3QRDA

Crystal structure of l68v mutant of human cystatin c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
total genus 18
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3qrdA00
5ELUA 1CEWI 1RN7A 3UL6A 1FA3A 1FUWA 2KXGA 3SVAA 1A90A 2CH9A 1N9JA 4TX4A 4N6OB 3KSED 1LXEA 1STFI 1MNLA 3PXMA 4N6UA 4N6TA 3GAXA 2OCTA 5EQLA 3L0RA 1WNHA 1CYUA 4IT7A 4CCVA 5LC6A 1PFPA 3KFQC 3LH4A 1G96A 3PS8A 4N6NB 5ELJA 2O9UX 3MWZA 4LZIA 3QRDA 3IMAB 1DVCA 1NB5I 1GD3A 2W9QA 1KWIA 1R4CA 1GD4A 4N6V0 3PYJA 1NB3I 1ROAA 1CYVA 1YVBI 4EYCA 1A67A 1DVDA 1TIJA 1EQKA 1IV7A 1M9GA 4N6LA 2BO9B 1IV9A 4ZM8A 4N6MA 3K9MC 1MOLA 3Q2PA 5A0OB 1N5PA 2W9PA 1N5HA 3UL5A 3NX0A 3S67A 5LC7A
chains in the Genus database with same CATH superfamily
4R1KA 1EEJA 2XSHB 1BNEA 1OF5B 2KF6A 3U97A 1UUVB 3CCR3 1IK3A 1NNVA 2CWTA 2XF3A 1W6CA 1G02A 2Z76A 3KSPA 1PYLA 5AEUB 4KVHA 2RBIA 4K90B 3GZXB 4O2HA 4EBGA 2W03A 4EW5A 1W6YA 1PY3A 2O9UX 4HM2B 1BRSA 3QRDA 3I553 1Q42A 3DY5A 3FZWA 4AKYA 1BUJA 3T0UA 3AHWA 1RGFA 1FZUA 1RGHA 1BSEA 1QMAA 5G1LA 4CPKA 1JB5A 1RMSA 1T5YA 2IUKA 1BRGA 3EN1B 1IVUA 3B8LA 3HOHA 3D9RA 1AR0A 1W4NA 2JDIH 2RSXA 2ZDJA 4PEJA 1CEWI 1Q40B 5IF6A 2Y73A 5EVHA 3CXC2 4HAAA 1MWUA 1SJWA 1LNHA 2R4IA 1BRJA 2IY2A 1BSAA 3VGNA 3Q1CA 4K1UA 1S723 2BNGA 1HZ1A 2CFGA 2ZA4A 3SOYA 1D6ZA 2CFKA 2B24B 4HKVB 4ILFA 3KE7A 4WHAA 4EC6A 3J7Yd 1VQM3 1BOXA 1V57A 2W9QA 1BIRA 2K0MA 3MYTA 1M1K4 1TU5A 2W56A 3BNCA 3KKGA 1LOVA 3LYGA 1ROVA 3DXOA 1BNGA 3IPTA 3STDA 2GU1A 1AQZA 4BTWA 8RNTA 2V1LA 1RKYA 1JV2B 4EV2A 2K54A 5M1AA 4FR9A 4X2HA 3SEDA 3GSPA 4DKIA 3F14A 3G0KA 4TX4A 3URPA 1A2KA 2KF5A 1W02A 1OPYA 4RNZA 3GAXA 3NM7A 2RCDA 3NQYA 4GB5A 3BB9A 1QALA 5EQLA 4AKZA 5CF2A 4N3VA 4RZMA 3WA2X 5RNTA 3HIIA 4CCVA 3KFQC 3DZLA 5LC6A 3T8UA 2ML6A 1IVXA 2CFWA 4I4KA 2HMKB 2KCDA 1IQXA 5IEOA 2E2UA 7STDA 3V92A 2BHMA 3DGMA 1NB3I 2KF3A 4K1VA 1B2SA 1K28A 2E2VA 2W2CA 2P09A 1W5ZA 4OUQA 1NJI4 2Q07A 5IG5A 1B27A 4N6MA 3OX9A 1QAKA 1BNIA 3N8BA 2W9PA 3N9HA 4EYCA 4EV5A 4R9LA 4BL2A 4GSPA 2M7OA 1IVVA 1TUHA 1IYYA 1I70A 1SPUA 1KQS2 1OCVA 1K734 1ZX2A 1KSIA 1OHSA 2YFJB 3G8ZA 3T8NA 3M8CA 1GMRA 4RBNA 4XBTA 2RFRA 1LRAA 4WYKB 3NXJA 2CK3H 3NBJA 4BIRA 2IMJA 1G96A 5BVBA 1TRPA 1V74A 3GRDA 5CLKA 1N9EA 1I2EA 2K3DA 4XB5A 2JQ5A 3EX9A 3Q90A 1NWWA 1TFOA 5IG4A 5DRVA 3RGAA 4WWUC 5STDA 1STDA 3B4PA 2F5WA 5JPUA 3NM2A 1W01A 3AHSA 3K9MC 3ZFZA 1F8NA 1V58A 1AY7A 3E99A 3NX0A 1JRQA 1Y4KA 1UI7A 2QA43 5CF1A 3LTCA 5CK6A 2IUJA 3F8HA 3CCJ3 3CPOA 5EEOA 1W2ZA 1FGTA 4MMYB 2HMOB 3KSED 1LXEA 2D42A 2B1XB 1IVWA 4H61A 5I97A 2BMRB 2FXTA 4LEHA 1RNBA 6GSPA 2XSOB 1LQGC 3WOFB 1A2PA 1E97A 4ZM8A 2OQEC 4XBYA 4O8SA 1YIJ3 1LNIA 1OGXA 3B7CA 2GXFA 5G1KA 2OTJ3 3EBTA 3OXAA 5FGOA 4KFDA 3MG2A 1ASKA 1CQSA 1I8VA 1TIJA 3LXUX 3DUKA 1GY5A 4FCMA 3EC9A 4N6LA 1BSCA 3ER7A 3OV4A 1IT8A 4XDVA 1X1WA 2H0IA 4HM4B 4O02B 5GSPA 5AIGA 5BIRA 1C54A 1IU7A 1TP6A 2C10A 1O7WB 5HGRA 1A90A 5D81A 1TJDA 1YGEA 1B2UA 2WOHA 4NREA 1BNSA 3QK9A 1G0TA 3FCSB 1ISKA 2A15A 2O3OA 3LT9A 4MMXB 2L4VA 6RNTA 4BL3A 1WNHA 2UX0A 2W04A 1VQ53 2OQEA 3CC43 2CG0A 1VQ63 1DETA 2C11A 7RNTA 1VQP3 4KFEA 3AMOB 1FW7A 4HOHA 1JZDA 3DH2A 2LQVA 1GD4A 4NPBA 1HU9A 4N6V0 1UDII 4CDLA 1RCKA 3GZRA 4XBXA 4WYKA 3CMA3 2F99A 5IENA 2CWVA 4HVNA 3F8XA 3BLZA 4HM3B 4R9KA 1X1YA 3K63A 2ZHXB 1AVLA 5D83A 1WMNA 4XDWA 1SIHA 3WR2A 3CNMA 3EF8A 1GMQA 5AYRB 1T2HA 1W2B2 2HMJB 2L1SA 2LYXA 3EB8A 4FMAA 2GEYA 2PZVA 3LOYA 3FSDA 1YJW3 4J5KA 1JBSA 4HM5B 4HZBB 1TFKA 2CHCA 1NU3A 3NHXA 3U1WA 5IEPA 1BVIA 2KAAA 3MKIA 2RGQA 3F40A 1Q864 1I3IA 1IV9A 2CIUA 1JN5A 1N8R4 2AAEA 3KN4A 1RCLA 1YVSA 4HM0B 1BGSA 2CFDA 1FGOA 1O7GB 3AGOA 3Q3FA 3WOEB 4LGQA 2OTL3 2CKFB 3D5IA 4LYLB 2Z6BA 2BMOB 5HOHA 1VQN3 4N6OB 3ECFA 1K8A4 1M904 4Q53A 2GSPA 1JKGA 2F56A 4HZ9B 3CCL3 1O7MB 3EQQB 4HYZA 3HK4A 5BXQA 1B2MA 3DGYA 1ZGXA 1D6UA 1I0VA 1LQMB 1MWRA 1Q9EA 3I0YA 3LZAA 1VQQA 3CCQ3 2SBLA 3O8YA 2CWUA 2CFLA 1R4CA 1BSBA 1FUSA 1GYBA 1AVKA 3A5EA 2W6JH 1UCIA 5BU4A 5KP4A 3JUQA 1IV7A 1JN5B 1E3RA 3FG4A 4AEQA 1RN4A 2WGOA 1MOLA 3NUVA 1TTOA 1N5HA 1HKXA 2WGQA 3S28A 1RGAA 3KZTA 4MEIA 1FA3A 2HMNB 3H3HA 4MMZB 2WO0A 1GSPA 1T2IA 2P38A 3CU3A 1BRIA 1T3BA 2GBWB 2CX1A 3PCRA 4WFOA 2SARA 1O7PB 1U5OA 2YFIB 1B2XA 3AGNA 4K61A 1MNLA 4L8OA 4N6TA 1GY7A 5JPPA 1Q814 1VQ43 3CNXA 5KP3A 1OGZA 1DYUA 2J8XB 2XEPA 3V98A 4L7KA 1GOYA 3F7XA 3D4AA 3FH1A 3BNEA 2OWPA 3D5GA 1GS3A 1I0XA 2Z77A 1BAOA 3DGOA 3KIIA 3SOAA 1IQ8A 5M18A 4ORLA 1OHOA 1K9M4 5D82A 2GU3A 1A67A 3G713 1M9GA 4BTYA 1UUGB 3I563 3G4S3 2YFLB 2ZL8A 1WTHA 4OVMA 1BU4A 1X1XA 2Z7AA 3HZPA 5LC7A 2F86B 3NQZA 1RGKA 2CX0A 3VF1A 1E3VA 3JUOA 1KC84 1IDPA 1W7CA 4J5GA 5DREA 5M19A 8CHOA 4CJNA 3OWYA 1LOYA 1GY6A 1STFI 3K7CA 4JF8A 1VQ83 3FF2A 3SYUA 1UCLA 1EKMA 3PZWA 4IT7A 1BRKA 3KCHA 1KD14 4HM1B 4GL6A 5AIHA 3WA3A 3ALAA 4FMDA 1W6GA 2IA7A 3CC73 1ULIB 1AV4A 1OH0A 1BNFA 2H0HA 3S5CA 4BU4A 1ULJB 3CC23 2UUGC 1JBTA 4NHFA 3NBRA 1FYSA 3V99A 1IQYA 3RDEA 1UUWB 3D3LA 4J8TA 1B2ZA 2KXGA 4KFFA 2R41A 3X41A 3EBYA 2ML5A 1B3SA 1K41A 2CH9A 4WP5A 1JBRA 5TGNA 3UNLA 2E2TA 4KT3B 2Y74A 2OOVA 5IG3A 3X3ZA 4HJLB 2F5MA 1EA2A 3HIGA 3IJEB 2XFSA 4HM8B 3LH4A 3PS8A 3ZG0A 1DMQA 2BU4A 1FUTA 2FNQA 3MWZA 3G16A 3DGLA 3JUPA 2UGIA 4X2OA 4G1MB 1GMPA 2XRXB 3RGRA 3PYJA 4HM6B 1ROAA 3TDGA 5AIIA 1RGLA 3BU4A 7GSPA 3DGNA 3MG3A 3A76A 3Q2PA 1LVNA 1N5PA 1MGWA 1YJN3 3LTAA 3FKAA 1A2VA 2H0GA 3DMCA 5IW9A 3X3XA 3B4OA 3LTBA 1FUWA 1QVF2 1M1XB 3UB1A 3UJMA 2HMLB 4R4KA 1VQK3 2D1WA 5AI1A 3GZYB 1MWSA 1L5GB 3X3YA 6STDA 5CXOA 4GHOA 2XH9A 1RSNA 2XGNA 3CCS3 1B21A 2CG1A 3HI7A 3BIRA 1BRHA 1UI8A 1Z1SA 2HMMB 4LZIA 1BANA 1WQLB 1UGHI 3RNTA 3AMOA 3MPHA 1MGRA 3VSYA 2CC3A 1SQWA 1W00A 5G2GA 3EE1A 2KRTA 3MHEA 4FCJA 1RHLA 2QEX3 1OHPA 4RNYA 3MSOA 1BSDA 1I2GA 1I3FA 4FMBA 3PGBA 5FW5A 3CCM3 2IYJA 1O7HB 3OWSA 3FGYA 3F9SA 1CH0A 1LOXA 1EUIC 5AIFA 1UGIA 1EG9B 1FGQA 1VQ73 2P0XA 3JUMA 1VZZA 3MG1A 3OWUA 2GEXA 1OACA 4O3VA 3JVCA 4L8PA 1US1A 2INXA 2QGUA 1RDSA 1ZS7A 1TRQA 1D6YA 2P05A 3CPW2 3LMLA 1RLSA 1YNVX 3CD63 1Q40A 1WMOA 1QAFA 1ZO2A 4N6NB 1JJ22 1Q7Y4 1QJGA 3DM8A 1RGCA 2W0QA 2XGLA 3S27A 1KWIA 3S29A 3K5TA 5AYSC 4R80A 1CYVA 1FGRA 3SX1A 1BNRA 1FGMA 1JNQA 2HOHA 3BNDA 3EJVA 1RRHA 1RGGA 2MC8A 3OW22 2YX9A 3JUNA 3H51A 1RNTA 1UCJA 3F7SA 2W56B 3NV0A 1PU4A 4STDA 1LOWA 1JB4A 1I2FA 2QIYA 4QWTA 1WMPA 3PXMA 4N6UA 4OK0A 4H3UA 3GZBA 1JKGB 1DMMA 2KF4A 1CYUA 3WDGB 1MWTA 4FCZA 3CCE3 3SXXA 3ZG5A 1BRNL 1YHQ3 1UW1A 1NDOB 1NB5I 3FF0A 1C7HA 2P0MA 1VQL3 4IPBA 2BT3A 3ROBA 2BO9B 3X40A 2MF7A 1YI23 3S67A 5ELUA 1BNJA 3UL6A 1X1UA 1RRLA 2FGTA 1DE3A 3D79A 2RNTA 1UCKA 3CCV3 1QVG2 3G6E3 2PNCA 3LT8A 2OCTA 1VQO3 1J2BA 3FG1A 3L0RA 1RN1A 2XR8B 3K0ZA 5IERA 1OF5A 2F98A 1U8CB 3X42A 4EXRA 3IMAB 3BNBA 3LTDA 3CME3 1DVCA 1YGWA 2BIRA 3GWRA 4FMCA 1B20A 3EN8A 4HBRA 1VQ93 4LMIA 5AEWB 9RNTA 1DVDA 1O7NB 1YJ93 2BMQB 4J9AA 3SLUA 1SARA 1IT7A 4I5QA 3UL5A 2AADA 4LSOA 3CCU3 4XM4A 1RN7A 3EHCA 4JRFA 1JZOA 2C4BA 2XFTA 4RNTA 3SVAA 1YIT3 2WOFA 2F4YA 2GBXB 4MJDA 1JB2A 1GOVA 1N9JA 2STDA 1GOUA 5IG0A 5KP1A 1BUQA 1Q824 2I9WA 5JBSA 3WMDA 1PFPA 5ELJA 4IIAA 4BTXA 3PCSA 4U13A 1NO3A 3WODG 3NBBA 4KZ1A 3NV0B 3WHOA 1GD3A 1RJOA 1RGEA 1Q7HA 2CW9A 2OOVC 1YVBI 1EQKA 1R4YA 3FG3A 1HYFA 3FLJA 1DMNA 3HX8A 3N54B 4HM7B 5A0OB 1OUNA 1RTUA 1S5AA 1N8QA 1SIIA
chains in the Genus database with same CATH topology
4R1KA 2XSHB 1OF5B 3U97A 1UUVB 3CCR3 1IK3A 2CWTA 2XF3A 1W6CA 2Z76A 3KSPA 5AEUB 4KVHA 4K90B 3GZXB 4O2HA 4EBGA 2W03A 1W6YA 2O9UX 4HM2B 3QRDA 3I553 1Q42A 3DY5A 3FZWA 4AKYA 3T0UA 1QMAA 1JB5A 1T5YA 2IUKA 3EN1B 1IVUA 3B8LA 3D9RA 1AR0A 1W4NA 2JDIH 2RSXA 2ZDJA 4PEJA 1CEWI 1Q40B 5IF6A 2Y73A 5EVHA 3CXC2 1SJWA 1LNHA 2R4IA 3VGNA 3Q1CA 4K1UA 1S723 2BNGA 2CFGA 3SOYA 1D6ZA 2CFKA 2B24B 4HKVB 3KE7A 4WHAA 4EC6A 3J7Yd 1VQM3 2W9QA 2K0MA 3MYTA 1M1K4 1TU5A 2W56A 3BNCA 3KKGA 3LYGA 1ROVA 3DXOA 4BTWA 3IPTA 2GU1A 2V1LA 1RKYA 1JV2B 4EV2A 2K54A 4FR9A 4X2HA 3SEDA 3F14A 3G0KA 4TX4A 1A2KA 1W02A 1OPYA 4RNZA 3GAXA 3NM7A 2RCDA 3NQYA 4GB5A 3BB9A 1QALA 5EQLA 4AKZA 5CF2A 4N3VA 4RZMA 3WA2X 3HIIA 4CCVA 3KFQC 3DZLA 5LC6A 3T8UA 2ML6A 1IVXA 2CFWA 4I4KA 2HMKB 2KCDA 1IQXA 5IEOA 2E2UA 7STDA 3V92A 2BHMA 3DGMA 1NB3I 4K1VA 1K28A 2E2VA 2W2CA 2P09A 1W5ZA 4OUQA 1NJI4 2Q07A 5IG5A 4N6MA 3OX9A 1QAKA 3N9HA 3N8BA 2W9PA 4EYCA 4EV5A 4R9LA 2M7OA 1IVVA 1TUHA 1SPUA 1KQS2 1OCVA 1K734 1ZX2A 1KSIA 1OHSA 2YFJB 3G8ZA 3T8NA 3M8CA 4RBNA 4XBTA 2RFRA 4WYKB 3NXJA 2CK3H 3NBJA 2IMJA 1G96A 5BVBA 1V74A 3GRDA 5CLKA 1N9EA 4XB5A 2JQ5A 3EX9A 3Q90A 1NWWA 1TFOA 5IG4A 5DRVA 3RGAA 4WWUC 5STDA 1STDA 3B4PA 5JPUA 3NM2A 1W01A 3K9MC 1F8NA 3E99A 3NX0A 1JRQA 1Y4KA 1UI7A 2QA43 5CF1A 3LTCA 5CK6A 2IUJA 3F8HA 3CCJ3 3CPOA 5EEOA 1W2ZA 1FGTA 4MMYB 2HMOB 3KSED 1LXEA 2D42A 2B1XB 1IVWA 4H61A 5I97A 2BMRB 2FXTA 4LEHA 2XSOB 3WOFB 1E97A 4ZM8A 2OQEC 4XBYA 4O8SA 1YIJ3 3B7CA 1OGXA 2GXFA 2OTJ3 3EBTA 3OXAA 5FGOA 4KFDA 3MG2A 1ASKA 1CQSA 1TIJA 3LXUX 4FCMA 3DUKA 1GY5A 4N6LA 3EC9A 3ER7A 3OV4A 1IT8A 4XDVA 4HM4B 4O02B 5AIGA 1IU7A 1TP6A 2C10A 1O7WB 5HGRA 1A90A 5D81A 1YGEA 2WOHA 4NREA 3QK9A 1ISKA 3FCSB 2A15A 2O3OA 3LT9A 4MMXB 2L4VA 1WNHA 2UX0A 2W04A 1VQ53 2OQEA 3CC43 2CG0A 1VQ63 2C11A 1VQP3 4KFEA 3AMOB 2LQVA 1GD4A 1HU9A 4N6V0 4CDLA 3GZRA 4XBXA 4WYKA 3CMA3 2F99A 5IENA 2CWVA 4HVNA 3F8XA 3BLZA 4HM3B 4R9KA 3K63A 1AVLA 5D83A 1WMNA 4XDWA 1SIHA 3CNMA 3EF8A 5AYRB 1W2B2 2HMJB 2LYXA 3EB8A 4FMAA 2GEYA 2PZVA 3LOYA 3FSDA 1YJW3 4HM5B 4HZBB 1TFKA 2CHCA 1NU3A 3NHXA 3U1WA 5IEPA 3MKIA 2RGQA 3F40A 1Q864 1IV9A 2CIUA 1JN5A 1N8R4 3KN4A 4HM0B 2CFDA 1FGOA 1O7GB 3WOEB 4LGQA 2OTL3 2CKFB 2Z6BA 2BMOB 1VQN3 4N6OB 3ECFA 1K8A4 1M904 4Q53A 1JKGA 4HZ9B 3CCL3 1O7MB 3EQQB 4HYZA 3HK4A 5BXQA 1D6UA 3LZAA 3I0YA 3CCQ3 2SBLA 3O8YA 2CWUA 2CFLA 1R4CA 1GYBA 1AVKA 2W6JH 5KP4A 3JUQA 1IV7A 1JN5B 1E3RA 3FG4A 4AEQA 2WGOA 1MOLA 3NUVA 1N5HA 1HKXA 2WGQA 3S28A 3KZTA 4MEIA 1FA3A 2HMNB 3H3HA 4MMZB 2WO0A 2P38A 3CU3A 4WFOA 3STDA 2GBWB 3PCRA 1O7PB 1U5OA 2YFIB 4K61A 1MNLA 4L8OA 4N6TA 1GY7A 5JPPA 1Q814 1VQ43 3CNXA 5KP3A 1OGZA 1DYUA 2XEPA 3V98A 4L7KA 3F7XA 3FH1A 3BNEA 2OWPA 3SOAA 1GS3A 2Z77A 3DGOA 3KIIA 1YJ93 1IQ8A 4ORLA 1OHOA 1K9M4 5D82A 2GU3A 1A67A 3G713 1M9GA 4BTYA 3I563 3G4S3 2YFLB 2ZL8A 1WTHA 4OVMA 3HZPA 2Z7AA 5LC7A 2F86B 3NQZA 3VF1A 1E3VA 3JUOA 1KC84 1IDPA 1W7CA 5DREA 8CHOA 3OWYA 1GY6A 1STFI 3K7CA 4JF8A 1VQ83 3FF2A 1EKMA 3PZWA 4IT7A 1KD14 4HM1B 4GL6A 5AIHA 3WA3A 3ALAA 4FMDA 1W6GA 2IA7A 3CC73 1ULIB 1AV4A 1OH0A 3S5CA 1ULJB 3CC23 4NHFA 3NBRA 3V99A 1IQYA 3RDEA 1UUWB 3D3LA 4J8TA 2KXGA 4KFFA 3X41A 3EBYA 2ML5A 1K41A 2CH9A 4WP5A 5TGNA 3UNLA 2E2TA 2Y74A 2OOVA 5IG3A 3X3ZA 4HJLB 1EA2A 3HIGA 3IJEB 2XFSA 4HM8B 3LH4A 3PS8A 1DMQA 2FNQA 3MWZA 3G16A 3DGLA 3JUPA 4X2OA 4G1MB 2XRXB 3RGRA 3PYJA 4HM6B 1ROAA 3TDGA 5AIIA 3DGNA 3MG3A 3A76A 3Q2PA 1LVNA 1N5PA 1YJN3 3LTAA 3FKAA 1A2VA 3DMCA 5IW9A 3X3XA 3B4OA 3LTBA 1FUWA 1QVF2 1M1XB 3UB1A 3UJMA 2HMLB 4R4KA 1VQK3 2D1WA 5AI1A 3GZYB 1L5GB 3X3YA 6STDA 5CXOA 2XH9A 2XGNA 3CCS3 2CG1A 3HI7A 1UI8A 1Z1SA 2HMMB 4LZIA 1WQLB 3AMOA 3MPHA 3VSYA 2CC3A 1SQWA 1W00A 5G2GA 3EE1A 2KRTA 3MHEA 4FCJA 2QEX3 1OHPA 4RNYA 3MSOA 4FMBA 3CCM3 3PGBA 5FW5A 1O7HB 3OWSA 3FGYA 3F9SA 1LOXA 5AIFA 1EG9B 1FGQA 1VQ73 2P0XA 3JUMA 1VZZA 3MG1A 3OWUA 2GEXA 1OACA 4O3VA 3JVCA 4L8PA 1US1A 2INXA 2QGUA 1D6YA 2P05A 3CPW2 3LMLA 3CD63 1Q40A 1WMOA 1QAFA 1ZO2A 4N6NB 1JJ22 1Q7Y4 1QJGA 3DM8A 2W0QA 2XGLA 3S29A 3S27A 1KWIA 3K5TA 5AYSC 4R80A 1CYVA 1FGRA 3SX1A 1FGMA 1JNQA 3BNDA 3EJVA 1RRHA 2MC8A 3OW22 2YX9A 3JUNA 3H51A 3F7SA 2W56B 3NV0A 1PU4A 4STDA 1JB4A 2QIYA 4QWTA 1WMPA 3PXMA 4N6UA 4OK0A 4H3UA 3GZBA 1JKGB 1DMMA 1CYUA 3WDGB 4FCZA 3CCE3 3SXXA 1YHQ3 1UW1A 1NDOB 1NB5I 3FF0A 1C7HA 2P0MA 1VQL3 4IPBA 2BT3A 3ROBA 2BO9B 3X40A 2MF7A 1YI23 3S67A 5ELUA 3UL6A 1RRLA 2FGTA 3CCV3 1QVG2 3G6E3 2PNCA 3LT8A 2OCTA 1VQO3 1J2BA 3FG1A 3L0RA 2XR8B 3K0ZA 5IERA 1OF5A 2F98A 1U8CB 3X42A 4EXRA 3IMAB 3BNBA 3LTDA 3CME3 1DVCA 3GWRA 4FMCA 1DVDA 3EN8A 4HBRA 1VQ93 4LMIA 5AEWB 1O7NB 2BMQB 4J9AA 3SLUA 1IT7A 3UL5A 4LSOA 3CCU3 4XM4A 1RN7A 3EHCA 4JRFA 2XFTA 3SVAA 1YIT3 2WOFA 4MJDA 2GBXB 1JB2A 1N9JA 2STDA 1BUQA 5IG0A 5KP1A 1Q824 2I9WA 5JBSA 3WMDA 1PFPA 5ELJA 4IIAA 4BTXA 3PCSA 4U13A 1NO3A 3WODG 3NBBA 4KZ1A 3NV0B 1GD3A 1RJOA 2CW9A 2OOVC 1YVBI 1EQKA 3HX8A 3FG3A 3FLJA 1DMNA 3N54B 4HM7B 5A0OB 1OUNA 1S5AA 1N8QA 1SIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELU A;  1CEW I;  1RN7 A;  3UL6 A;  1FA3 A;  1FUW A;  2KXG A;  3SVA A;  1A90 A;  2CH9 A;  1N9J A;  4TX4 A;  4N6O B;  3KSE D;  1LXE A;  1STF I;  1MNL A;  3PXM A;  4N6U A;  4N6T A;  3GAX A;  2OCT A;  5EQL A;  3L0R A;  1WNH A;  1CYU A;  4IT7 A;  4CCV A;  5LC6 A;  1PFP A;  3KFQ C;  3LH4 A;  1G96 A;  3PS8 A;  4N6N B;  5ELJ A;  2O9U X;  3MWZ A;  4LZI A;  3QRD A;  3IMA B;  1DVC A;  1NB5 I;  1GD3 A;  2W9Q A;  1KWI A;  1R4C A;  1GD4 A;  4N6V 0;  3PYJ A;  1NB3 I;  1ROA A;  1CYV A;  1YVB I;  4EYC A;  1A67 A;  1DVD A;  1TIJ A;  1EQK A;  1IV7 A;  1M9G A;  4N6L A;  2BO9 B;  1IV9 A;  4ZM8 A;  4N6M A;  3K9M C;  1MOL A;  3Q2P A;  5A0O B;  1N5P A;  2W9P A;  1N5H A;  3UL5 A;  3NX0 A;  3S67 A;  5LC7 A; 
#chains in the Genus database with same CATH topology
 4R1K A;  1EEJ A;  2XSH B;  1BNE A;  1OF5 B;  2KF6 A;  3U97 A;  1UUV B;  3CCR 3;  1IK3 A;  1NNV A;  2CWT A;  2XF3 A;  1W6C A;  1G02 A;  2Z76 A;  3KSP A;  1PYL A;  5AEU B;  4KVH A;  2RBI A;  4K90 B;  3GZX B;  4O2H A;  4EBG A;  2W03 A;  4EW5 A;  1W6Y A;  1PY3 A;  2O9U X;  4HM2 B;  1BRS A;  3QRD A;  3I55 3;  1Q42 A;  3DY5 A;  3FZW A;  4AKY A;  1BUJ A;  3T0U A;  3AHW A;  1RGF A;  1FZU A;  1RGH A;  1BSE A;  1QMA A;  5G1L A;  4CPK A;  1JB5 A;  1RMS A;  1T5Y A;  2IUK A;  1BRG A;  3EN1 B;  1IVU A;  3B8L A;  3HOH A;  3D9R A;  1AR0 A;  1W4N A;  2JDI H;  2RSX A;  2ZDJ A;  4PEJ A;  1CEW I;  1Q40 B;  5IF6 A;  2Y73 A;  5EVH A;  3CXC 2;  4HAA A;  1MWU A;  1SJW A;  1LNH A;  2R4I A;  1BRJ A;  2IY2 A;  1BSA A;  3VGN A;  3Q1C A;  4K1U A;  1S72 3;  2BNG A;  1HZ1 A;  2CFG A;  2ZA4 A;  3SOY A;  1D6Z A;  2CFK A;  2B24 B;  4HKV B;  4ILF A;  3KE7 A;  4WHA A;  4EC6 A;  3J7Y d;  1VQM 3;  1BOX A;  1V57 A;  2W9Q A;  1BIR A;  2K0M A;  3MYT A;  1M1K 4;  1TU5 A;  2W56 A;  3BNC A;  3KKG A;  1LOV A;  3LYG A;  1ROV A;  3DXO A;  1BNG A;  3IPT A;  3STD A;  2GU1 A;  1AQZ A;  4BTW A;  8RNT A;  2V1L A;  1RKY A;  1JV2 B;  4EV2 A;  2K54 A;  5M1A A;  4FR9 A;  4X2H A;  3SED A;  3GSP A;  4DKI A;  3F14 A;  3G0K A;  4TX4 A;  3URP A;  1A2K A;  2KF5 A;  1W02 A;  1OPY A;  4RNZ A;  3GAX A;  3NM7 A;  2RCD A;  3NQY A;  4GB5 A;  3BB9 A;  1QAL A;  5EQL A;  4AKZ A;  5CF2 A;  4N3V A;  4RZM A;  3WA2 X;  5RNT A;  3HII A;  4CCV A;  3KFQ C;  3DZL A;  5LC6 A;  3T8U A;  2ML6 A;  1IVX A;  2CFW A;  4I4K A;  2HMK B;  2KCD A;  1IQX A;  5IEO A;  2E2U A;  7STD A;  3V92 A;  2BHM A;  3DGM A;  1NB3 I;  2KF3 A;  4K1V A;  1B2S A;  1K28 A;  2E2V A;  2W2C A;  2P09 A;  1W5Z A;  4OUQ A;  1NJI 4;  2Q07 A;  5IG5 A;  1B27 A;  4N6M A;  3OX9 A;  1QAK A;  1BNI A;  3N8B A;  2W9P A;  3N9H A;  4EYC A;  4EV5 A;  4R9L A;  4BL2 A;  4GSP A;  2M7O A;  1IVV A;  1TUH A;  1IYY A;  1I70 A;  1SPU A;  1KQS 2;  1OCV A;  1K73 4;  1ZX2 A;  1KSI A;  1OHS A;  2YFJ B;  3G8Z A;  3T8N A;  3M8C A;  1GMR A;  4RBN A;  4XBT A;  2RFR A;  1LRA A;  4WYK B;  3NXJ A;  2CK3 H;  3NBJ A;  4BIR A;  2IMJ A;  1G96 A;  5BVB A;  1TRP A;  1V74 A;  3GRD A;  5CLK A;  1N9E A;  1I2E A;  2K3D A;  4XB5 A;  2JQ5 A;  3EX9 A;  3Q90 A;  1NWW A;  1TFO A;  5IG4 A;  5DRV A;  3RGA A;  4WWU C;  5STD A;  1STD A;  3B4P A;  2F5W A;  5JPU A;  3NM2 A;  1W01 A;  3AHS A;  3K9M C;  3ZFZ A;  1F8N A;  1V58 A;  1AY7 A;  3E99 A;  3NX0 A;  1JRQ A;  1Y4K A;  1UI7 A;  2QA4 3;  5CF1 A;  3LTC A;  5CK6 A;  2IUJ A;  3F8H A;  3CCJ 3;  3CPO A;  5EEO A;  1W2Z A;  1FGT A;  4MMY B;  2HMO B;  3KSE D;  1LXE A;  2D42 A;  2B1X B;  1IVW A;  4H61 A;  5I97 A;  2BMR B;  2FXT A;  4LEH A;  1RNB A;  6GSP A;  2XSO B;  1LQG C;  3WOF B;  1A2P A;  1E97 A;  4ZM8 A;  2OQE C;  4XBY A;  4O8S A;  1YIJ 3;  1LNI A;  1OGX A;  3B7C A;  2GXF A;  5G1K A;  2OTJ 3;  3EBT A;  3OXA A;  5FGO A;  4KFD A;  3MG2 A;  1ASK A;  1CQS A;  1I8V A;  1TIJ A;  3LXU X;  3DUK A;  1GY5 A;  4FCM A;  3EC9 A;  4N6L A;  1BSC A;  3ER7 A;  3OV4 A;  1IT8 A;  4XDV A;  1X1W A;  2H0I A;  4HM4 B;  4O02 B;  5GSP A;  5AIG A;  5BIR A;  1C54 A;  1IU7 A;  1TP6 A;  2C10 A;  1O7W B;  5HGR A;  1A90 A;  5D81 A;  1TJD A;  1YGE A;  1B2U A;  2WOH A;  4NRE A;  1BNS A;  3QK9 A;  1G0T A;  3FCS B;  1ISK A;  2A15 A;  2O3O A;  3LT9 A;  4MMX B;  2L4V A;  6RNT A;  4BL3 A;  1WNH A;  2UX0 A;  2W04 A;  1VQ5 3;  2OQE A;  3CC4 3;  2CG0 A;  1VQ6 3;  1DET A;  2C11 A;  7RNT A;  1VQP 3;  4KFE A;  3AMO B;  1FW7 A;  4HOH A;  1JZD A;  3DH2 A;  2LQV A;  1GD4 A;  4NPB A;  1HU9 A;  4N6V 0;  1UDI I;  4CDL A;  1RCK A;  3GZR A;  4XBX A;  4WYK A;  3CMA 3;  2F99 A;  5IEN A;  2CWV A;  4HVN A;  3F8X A;  3BLZ A;  4HM3 B;  4R9K A;  1X1Y A;  3K63 A;  2ZHX B;  1AVL A;  5D83 A;  1WMN A;  4XDW A;  1SIH A;  3WR2 A;  3CNM A;  3EF8 A;  1GMQ A;  5AYR B;  1T2H A;  1W2B 2;  2HMJ B;  2L1S A;  2LYX A;  3EB8 A;  4FMA A;  2GEY A;  2PZV A;  3LOY A;  3FSD A;  1YJW 3;  4J5K A;  1JBS A;  4HM5 B;  4HZB B;  1TFK A;  2CHC A;  1NU3 A;  3NHX A;  3U1W A;  5IEP A;  1BVI A;  2KAA A;  3MKI A;  2RGQ A;  3F40 A;  1Q86 4;  1I3I A;  1IV9 A;  2CIU A;  1JN5 A;  1N8R 4;  2AAE A;  3KN4 A;  1RCL A;  1YVS A;  4HM0 B;  1BGS A;  2CFD A;  1FGO A;  1O7G B;  3AGO A;  3Q3F A;  3WOE B;  4LGQ A;  2OTL 3;  2CKF B;  3D5I A;  4LYL B;  2Z6B A;  2BMO B;  5HOH A;  1VQN 3;  4N6O B;  3ECF A;  1K8A 4;  1M90 4;  4Q53 A;  2GSP A;  1JKG A;  2F56 A;  4HZ9 B;  3CCL 3;  1O7M B;  3EQQ B;  4HYZ A;  3HK4 A;  5BXQ A;  1B2M A;  3DGY A;  1ZGX A;  1D6U A;  1I0V A;  1LQM B;  1MWR A;  1Q9E A;  3I0Y A;  3LZA A;  1VQQ A;  3CCQ 3;  2SBL A;  3O8Y A;  2CWU A;  2CFL A;  1R4C A;  1BSB A;  1FUS A;  1GYB A;  1AVK A;  3A5E A;  2W6J H;  1UCI A;  5BU4 A;  5KP4 A;  3JUQ A;  1IV7 A;  1JN5 B;  1E3R A;  3FG4 A;  4AEQ A;  1RN4 A;  2WGO A;  1MOL A;  3NUV A;  1TTO A;  1N5H A;  1HKX A;  2WGQ A;  3S28 A;  1RGA A;  3KZT A;  4MEI A;  1FA3 A;  2HMN B;  3H3H A;  4MMZ B;  2WO0 A;  1GSP A;  1T2I A;  2P38 A;  3CU3 A;  1BRI A;  1T3B A;  2GBW B;  2CX1 A;  3PCR A;  4WFO A;  2SAR A;  1O7P B;  1U5O A;  2YFI B;  1B2X A;  3AGN A;  4K61 A;  1MNL A;  4L8O A;  4N6T A;  1GY7 A;  5JPP A;  1Q81 4;  1VQ4 3;  3CNX A;  5KP3 A;  1OGZ A;  1DYU A;  2J8X B;  2XEP A;  3V98 A;  4L7K A;  1GOY A;  3F7X A;  3D4A A;  3FH1 A;  3BNE A;  2OWP A;  3D5G A;  1GS3 A;  1I0X A;  2Z77 A;  1BAO A;  3DGO A;  3KII A;  3SOA A;  1IQ8 A;  5M18 A;  4ORL A;  1OHO A;  1K9M 4;  5D82 A;  2GU3 A;  1A67 A;  3G71 3;  1M9G A;  4BTY A;  1UUG B;  3I56 3;  3G4S 3;  2YFL B;  2ZL8 A;  1WTH A;  4OVM A;  1BU4 A;  1X1X A;  2Z7A A;  3HZP A;  5LC7 A;  2F86 B;  3NQZ A;  1RGK A;  2CX0 A;  3VF1 A;  1E3V A;  3JUO A;  1KC8 4;  1IDP A;  1W7C A;  4J5G A;  5DRE A;  5M19 A;  8CHO A;  4CJN A;  3OWY A;  1LOY A;  1GY6 A;  1STF I;  3K7C A;  4JF8 A;  1VQ8 3;  3FF2 A;  3SYU A;  1UCL A;  1EKM A;  3PZW A;  4IT7 A;  1BRK A;  3KCH A;  1KD1 4;  4HM1 B;  4GL6 A;  5AIH A;  3WA3 A;  3ALA A;  4FMD A;  1W6G A;  2IA7 A;  3CC7 3;  1ULI B;  1AV4 A;  1OH0 A;  1BNF A;  2H0H A;  3S5C A;  4BU4 A;  1ULJ B;  3CC2 3;  2UUG C;  1JBT A;  4NHF A;  3NBR A;  1FYS A;  3V99 A;  1IQY A;  3RDE A;  1UUW B;  3D3L A;  4J8T A;  1B2Z A;  2KXG A;  4KFF A;  2R41 A;  3X41 A;  3EBY A;  2ML5 A;  1B3S A;  1K41 A;  2CH9 A;  4WP5 A;  1JBR A;  5TGN A;  3UNL A;  2E2T A;  4KT3 B;  2Y74 A;  2OOV A;  5IG3 A;  3X3Z A;  4HJL B;  2F5M A;  1EA2 A;  3HIG A;  3IJE B;  2XFS A;  4HM8 B;  3LH4 A;  3PS8 A;  3ZG0 A;  1DMQ A;  2BU4 A;  1FUT A;  2FNQ A;  3MWZ A;  3G16 A;  3DGL A;  3JUP A;  2UGI A;  4X2O A;  4G1M B;  1GMP A;  2XRX B;  3RGR A;  3PYJ A;  4HM6 B;  1ROA A;  3TDG A;  5AII A;  1RGL A;  3BU4 A;  7GSP A;  3DGN A;  3MG3 A;  3A76 A;  3Q2P A;  1LVN A;  1N5P A;  1MGW A;  1YJN 3;  3LTA A;  3FKA A;  1A2V A;  2H0G A;  3DMC A;  5IW9 A;  3X3X A;  3B4O A;  3LTB A;  1FUW A;  1QVF 2;  1M1X B;  3UB1 A;  3UJM A;  2HML B;  4R4K A;  1VQK 3;  2D1W A;  5AI1 A;  3GZY B;  1MWS A;  1L5G B;  3X3Y A;  6STD A;  5CXO A;  4GHO A;  2XH9 A;  1RSN A;  2XGN A;  3CCS 3;  1B21 A;  2CG1 A;  3HI7 A;  3BIR A;  1BRH A;  1UI8 A;  1Z1S A;  2HMM B;  4LZI A;  1BAN A;  1WQL B;  1UGH I;  3RNT A;  3AMO A;  3MPH A;  1MGR A;  3VSY A;  2CC3 A;  1SQW A;  1W00 A;  5G2G A;  3EE1 A;  2KRT A;  3MHE A;  4FCJ A;  1RHL A;  2QEX 3;  1OHP A;  4RNY A;  3MSO A;  1BSD A;  1I2G A;  1I3F A;  4FMB A;  3PGB A;  5FW5 A;  3CCM 3;  2IYJ A;  1O7H B;  3OWS A;  3FGY A;  3F9S A;  1CH0 A;  1LOX A;  1EUI C;  5AIF A;  1UGI A;  1EG9 B;  1FGQ A;  1VQ7 3;  2P0X A;  3JUM A;  1VZZ A;  3MG1 A;  3OWU A;  2GEX A;  1OAC A;  4O3V A;  3JVC A;  4L8P A;  1US1 A;  2INX A;  2QGU A;  1RDS A;  1ZS7 A;  1TRQ A;  1D6Y A;  2P05 A;  3CPW 2;  3LML A;  1RLS A;  1YNV X;  3CD6 3;  1Q40 A;  1WMO A;  1QAF A;  1ZO2 A;  4N6N B;  1JJ2 2;  1Q7Y 4;  1QJG A;  3DM8 A;  1RGC A;  2W0Q A;  2XGL A;  3S27 A;  1KWI A;  3S29 A;  3K5T A;  5AYS C;  4R80 A;  1CYV A;  1FGR A;  3SX1 A;  1BNR A;  1FGM A;  1JNQ A;  2HOH A;  3BND A;  3EJV A;  1RRH A;  1RGG A;  2MC8 A;  3OW2 2;  2YX9 A;  3JUN A;  3H51 A;  1RNT A;  1UCJ A;  3F7S A;  2W56 B;  3NV0 A;  1PU4 A;  4STD A;  1LOW A;  1JB4 A;  1I2F A;  2QIY A;  4QWT A;  1WMP A;  3PXM A;  4N6U A;  4OK0 A;  4H3U A;  3GZB A;  1JKG B;  1DMM A;  2KF4 A;  1CYU A;  3WDG B;  1MWT A;  4FCZ A;  3CCE 3;  3SXX A;  3ZG5 A;  1BRN L;  1YHQ 3;  1UW1 A;  1NDO B;  1NB5 I;  3FF0 A;  1C7H A;  2P0M A;  1VQL 3;  4IPB A;  2BT3 A;  3ROB A;  2BO9 B;  3X40 A;  2MF7 A;  1YI2 3;  3S67 A;  5ELU A;  1BNJ A;  3UL6 A;  1X1U A;  1RRL A;  2FGT A;  1DE3 A;  3D79 A;  2RNT A;  1UCK A;  3CCV 3;  1QVG 2;  3G6E 3;  2PNC A;  3LT8 A;  2OCT A;  1VQO 3;  1J2B A;  3FG1 A;  3L0R A;  1RN1 A;  2XR8 B;  3K0Z A;  5IER A;  1OF5 A;  2F98 A;  1U8C B;  3X42 A;  4EXR A;  3IMA B;  3BNB A;  3LTD A;  3CME 3;  1DVC A;  1YGW A;  2BIR A;  3GWR A;  4FMC A;  1B20 A;  3EN8 A;  4HBR A;  1VQ9 3;  4LMI A;  5AEW B;  9RNT A;  1DVD A;  1O7N B;  1YJ9 3;  2BMQ B;  4J9A A;  3SLU A;  1SAR A;  1IT7 A;  4I5Q A;  3UL5 A;  2AAD A;  4LSO A;  3CCU 3;  4XM4 A;  1RN7 A;  3EHC A;  4JRF A;  1JZO A;  2C4B A;  2XFT A;  4RNT A;  3SVA A;  1YIT 3;  2WOF A;  2F4Y A;  2GBX B;  4MJD A;  1JB2 A;  1GOV A;  1N9J A;  2STD A;  1GOU A;  5IG0 A;  5KP1 A;  1BUQ A;  1Q82 4;  2I9W A;  5JBS A;  3WMD A;  1PFP A;  5ELJ A;  4IIA A;  4BTX A;  3PCS A;  4U13 A;  1NO3 A;  3WOD G;  3NBB A;  4KZ1 A;  3NV0 B;  3WHO A;  1GD3 A;  1RJO A;  1RGE A;  1Q7H A;  2CW9 A;  2OOV C;  1YVB I;  1EQK A;  1R4Y A;  3FG3 A;  1HYF A;  3FLJ A;  1DMN A;  3HX8 A;  3N54 B;  4HM7 B;  5A0O B;  1OUN A;  1RTU A;  1S5A A;  1N8Q A;  1SII A; 
#chains in the Genus database with same CATH homology
 4R1K A;  2XSH B;  1OF5 B;  3U97 A;  1UUV B;  3CCR 3;  1IK3 A;  2CWT A;  2XF3 A;  1W6C A;  2Z76 A;  3KSP A;  5AEU B;  4KVH A;  4K90 B;  3GZX B;  4O2H A;  4EBG A;  2W03 A;  1W6Y A;  2O9U X;  4HM2 B;  3QRD A;  3I55 3;  1Q42 A;  3DY5 A;  3FZW A;  4AKY A;  3T0U A;  1QMA A;  1JB5 A;  1T5Y A;  2IUK A;  3EN1 B;  1IVU A;  3B8L A;  3D9R A;  1AR0 A;  1W4N A;  2JDI H;  2RSX A;  2ZDJ A;  4PEJ A;  1CEW I;  1Q40 B;  5IF6 A;  2Y73 A;  5EVH A;  3CXC 2;  1SJW A;  1LNH A;  2R4I A;  3VGN A;  3Q1C A;  4K1U A;  1S72 3;  2BNG A;  2CFG A;  3SOY A;  1D6Z A;  2CFK A;  2B24 B;  4HKV B;  3KE7 A;  4WHA A;  4EC6 A;  3J7Y d;  1VQM 3;  2W9Q A;  2K0M A;  3MYT A;  1M1K 4;  1TU5 A;  2W56 A;  3BNC A;  3KKG A;  3LYG A;  1ROV A;  3DXO A;  4BTW A;  3IPT A;  2GU1 A;  2V1L A;  1RKY A;  1JV2 B;  4EV2 A;  2K54 A;  4FR9 A;  4X2H A;  3SED A;  3F14 A;  3G0K A;  4TX4 A;  1A2K A;  1W02 A;  1OPY A;  4RNZ A;  3GAX A;  3NM7 A;  2RCD A;  3NQY A;  4GB5 A;  3BB9 A;  1QAL A;  5EQL A;  4AKZ A;  5CF2 A;  4N3V A;  4RZM A;  3WA2 X;  3HII A;  4CCV A;  3KFQ C;  3DZL A;  5LC6 A;  3T8U A;  2ML6 A;  1IVX A;  2CFW A;  4I4K A;  2HMK B;  2KCD A;  1IQX A;  5IEO A;  2E2U A;  7STD A;  3V92 A;  2BHM A;  3DGM A;  1NB3 I;  4K1V A;  1K28 A;  2E2V A;  2W2C A;  2P09 A;  1W5Z A;  4OUQ A;  1NJI 4;  2Q07 A;  5IG5 A;  4N6M A;  3OX9 A;  1QAK A;  3N9H A;  3N8B A;  2W9P A;  4EYC A;  4EV5 A;  4R9L A;  2M7O A;  1IVV A;  1TUH A;  1SPU A;  1KQS 2;  1OCV A;  1K73 4;  1ZX2 A;  1KSI A;  1OHS A;  2YFJ B;  3G8Z A;  3T8N A;  3M8C A;  4RBN A;  4XBT A;  2RFR A;  4WYK B;  3NXJ A;  2CK3 H;  3NBJ A;  2IMJ A;  1G96 A;  5BVB A;  1V74 A;  3GRD A;  5CLK A;  1N9E A;  4XB5 A;  2JQ5 A;  3EX9 A;  3Q90 A;  1NWW A;  1TFO A;  5IG4 A;  5DRV A;  3RGA A;  4WWU C;  5STD A;  1STD A;  3B4P A;  5JPU A;  3NM2 A;  1W01 A;  3K9M C;  1F8N A;  3E99 A;  3NX0 A;  1JRQ A;  1Y4K A;  1UI7 A;  2QA4 3;  5CF1 A;  3LTC A;  5CK6 A;  2IUJ A;  3F8H A;  3CCJ 3;  3CPO A;  5EEO A;  1W2Z A;  1FGT A;  4MMY B;  2HMO B;  3KSE D;  1LXE A;  2D42 A;  2B1X B;  1IVW A;  4H61 A;  5I97 A;  2BMR B;  2FXT A;  4LEH A;  2XSO B;  3WOF B;  1E97 A;  4ZM8 A;  2OQE C;  4XBY A;  4O8S A;  1YIJ 3;  3B7C A;  1OGX A;  2GXF A;  2OTJ 3;  3EBT A;  3OXA A;  5FGO A;  4KFD A;  3MG2 A;  1ASK A;  1CQS A;  1TIJ A;  3LXU X;  4FCM A;  3DUK A;  1GY5 A;  4N6L A;  3EC9 A;  3ER7 A;  3OV4 A;  1IT8 A;  4XDV A;  4HM4 B;  4O02 B;  5AIG A;  1IU7 A;  1TP6 A;  2C10 A;  1O7W B;  5HGR A;  1A90 A;  5D81 A;  1YGE A;  2WOH A;  4NRE A;  3QK9 A;  1ISK A;  3FCS B;  2A15 A;  2O3O A;  3LT9 A;  4MMX B;  2L4V A;  1WNH A;  2UX0 A;  2W04 A;  1VQ5 3;  2OQE A;  3CC4 3;  2CG0 A;  1VQ6 3;  2C11 A;  1VQP 3;  4KFE A;  3AMO B;  2LQV A;  1GD4 A;  1HU9 A;  4N6V 0;  4CDL A;  3GZR A;  4XBX A;  4WYK A;  3CMA 3;  2F99 A;  5IEN A;  2CWV A;  4HVN A;  3F8X A;  3BLZ A;  4HM3 B;  4R9K A;  3K63 A;  1AVL A;  5D83 A;  1WMN A;  4XDW A;  1SIH A;  3CNM A;  3EF8 A;  5AYR B;  1W2B 2;  2HMJ B;  2LYX A;  3EB8 A;  4FMA A;  2GEY A;  2PZV A;  3LOY A;  3FSD A;  1YJW 3;  4HM5 B;  4HZB B;  1TFK A;  2CHC A;  1NU3 A;  3NHX A;  3U1W A;  5IEP A;  3MKI A;  2RGQ A;  3F40 A;  1Q86 4;  1IV9 A;  2CIU A;  1JN5 A;  1N8R 4;  3KN4 A;  4HM0 B;  2CFD A;  1FGO A;  1O7G B;  3WOE B;  4LGQ A;  2OTL 3;  2CKF B;  2Z6B A;  2BMO B;  1VQN 3;  4N6O B;  3ECF A;  1K8A 4;  1M90 4;  4Q53 A;  1JKG A;  4HZ9 B;  3CCL 3;  1O7M B;  3EQQ B;  4HYZ A;  3HK4 A;  5BXQ A;  1D6U A;  3LZA A;  3I0Y A;  3CCQ 3;  2SBL A;  3O8Y A;  2CWU A;  2CFL A;  1R4C A;  1GYB A;  1AVK A;  2W6J H;  5KP4 A;  3JUQ A;  1IV7 A;  1JN5 B;  1E3R A;  3FG4 A;  4AEQ A;  2WGO A;  1MOL A;  3NUV A;  1N5H A;  1HKX A;  2WGQ A;  3S28 A;  3KZT A;  4MEI A;  1FA3 A;  2HMN B;  3H3H A;  4MMZ B;  2WO0 A;  2P38 A;  3CU3 A;  4WFO A;  3STD A;  2GBW B;  3PCR A;  1O7P B;  1U5O A;  2YFI B;  4K61 A;  1MNL A;  4L8O A;  4N6T A;  1GY7 A;  5JPP A;  1Q81 4;  1VQ4 3;  3CNX A;  5KP3 A;  1OGZ A;  1DYU A;  2XEP A;  3V98 A;  4L7K A;  3F7X A;  3FH1 A;  3BNE A;  2OWP A;  3SOA A;  1GS3 A;  2Z77 A;  3DGO A;  3KII A;  1YJ9 3;  1IQ8 A;  4ORL A;  1OHO A;  1K9M 4;  5D82 A;  2GU3 A;  1A67 A;  3G71 3;  1M9G A;  4BTY A;  3I56 3;  3G4S 3;  2YFL B;  2ZL8 A;  1WTH A;  4OVM A;  3HZP A;  2Z7A A;  5LC7 A;  2F86 B;  3NQZ A;  3VF1 A;  1E3V A;  3JUO A;  1KC8 4;  1IDP A;  1W7C A;  5DRE A;  8CHO A;  3OWY A;  1GY6 A;  1STF I;  3K7C A;  4JF8 A;  1VQ8 3;  3FF2 A;  1EKM A;  3PZW A;  4IT7 A;  1KD1 4;  4HM1 B;  4GL6 A;  5AIH A;  3WA3 A;  3ALA A;  4FMD A;  1W6G A;  2IA7 A;  3CC7 3;  1ULI B;  1AV4 A;  1OH0 A;  3S5C A;  1ULJ B;  3CC2 3;  4NHF A;  3NBR A;  3V99 A;  1IQY A;  3RDE A;  1UUW B;  3D3L A;  4J8T A;  2KXG A;  4KFF A;  3X41 A;  3EBY A;  2ML5 A;  1K41 A;  2CH9 A;  4WP5 A;  5TGN A;  3UNL A;  2E2T A;  2Y74 A;  2OOV A;  5IG3 A;  3X3Z A;  4HJL B;  1EA2 A;  3HIG A;  3IJE B;  2XFS A;  4HM8 B;  3LH4 A;  3PS8 A;  1DMQ A;  2FNQ A;  3MWZ A;  3G16 A;  3DGL A;  3JUP A;  4X2O A;  4G1M B;  2XRX B;  3RGR A;  3PYJ A;  4HM6 B;  1ROA A;  3TDG A;  5AII A;  3DGN A;  3MG3 A;  3A76 A;  3Q2P A;  1LVN A;  1N5P A;  1YJN 3;  3LTA A;  3FKA A;  1A2V A;  3DMC A;  5IW9 A;  3X3X A;  3B4O A;  3LTB A;  1FUW A;  1QVF 2;  1M1X B;  3UB1 A;  3UJM A;  2HML B;  4R4K A;  1VQK 3;  2D1W A;  5AI1 A;  3GZY B;  1L5G B;  3X3Y A;  6STD A;  5CXO A;  2XH9 A;  2XGN A;  3CCS 3;  2CG1 A;  3HI7 A;  1UI8 A;  1Z1S A;  2HMM B;  4LZI A;  1WQL B;  3AMO A;  3MPH A;  3VSY A;  2CC3 A;  1SQW A;  1W00 A;  5G2G A;  3EE1 A;  2KRT A;  3MHE A;  4FCJ A;  2QEX 3;  1OHP A;  4RNY A;  3MSO A;  4FMB A;  3CCM 3;  3PGB A;  5FW5 A;  1O7H B;  3OWS A;  3FGY A;  3F9S A;  1LOX A;  5AIF A;  1EG9 B;  1FGQ A;  1VQ7 3;  2P0X A;  3JUM A;  1VZZ A;  3MG1 A;  3OWU A;  2GEX A;  1OAC A;  4O3V A;  3JVC A;  4L8P A;  1US1 A;  2INX A;  2QGU A;  1D6Y A;  2P05 A;  3CPW 2;  3LML A;  3CD6 3;  1Q40 A;  1WMO A;  1QAF A;  1ZO2 A;  4N6N B;  1JJ2 2;  1Q7Y 4;  1QJG A;  3DM8 A;  2W0Q A;  2XGL A;  3S29 A;  3S27 A;  1KWI A;  3K5T A;  5AYS C;  4R80 A;  1CYV A;  1FGR A;  3SX1 A;  1FGM A;  1JNQ A;  3BND A;  3EJV A;  1RRH A;  2MC8 A;  3OW2 2;  2YX9 A;  3JUN A;  3H51 A;  3F7S A;  2W56 B;  3NV0 A;  1PU4 A;  4STD A;  1JB4 A;  2QIY A;  4QWT A;  1WMP A;  3PXM A;  4N6U A;  4OK0 A;  4H3U A;  3GZB A;  1JKG B;  1DMM A;  1CYU A;  3WDG B;  4FCZ A;  3CCE 3;  3SXX A;  1YHQ 3;  1UW1 A;  1NDO B;  1NB5 I;  3FF0 A;  1C7H A;  2P0M A;  1VQL 3;  4IPB A;  2BT3 A;  3ROB A;  2BO9 B;  3X40 A;  2MF7 A;  1YI2 3;  3S67 A;  5ELU A;  3UL6 A;  1RRL A;  2FGT A;  3CCV 3;  1QVG 2;  3G6E 3;  2PNC A;  3LT8 A;  2OCT A;  1VQO 3;  1J2B A;  3FG1 A;  3L0R A;  2XR8 B;  3K0Z A;  5IER A;  1OF5 A;  2F98 A;  1U8C B;  3X42 A;  4EXR A;  3IMA B;  3BNB A;  3LTD A;  3CME 3;  1DVC A;  3GWR A;  4FMC A;  1DVD A;  3EN8 A;  4HBR A;  1VQ9 3;  4LMI A;  5AEW B;  1O7N B;  2BMQ B;  4J9A A;  3SLU A;  1IT7 A;  3UL5 A;  4LSO A;  3CCU 3;  4XM4 A;  1RN7 A;  3EHC A;  4JRF A;  2XFT A;  3SVA A;  1YIT 3;  2WOF A;  4MJD A;  2GBX B;  1JB2 A;  1N9J A;  2STD A;  1BUQ A;  5IG0 A;  5KP1 A;  1Q82 4;  2I9W A;  5JBS A;  3WMD A;  1PFP A;  5ELJ A;  4IIA A;  4BTX A;  3PCS A;  4U13 A;  1NO3 A;  3WOD G;  3NBB A;  4KZ1 A;  3NV0 B;  1GD3 A;  1RJO A;  2CW9 A;  2OOV C;  1YVB I;  1EQK A;  3HX8 A;  3FG3 A;  3FLJ A;  1DMN A;  3N54 B;  4HM7 B;  5A0O B;  1OUN A;  1S5A A;  1N8Q A;  1SII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...