;  5IG5 A;  1GY7 A;  2Z7A A;  4WP5 A;  5BVB A;  2B1X B;  5D83 A;  1JN5 B;  2I9W A;  3S5C A;  4HM1 B;  1E3V A;  3KE7 A;  5AEW B;  1A2K A;  6STD A;  3K0Z A;  4Q53 A;  3A76 A;  3NM2 A;  4FCJ A;  2GXF A;  4H3U A;  4WYK A;  4HKV B;  1GYB A;  2CHC A;  3SOY A;  5IG4 A;  1GY5 A;  3T8U A;  1OPY A;  2F99 A;  3I0Y A;  4R1K A;  3B8L A;  4HM8 B;  5AIF A;  3H51 A;  1STD A;  3DM8 A;  3ROB A;  4L8P A;  5DRV A;  3FZW A;  3NV0 A;  2XRX B;  3VSY A;  4K1U A;  4FCM A;  3GZX B;  3MG3 A; 
#chains in the Genus database with same CATH topology
 2YFJ B;  1R4Y A;  4AKY A;  3LOY A;  3D5I A;  3S67 A;  2CX0 A;  3X3X A;  3D79 A;  2A15 A;  2P0M A;  2V1L A;  2WOH A;  1FUT A;  3NX0 A;  2XEP A;  1BOX A;  2HMJ B;  2KAA A;  1TJD A;  4WHA A;  3VGN A;  1QVG 2;  1IU7 A;  1W00 A;  1RGK A;  3OWU A;  1B2S A;  1IT8 A;  1EKM A;  1IVX A;  1O7M B;  2IYJ A;  1TIJ A;  2Z6B A;  1M1K 4;  2XH9 A;  5GSP A;  3EBT A;  2CG0 A;  2CK3 H;  4IT7 A;  4I5Q A;  1W2B 2;  1KSI A;  1JKG A;  1RN4 A;  3H3H A;  3G8Z A;  3LT8 A;  3B7C A;  4JRF A;  1O7N B;  4GB5 A;  4AKZ A;  1VQ7 3;  1CYU A;  3DXO A;  1DVD A;  1K73 4;  1W2Z A;  1NDO B;  2INX A;  1U8C B;  2IUJ A;  2AAD A;  5CF1 A;  1ZGX A;  1YJN 3;  4JF8 A;  2BIR A;  1I8V A;  2L4V A;  2O3O A;  2PNC A;  4LYL B;  3EQQ B;  2WO0 A;  3HOH A;  1JN5 A;  4PEJ A;  4XBT A;  3UJM A;  5BIR A;  1Q81 4;  5STD A;  3HZP A;  3CC4 3;  4HOH A;  1UI8 A;  3D4A A;  3SX1 A;  1QJG A;  1JBS A;  4O3V A;  3CCE 3;  3JUM A;  3K9M C;  3D9R A;  1NWW A;  1N5H A;  3FSD A;  3OX9 A;  1HKX A;  4EV2 A;  1HYF A;  3GWR A;  4HM6 B;  2CFL A;  3UB1 A;  1JB2 A;  3EN8 A;  1I2G A;  1QAK A;  4N3V A;  3AHS A;  1UGI A;  4OVM A;  4XBY A;  3EX9 A;  2O9U X;  3Q3F A;  3D3L A;  4WWU C;  1A2P A;  2BU4 A;  1N8R 4;  2GBW B;  1SAR A;  1HU9 A;  3FG3 A;  3DMC A;  3CC2 3;  2YFI B;  3PS8 A;  3GRD A;  2F86 B;  1Q42 A;  1T2H A;  1BAN A;  3NXJ A;  5AYR B;  2D42 A;  3KFQ C;  2FNQ A;  5D81 A;  3LTB A;  2HML B;  1HZ1 A;  1D6Y A;  3F9S A;  3STD A;  2UUG C;  4TX4 A;  2R41 A;  3BNB A;  3ZG0 A;  2RFR A;  3CPW 2;  5I97 A;  1FGT A;  2W9P A;  1O7H B;  2HMK B;  3RGA A;  3EF8 A;  3JUP A;  4CDL A;  2MF7 A;  3HI7 A;  4J9A A;  3LTD A;  1WTH A;  3MPH A;  2QEX 3;  1YGW A;  2W9Q A;  2STD A;  1BRS A;  1UUV B;  3UNL A;  1GOU A;  3PYJ A;  3I56 3;  3Q2P A;  4O2H A;  3CPO A;  2RNT A;  5EQL A;  1RKY A;  3AMO B;  1W7C A;  1JBT A;  1O7P B;  1NJI 4;  3IPT A;  6GSP A;  3T0U A;  1OCV A;  1SQW A;  1RRH A;  4J8T A;  5AEU B;  2IA7 A;  1UUW B;  3X40 A;  2ZHX B;  1YNV X;  7STD A;  5JBS A;  1DMQ A;  2KF5 A;  1AQZ A;  4K61 A;  2UX0 A;  3J7Y d;  3BND A;  3SYU A;  3G4S 3;  3RNT A;  4QWT A;  3KCH A;  2H0H A;  4R4K A;  1A90 A;  2HMN B;  3WOD G;  5AIH A;  3OWS A;  2GEY A;  1VZZ A;  4HVN A;  1YGE A;  1BRN L;  1EA2 A;  3DGY A;  4N6T A;  1ROA A;  2HMM B;  1W5Z A;  1Q7Y 4;  2XSH B;  1GMP A;  1SPU A;  3JUN A;  3K63 A;  2CC3 A;  3N9H A;  5IEO A;  3D5G A;  5CF2 A;  4EBG A;  1IVV A;  1WNH A;  1QMA A;  3ECF A;  4BTY A;  3CMA 3;  1QVF 2;  2ML5 A;  3URP A;  2RBI A;  3HII A;  2XGN A;  5CK6 A;  3N8B A;  3LXU X;  5FW5 A;  1GD4 A;  5BU4 A;  3DGN A;  2FXT A;  5KP1 A;  3CCR 3;  4BL2 A;  4HM3 B;  1BRH A;  1EEJ A;  2F4Y A;  1BRG A;  2OTJ 3;  1BNJ A;  5IF6 A;  2CH9 A;  1IDP A;  2RSX A;  3EJV A;  4R9L A;  3CXC 2;  1VQ4 3;  5IW9 A;  3SOA A;  3F40 A;  1IT7 A;  1K28 A;  1E3R A;  3OXA A;  2GEX A;  3CNX A;  1UCK A;  1W6G A;  1CEW I;  5CXO A;  1NNV A;  1X1U A;  1MWS A;  4IPB A;  4ORL A;  4EV5 A;  7RNT A;  1BNR A;  1RGL A;  5IEN A;  1BNG A;  3CNM A;  3V98 A;  1IVW A;  1IV7 A;  1IV9 A;  1FGQ A;  1S72 3;  3ER7 A;  3IMA B;  3Q90 A;  4MEI A;  1BVI A;  1RN7 A;  1WMP A;  1NO3 A;  5M1A A;  1UUG B;  1ULI B;  1ZO2 A;  3U97 A;  4CJN A;  3FKA A;  3T8N A;  1DMM A;  3WDG B;  1VQN 3;  3B4P A;  1AV4 A;  4K90 B;  3GSP A;  4L7K A;  2P38 A;  1B2U A;  1ULJ B;  1Q7H A;  2F5W A;  2GBX B;  1E97 A;  5LC7 A;  1UW1 A;  2QGU A;  3G71 3;  1RLS A;  5RNT A;  2IMJ A;  2W56 B;  1BUQ A;  3F14 A;  4HJL B;  4G1M B;  3PCR A;  3IJE B;  1OGX A;  1QAF A;  4FMD A;  1US1 A;  3DZL A;  5G2G A;  5TGN A;  2P0X A;  2W04 A;  4FMA A;  3DGO A;  1BUJ A;  3FG4 A;  1X1W A;  2F98 A;  2W2C A;  1YJ9 3;  3A5E A;  1OHP A;  1B2X A;  3DY5 A;  3UL5 A;  3AHW A;  2SBL A;  1L5G B;  2CIU A;  3LTA A;  4BIR A;  2YFL B;  3ZG5 A;  1B20 A;  1DYU A;  2XSO B;  4HAA A;  3JVC A;  3F7X A;  5HOH A;  1RSN A;  1GMQ A;  1WQL B;  2BO9 B;  4XDW A;  4HZB B;  1BAO A;  1GD3 A;  1DMN A;  3OWY A;  2GU3 A;  1Q40 B;  1RHL A;  4HM7 B;  3CD6 3;  5KP4 A;  2Z76 A;  3LZA A;  1VQ5 3;  1OHO A;  1G02 A;  3DGL A;  4HM0 B;  1G96 A;  3V99 A;  1TU5 A;  2BT3 A;  1IQ8 A;  3GAX A;  2QIY A;  5ELU A;  3S27 A;  5G1K A;  2H0I A;  5IG3 A;  5AI1 A;  3NBR A;  2UGI A;  5G1L A;  3HK4 A;  4K1V A;  1BSD A;  4XB5 A;  3LT9 A;  1KD1 4;  4LEH A;  3DUK A;  1OHS A;  1GS3 A;  3WHO A;  1AR0 A;  4LZI A;  3ZFZ A;  2CX1 A;  4H61 A;  1IQY A;  3KZT A;  1UCL A;  3FF2 A;  4N6U A;  3L0R A;  2M7O A;  1C7H A;  3ALA A;  4NHF A;  4HZ9 B;  4ILF A;  2JDI H;  4BTW A;  2OCT A;  1I3I A;  2OQE C;  3F8H A;  2C10 A;  1O7W B;  3JUQ A;  1I2E A;  1FYS A;  2GU1 A;  4HM5 B;  2ZL8 A;  1RCK A;  2OQE A;  1LNI A;  2WGO A;  3DGM A;  3S28 A;  3SXX A;  1RNT A;  1PFP A;  1OGZ A;  2E2V A;  4BL3 A;  3WA3 A;  1VQP 3;  4MMZ B;  3GZB A;  4XDV A;  3F8X A;  4KT3 B;  4R9K A;  1RN1 A;  4LGQ A;  1OUN A;  1YHQ 3;  4X2H A;  2K0M A;  7GSP A;  2K54 A;  4O8S A;  1VQ8 3;  2Y74 A;  3NBB A;  3CCV 3;  1RNB A;  1R4C A;  4KFF A;  1OF5 B;  2CFD A;  3OW2 2;  1BSA A;  1T2I A;  1V57 A;  1I2F A;  3EN1 B;  2CG1 A;  1QAL A;  1ISK A;  2HOH A;  5HGR A;  4STD A;  1BNI A;  2CFK A;  1STF I;  5A0O B;  1K41 A;  4FMB A;  4HM2 B;  3SVA A;  2LYX A;  1M90 4;  1SIH A;  4CCV A;  5EVH A;  1I3F A;  1WMN A;  2R4I A;  3EC9 A;  1S5A A;  2JQ5 A;  4XBX A;  1IVU A;  4OUQ A;  5M19 A;  1GSP A;  1W4N A;  1BSC A;  4L8O A;  1RGG A;  2BNG A;  1M1X B;  1V58 A;  3G0K A;  2HMO B;  4U13 A;  2WGQ A;  1MGW A;  2Y73 A;  1FA3 A;  1B27 A;  2XGL A;  1MWU A;  1IYY A;  3HIG A;  3PGB A;  1W6Y A;  1B2M A;  1VQ9 3;  3G16 A;  4HM4 B;  3EBY A;  2BMQ B;  3LTC A;  3VF1 A;  1RGF A;  2BHM A;  1X1X A;  1LQM B;  2OWP A;  1I70 A;  5IEP A;  3MHE A;  2CWV A;  1AY7 A;  3HX8 A;  1DE3 A;  4EW5 A;  4EXR A;  3NBJ A;  1Q82 4;  2FGT A;  1SJW A;  3LML A;  5JPU A;  2RGQ A;  2CW9 A;  2W0Q A;  4WYK B;  1JB5 A;  2BMO B;  5AIG A;  1BSE A;  1KWI A;  1LQG C;  1UGH I;  1FGM A;  3KSP A;  8RNT A;  1JJ2 2;  1OH0 A;  2GSP A;  3RGR A;  1O7G B;  3X42 A;  1YIT 3;  3EB8 A;  3CCJ 3;  3SED A;  3FLJ A;  4XM4 A;  9RNT A;  1TP6 A;  4RZM A;  4KVH A;  1FUS A;  3AGN A;  1SII A;  3NM7 A;  2XFS A;  3FH1 A;  3K7C A;  4NRE A;  4MJD A;  3CC7 3;  1NU3 A;  5KP3 A;  1RMS A;  2WOF A;  1RCL A;  2XR8 B;  1W6C A;  1GOV A;  2Z77 A;  1U5O A;  2PZV A;  2QA4 3;  3MSO A;  3CU3 A;  3CCL 3;  3LH4 A;  1W01 A;  2OOV C;  2P09 A;  1LOX A;  3BU4 A;  2MC8 A;  1LOW A;  3BLZ A;  3FGY A;  4X2O A;  1MWR A;  4IIA A;  1LXE A;  3JUO A;  5CLK A;  2YX9 A;  5D82 A;  3MWZ A;  1Q40 A;  3BIR A;  2CFW A;  1CQS A;  2OOV A;  3NUV A;  3MYT A;  5JPP A;  4N6N B;  2E2U A;  3K5T A;  1UI7 A;  2L1S A;  5IER A;  3EHC A;  2KF4 A;  3GZY B;  3BNE A;  3M8C A;  3CCQ 3;  3NHX A;  3U1W A;  1LOY A;  1MOL A;  4O02 B;  3I55 3;  1Q86 4;  2W03 A;  1ZX2 A;  3KN4 A;  4EC6 A;  4GHO A;  3NV0 B;  1ASK A;  5AII A;  3QRD A;  4MMY B;  5IG0 A;  3X3Y A;  1NB5 I;  4N6M A;  1N5P A;  2IUK A;  3BB9 A;  3O8Y A;  4KFE A;  4RNY A;  4J5K A;  2BMR B;  1I0X A;  1RRL A;  1TFK A;  3NQZ A;  4LMI A;  5ELJ A;  1MNL A;  1BRI A;  1DVC A;  2AAE A;  1JB4 A;  1BNS A;  2CKF B;  2KCD A;  1VQK 3;  1J2B A;  1W02 A;  1Z1S A;  3DH2 A;  3KII A;  3TDG A;  1RGA A;  1GY6 A;  3MG1 A;  1BRJ A;  1PY3 A;  5LC6 A;  4I4K A;  1TUH A;  1BIR A;  3E99 A;  4MMX B;  2B24 B;  3F7S A;  4EYC A;  4ZM8 A;  1Y4K A;  3SLU A;  4RBN A;  1Q9E A;  3FG1 A;  2KF3 A;  3EE1 A;  1TRP A;  1T3B A;  5BXQ A;  3MG2 A;  3FF0 A;  1A2V A;  1K9M 4;  1N9J A;  2XFT A;  1OF5 A;  2SAR A;  3B4O A;  3MKI A;  1JV2 B;  3WMD A;  2IY2 A;  3PZW A;  3V92 A;  1M9G A;  3WR2 A;  4BTX A;  1FZU A;  1WMO A;  5AYS C;  3AMO A;  3GZR A;  1JKG B;  1MGR A;  1BNE A;  1BSB A;  1EG9 B;  2LQV A;  4J5G A;  5EEO A;  8CHO A;  3KKG A;  1I0V A;  2RCD A;  3OV4 A;  1GOY A;  1ZS7 A;  2ZDJ A;  2Q07 A;  1CH0 A;  4R80 A;  5DRE A;  1IQX A;  1ROV A;  3LYG A;  1UCJ A;  4N6O B;  2KXG A;  5IG5 A;  1MWT A;  1GY7 A;  2Z7A A;  4WP5 A;  5BVB A;  1AVK A;  1DET A;  2H0G A;  1RGC A;  1FW7 A;  2B1X B;  2W6J H;  4GSP A;  5D83 A;  1JN5 B;  4BU4 A;  2F56 A;  5FGO A;  3S29 A;  2OTL 3;  3FCS B;  2I9W A;  2P05 A;  3S5C A;  4HM1 B;  1LNH A;  1E3V A;  3KE7 A;  1EQK A;  5AEW B;  1VQO 3;  1TTO A;  4HYZ A;  1N8Q A;  1A2K A;  4RNZ A;  6STD A;  1JZD A;  1BU4 A;  2D1W A;  1B3S A;  3K0Z A;  4Q53 A;  4RNT A;  3A76 A;  3KSE D;  1AVL A;  4CPK A;  3NM2 A;  1VQM 3;  1KQS 2;  4HBR A;  2E2T A;  4FCJ A;  1LRA A;  2GXF A;  3CCM 3;  1K8A 4;  4GL6 A;  2C4B A;  3BNC A;  3PXM A;  4H3U A;  4WYK A;  2CFG A;  4HKV B;  1N9E A;  1GYB A;  1NB3 I;  1V74 A;  1TRQ A;  3N54 B;  4NPB A;  4DKI A;  2CHC A;  4FR9 A;  3WOE B;  4AEQ A;  3WOF B;  4KFD A;  3X3Z A;  5M18 A;  1YI2 3;  3AGO A;  3SOY A;  5IG4 A;  1BGS A;  1RJO A;  1FGR A;  1GY5 A;  2ML6 A;  2K3D A;  3T8U A;  1OPY A;  3UL6 A;  1RGE A;  4WFO A;  1LVN A;  1BNF A;  3WA2 X;  2KRT A;  6RNT A;  1D6U A;  4LSO A;  1TFO A;  1C54 A;  1OAC A;  1KC8 4;  2F99 A;  4FMC A;  1YJW 3;  1YVS A;  1IK3 A;  2XF3 A;  1YIJ 3;  3I0Y A;  2KF6 A;  1FUW A;  4N6V 0;  1FGO A;  2W56 A;  1YVB I;  1UCI A;  2CWT A;  1JNQ A;  3QK9 A;  1B2Z A;  4R1K A;  1RGH A;  3Q1C A;  2F5M A;  1JRQ A;  1LOV A;  3B8L A;  4HM8 B;  1G0T A;  3RDE A;  1B21 A;  3CCU 3;  1JBR A;  1A67 A;  5AIF A;  3H51 A;  1STD A;  1VQL 3;  1CYV A;  3NQY A;  3DM8 A;  1EUI C;  3ROB A;  1F8N A;  2ZA4 A;  4L8P A;  5DRV A;  4N6L A;  4OK0 A;  3FZW A;  1RTU A;  2C11 A;  1D6Z A;  3G6E 3;  1PYL A;  1PU4 A;  3NV0 A;  1UDI I;  1RDS A;  1X1Y A;  2J8X B;  2XRX B;  3VSY A;  3CME 3;  1GMR A;  4K1U A;  3CCS 3;  4FCM A;  1VQQ A;  4KZ1 A;  1T5Y A;  1JZO A;  3GZX B;  1BRK A;  3PCS A;  3X41 A;  4FCZ A;  2CWU A;  3MG3 A;  1VQ6 3; 
#chains in the Genus database with same CATH homology
 2YFJ B;  4AKY A;  3LOY A;  3S67 A;  3X3X A;  2A15 A;  2P0M A;  2V1L A;  2WOH A;  3NX0 A;  2XEP A;  2HMJ B;  4WHA A;  3VGN A;  1QVG 2;  1IU7 A;  1W00 A;  3OWU A;  1IT8 A;  1EKM A;  1IVX A;  1O7M B;  1TIJ A;  2Z6B A;  1M1K 4;  2XH9 A;  3EBT A;  2CG0 A;  2CK3 H;  4IT7 A;  1W2B 2;  1KSI A;  1JKG A;  3H3H A;  3G8Z A;  3LT8 A;  3B7C A;  4JRF A;  1O7N B;  4GB5 A;  4AKZ A;  1VQ7 3;  1CYU A;  3DXO A;  1DVD A;  1K73 4;  1W2Z A;  1NDO B;  2INX A;  1U8C B;  2IUJ A;  5CF1 A;  1YJN 3;  4JF8 A;  2L4V A;  2O3O A;  2PNC A;  3EQQ B;  2WO0 A;  4XBT A;  1JN5 A;  4PEJ A;  3UJM A;  1Q81 4;  5STD A;  3HZP A;  3CC4 3;  1UI8 A;  3SX1 A;  1QJG A;  4O3V A;  3CCE 3;  3JUM A;  3K9M C;  3D9R A;  1NWW A;  1N5H A;  3FSD A;  3OX9 A;  1HKX A;  4EV2 A;  3GWR A;  4HM6 B;  3UB1 A;  2CFL A;  1JB2 A;  3EN8 A;  4OVM A;  1QAK A;  4N3V A;  4XBY A;  3EX9 A;  2O9U X;  3D3L A;  4WWU C;  1N8R 4;  2GBW B;  1HU9 A;  3FG3 A;  3DMC A;  3CC2 3;  2YFI B;  3PS8 A;  3GRD A;  2F86 B;  1Q42 A;  3NXJ A;  5AYR B;  2D42 A;  3KFQ C;  2FNQ A;  5D81 A;  3LTB A;  2HML B;  3F9S A;  1D6Y A;  3STD A;  4TX4 A;  3BNB A;  2RFR A;  3CPW 2;  5I97 A;  1FGT A;  2W9P A;  1O7H B;  2HMK B;  3RGA A;  3EF8 A;  3JUP A;  4CDL A;  2MF7 A;  3HI7 A;  4J9A A;  3LTD A;  1WTH A;  3MPH A;  2QEX 3;  2W9Q A;  2STD A;  1UUV B;  3UNL A;  3PYJ A;  3I56 3;  3Q2P A;  4O2H A;  3CPO A;  5EQL A;  1RKY A;  3AMO B;  1W7C A;  1O7P B;  1NJI 4;  3IPT A;  3T0U A;  1OCV A;  1SQW A;  1RRH A;  4J8T A;  5AEU B;  2IA7 A;  1UUW B;  3X40 A;  7STD A;  5JBS A;  1DMQ A;  4K61 A;  2UX0 A;  3J7Y d;  3BND A;  3G4S 3;  4QWT A;  4R4K A;  1A90 A;  2HMN B;  3WOD G;  5AIH A;  3OWS A;  2GEY A;  1VZZ A;  4HVN A;  1YGE A;  1EA2 A;  4N6T A;  1ROA A;  2HMM B;  1W5Z A;  1Q7Y 4;  2XSH B;  3JUN A;  1SPU A;  3K63 A;  2CC3 A;  3N9H A;  5IEO A;  5CF2 A;  1QVF 2;  4EBG A;  1IVV A;  1WNH A;  1QMA A;  3ECF A;  4BTY A;  3CMA 3;  2ML5 A;  3HII A;  2XGN A;  5CK6 A;  3N8B A;  3LXU X;  5FW5 A;  1GD4 A;  5KP1 A;  3DGN A;  2FXT A;  3CCR 3;  4HM3 B;  5IF6 A;  2CH9 A;  1IDP A;  2RSX A;  3EJV A;  4R9L A;  3CXC 2;  1VQ4 3;  5IW9 A;  3SOA A;  3F40 A;  1IT7 A;  1K28 A;  1E3R A;  3OXA A;  2GEX A;  3CNX A;  1CEW I;  1W6G A;  5CXO A;  4ORL A;  4IPB A;  4EV5 A;  5IEN A;  3V98 A;  3CNM A;  1IVW A;  1IV7 A;  1IV9 A;  1FGQ A;  1S72 3;  3ER7 A;  3IMA B;  3Q90 A;  4MEI A;  1RN7 A;  1WMP A;  1NO3 A;  3U97 A;  1ULI B;  1ZO2 A;  3FKA A;  3T8N A;  1DMM A;  3WDG B;  1VQN 3;  3B4P A;  1AV4 A;  4K90 B;  4L7K A;  2P38 A;  1ULJ B;  2GBX B;  3G71 3;  5LC7 A;  1E97 A;  1UW1 A;  2QGU A;  2IMJ A;  2W56 B;  1BUQ A;  3F14 A;  4HJL B;  4G1M B;  3PCR A;  3IJE B;  1OGX A;  1QAF A;  4FMD A;  1US1 A;  3DZL A;  5G2G A;  5TGN A;  2P0X A;  2W04 A;  4FMA A;  3DGO A;  3FG4 A;  2F98 A;  2W2C A;  1YJ9 3;  1OHP A;  3DY5 A;  3UL5 A;  2SBL A;  1L5G B;  2CIU A;  3LTA A;  2YFL B;  1DYU A;  2XSO B;  3JVC A;  3F7X A;  1WQL B;  2BO9 B;  4XDW A;  4HZB B;  1GD3 A;  1DMN A;  3OWY A;  2GU3 A;  1Q40 B;  4HM7 B;  3CD6 3;  5KP4 A;  2Z76 A;  3LZA A;  1VQ5 3;  1OHO A;  3DGL A;  4HM0 B;  1G96 A;  3V99 A;  1TU5 A;  2BT3 A;  1IQ8 A;  3GAX A;  2QIY A;  5ELU A;  3S27 A;  5IG3 A;  5AI1 A;  3NBR A;  3HK4 A;  4K1V A;  4XB5 A;  3LT9 A;  1KD1 4;  4LEH A;  3DUK A;  1OHS A;  1GS3 A;  1AR0 A;  4LZI A;  4H61 A;  1IQY A;  3KZT A;  3FF2 A;  4N6U A;  3L0R A;  2M7O A;  1C7H A;  3ALA A;  4NHF A;  4HZ9 B;  2JDI H;  4BTW A;  2OCT A;  2OQE C;  3F8H A;  2C10 A;  1O7W B;  3JUQ A;  2GU1 A;  4HM5 B;  2ZL8 A;  2OQE A;  2WGO A;  3DGM A;  3S28 A;  3SXX A;  1PFP A;  1OGZ A;  2E2V A;  3WA3 A;  1VQP 3;  4MMZ B;  3GZB A;  4XDV A;  3F8X A;  4R9K A;  4LGQ A;  1OUN A;  1YHQ 3;  4X2H A;  2K0M A;  2K54 A;  4O8S A;  1VQ8 3;  2Y74 A;  3NBB A;  3CCV 3;  1R4C A;  4KFF A;  1OF5 B;  2CFD A;  3OW2 2;  3EN1 B;  2CG1 A;  1QAL A;  1ISK A;  5HGR A;  4STD A;  2CFK A;  1STF I;  5A0O B;  1K41 A;  4FMB A;  4HM2 B;  3SVA A;  2LYX A;  1M90 4;  1SIH A;  4CCV A;  5EVH A;  2R4I A;  1WMN A;  3EC9 A;  1S5A A;  2JQ5 A;  4XBX A;  1IVU A;  4OUQ A;  1W4N A;  4L8O A;  2BNG A;  1M1X B;  3G0K A;  2HMO B;  4U13 A;  2WGQ A;  2Y73 A;  1FA3 A;  2XGL A;  3HIG A;  3PGB A;  1W6Y A;  1VQ9 3;  3G16 A;  4HM4 B;  3EBY A;  2BMQ B;  3LTC A;  3VF1 A;  2BHM A;  2OWP A;  5IEP A;  3MHE A;  2CWV A;  3HX8 A;  4EXR A;  3NBJ A;  1Q82 4;  2FGT A;  1SJW A;  3LML A;  5JPU A;  2RGQ A;  2CW9 A;  2W0Q A;  4WYK B;  1JB5 A;  2BMO B;  5AIG A;  1KWI A;  3KSP A;  1JJ2 2;  1FGM A;  1OH0 A;  3RGR A;  1O7G B;  3X42 A;  1YIT 3;  3EB8 A;  3CCJ 3;  3SED A;  3FLJ A;  4XM4 A;  1TP6 A;  4RZM A;  4KVH A;  1SII A;  3NM7 A;  2XFS A;  3FH1 A;  3K7C A;  4NRE A;  4MJD A;  3CC7 3;  1NU3 A;  5KP3 A;  2Z77 A;  2WOF A;  2XR8 B;  2OTJ 3;  1W6C A;  2QA4 3;  1U5O A;  2PZV A;  3MSO A;  3CU3 A;  3CCL 3;  3LH4 A;  1W01 A;  2OOV C;  2P09 A;  1LOX A;  2MC8 A;  3BLZ A;  3FGY A;  4X2O A;  5CLK A;  4IIA A;  1LXE A;  3JUO A;  5D82 A;  2YX9 A;  3MWZ A;  1Q40 A;  2OOV A;  2CFW A;  1CQS A;  3NUV A;  3MYT A;  5JPP A;  4N6N B;  2E2U A;  3K5T A;  1UI7 A;  5IER A;  3EHC A;  3GZY B;  3BNE A;  3M8C A;  3CCQ 3;  3NHX A;  3U1W A;  1MOL A;  4O02 B;  3I55 3;  1Q86 4;  2W03 A;  1ZX2 A;  3KN4 A;  4EC6 A;  3NV0 B;  1ASK A;  5AII A;  3QRD A;  4MMY B;  5IG0 A;  3X3Y A;  1NB5 I;  4N6M A;  1N5P A;  2IUK A;  3BB9 A;  3O8Y A;  4KFE A;  4RNY A;  2BMR B;  1RRL A;  1TFK A;  4LMI A;  3NQZ A;  5ELJ A;  1MNL A;  1DVC A;  1JB4 A;  2KCD A;  2CKF B;  1VQK 3;  1J2B A;  1W02 A;  1Z1S A;  3KII A;  3TDG A;  3MG1 A;  1GY6 A;  5LC6 A;  4I4K A;  1TUH A;  3E99 A;  4ZM8 A;  4MMX B;  2B24 B;  3F7S A;  4EYC A;  1Y4K A;  3SLU A;  4RBN A;  3FG1 A;  3EE1 A;  5BXQ A;  3MG2 A;  3FF0 A;  1A2V A;  1K9M 4;  1N9J A;  3B4O A;  1OF5 A;  2XFT A;  3MKI A;  3WMD A;  1JV2 B;  4BTX A;  3PZW A;  3V92 A;  1M9G A;  1WMO A;  5AYS C;  3AMO A;  3GZR A;  1JKG B;  2LQV A;  8CHO A;  1EG9 B;  1VQM 3;  1KC8 4;  5EEO A;  3KKG A;  2RCD A;  3OV4 A;  2ZDJ A;  2Q07 A;  4R80 A;  5DRE A;  1IQX A;  1ROV A;  3LYG A;  4N6O B;  2KXG A;  5IG5 A;  1GY7 A;  2Z7A A;  4WP5 A;  5BVB A;  1AVK A;  2B1X B;  2W6J H;  5D83 A;  1JN5 B;  5FGO A;  3S29 A;  2OTL 3;  3FCS B;  2I9W A;  2P05 A;  3S5C A;  4HM1 B;  1LNH A;  1E3V A;  3KE7 A;  1EQK A;  5AEW B;  1VQO 3;  4HYZ A;  1N8Q A;  1A2K A;  4RNZ A;  6STD A;  2D1W A;  3K0Z A;  4Q53 A;  3A76 A;  3KSE D;  1AVL A;  1KQS 2;  3NM2 A;  4HBR A;  2E2T A;  4FCJ A;  1K8A 4;  2GXF A;  3CCM 3;  4GL6 A;  3BNC A;  3PXM A;  4H3U A;  4WYK A;  2CFG A;  4HKV B;  1N9E A;  1GYB A;  1NB3 I;  1V74 A;  3N54 B;  2CHC A;  4FR9 A;  3WOE B;  4AEQ A;  3WOF B;  4KFD A;  3X3Z A;  1YI2 3;  3SOY A;  5IG4 A;  1RJO A;  1FGR A;  1GY5 A;  2ML6 A;  3T8U A;  3UL6 A;  1OPY A;  4WFO A;  1LVN A;  3WA2 X;  2KRT A;  1D6U A;  4LSO A;  1TFO A;  1OAC A;  2F99 A;  4FMC A;  1YJW 3;  1IK3 A;  2XF3 A;  1YIJ 3;  3I0Y A;  1FUW A;  4N6V 0;  1FGO A;  2W56 A;  1YVB I;  2CWT A;  1JNQ A;  3QK9 A;  4R1K A;  3Q1C A;  1JRQ A;  3B8L A;  4HM8 B;  3CCU 3;  3RDE A;  1A67 A;  5AIF A;  3H51 A;  1STD A;  1VQL 3;  1CYV A;  3NQY A;  3DM8 A;  3ROB A;  1F8N A;  4L8P A;  5DRV A;  4N6L A;  4OK0 A;  3FZW A;  2C11 A;  1D6Z A;  3G6E 3;  1PU4 A;  3NV0 A;  2XRX B;  3VSY A;  3CME 3;  4K1U A;  3CCS 3;  4FCM A;  4KZ1 A;  1T5Y A;  3GZX B;  3PCS A;  3X41 A;  4FCZ A;  2CWU A;  3MG3 A;  1VQ6 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...