3QRDA

Crystal structure of l68v mutant of human cystatin c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
b'VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 18
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3qrdA00
5EQLA 1MOLA 1FA3A 3NX0A 5A0OB 2KXGA 1R4CA 1IV9A 1N9JA 1G96A 1DVDA 2W9QA 2OCTA 1ROAA 2W9PA 1NB5I 4TX4A 1WNHA 4EYCA 1TIJA 1M9GA 4N6V0 4ZM8A 1A90A 3UL6A 1STFI 3GAXA 3IMAB 1N5PA 1PFPA 4N6LA 3PS8A 2BO9B 1DVCA 1CYVA 1LXEA 3UL5A 4N6OB 1RN7A 5ELUA 1EQKA 5LC6A 1FUWA 4CCVA 5ELJA 3Q2PA 4N6NB 1CYUA 1KWIA 1CEWI 1N5HA 1GD4A 1NB3I 2CH9A 3PYJA 3PXMA 3QRDA 3KSED 1IV7A 1YVBI 3L0RA 3MWZA 3LH4A 3KFQC 4IT7A 1GD3A 4N6UA 2O9UX 3K9MC 3S67A 3SVAA 1A67A 4LZIA 4N6MA 5LC7A 1MNLA 4N6TA
chains in the Genus database with same CATH superfamily
5JBSA 3F7SA 1BNGA 1UUGB 5A0OB 5AIIA 1NU3A 2W03A 2A15A 1X1YA 3BU4A 3EC9A 1N9JA 3I0YA 4KFEA 3KKGA 1JKGB 1ZS7A 1BUQA 3K7CA 2Z76A 3K63A 2CG0A 1C54A 3KIIA 2W9QA 2Y74A 4XBTA 1SARA 2F99A 5RNTA 3JUPA 2XFSA 1FGTA 1NB5I 5JPUA 2K3DA 5G1KA 2IUKA 5IEPA 1OHPA 2WO0A 3CCR3 1WNHA 2RNTA 2XF3A 3G713 4HZBB 1BSBA 5G1LA 2YFIB 3FG3A 3PCSA 3NV0B 4WFOA 1RHLA 2M7OA 1AVLA 4N6V0 1YIJ3 1YJ93 1TTOA 4ZM8A 3EN1B 1UUWB 3DY5A 3Q1CA 1AVKA 1DETA 5KP4A 1U8CB 3VGNA 1STFI 3LTCA 1BSDA 2UX0A 1N8R4 1NO3A 3DGMA 3X40A 4N6LA 2IUJA 2SBLA 5HOHA 2WGOA 1O7GB 1GYBA 1M904 3MPHA 3HI7A 2BO9B 1YI23 1QVF2 3X3YA 3IPTA 3F14A 2XFTA 3EJVA 1KSIA 6STDA 1RN1A 4MJDA 4WWUC 3MHEA 5CXOA 3UL5A 3CCQ3 2H0IA 1UI7A 1RCLA 3S27A 3WOEB 1IVVA 1RDSA 3LTDA 1GMQA 1HZ1A 4R9LA 4HBRA 4IIAA 1QAKA 3F8XA 3NM7A 1BUJA 1EKMA 1FUWA 4STDA 1RN4A 1MWUA 2YFLB 3KN4A 3QK9A 2E2UA 1C7HA 7RNTA 3VSYA 3Q2PA 2B24B 1JZOA 4BU4A 1IVWA 1MWRA 1BSAA 4NPBA 2H0GA 1L5GB 5IG5A 4N6NB 1KWIA 1UGHI 1N5HA 3S28A 3NBJA 4WYKB 1I8VA 4WP5A 1RGKA 1AR0A 2JQ5A 3O8YA 1FGMA 2HMMB 1JRQA 1STDA 1JN5A 2CX1A 2IY2A 1N8QA 3MG2A 3CC43 4J9AA 1LOVA 3F7XA 2BIRA 5JPPA 1D6YA 1YVBI 3S29A 1VQN3 1BNRA 2CX0A 2QGUA 3EBYA 5M18A 3JUQA 4HAAA 4JF8A 4X2OA 1NJI4 3MWZA 5AIHA 1RJOA 3J7Yd 3EE1A 2Q07A 1IT7A 3AMOB 5BIRA 1GD3A 4GSPA 3U97A 3D9RA 4FR9A 1JBSA 1Q40B 1Q864 3AGNA 5FW5A 1W2B2 2H0HA 1BGSA 2XGLA 1OACA 3HK4A 3MG1A 3S67A 1K9M4 1PU4A 4K90B 4EC6A 1A2KA 4MMZB 8CHOA 4OUQA 2XR8B 1BSCA 1W2ZA 3NHXA 4FCZA 1Q7Y4 1A67A 1A2VA 1T5YA 4IPBA 1VQ43 3G6E3 1FGQA 1G02A 3FF0A 1TFKA 4U13A 5LC7A 2W2CA 3I563 5D81A 3CCL3 1Q9EA 1BAOA 1GOUA 2F86B 1SIIA 3CC23 3SX1A 2W56B 4N6TA 1OH0A 3AGOA 4KVHA 1MOLA 3DZLA 5DRVA 1FA3A 4XBYA 3DUKA 4RBNA 1BRIA 1UCLA 2YX9A 3SLUA 1B21A 4Q53A 1I2FA 2UUGC 1S5AA 2GSPA 2AADA 3FGYA 5DREA 3PZWA 1RGEA 4KT3B 1IT8A 1ROAA 4HM3B 4HVNA 2W9PA 4FMCA 1IU7A 3LZAA 3CNMA 3DGNA 3WODG 4BL3A 4XBXA 3G8ZA 1YJW3 1KC84 1I0VA 3DGYA 4R80A 7STDA 4GL6A 1T2IA 1ZO2A 3MG3A 3HIGA 3S5CA 3HX8A 3NQZA 2F5WA 1BRSA 4FMAA 4R4KA 1DE3A 2RFRA 1HKXA 4RNTA 4J5GA 4HM4B 1EUIC 2XH9A 5AYSC 4DKIA 2KF6A 3HZPA 1YIT3 2Z6BA 4N3VA 2GBXB 4H61A 1RTUA 2CKFB 3UL6A 3H51A 2FXTA 2I9WA 2ZHXB 1VQM3 1N5PA 3GSPA 1PFPA 3FLJA 1TUHA 1FUTA 1M1XB 2BU4A 4HM8B 4LEHA 3PS8A 1CH0A 3NUVA 4H3UA 3TDGA 3G4S3 2P05A 1EA2A 3EB8A 2KF4A 1M1K4 1ULJB 2D1WA 4QWTA 3CC73 3T8NA 1BRGA 1IDPA 5IENA 5CLKA 1QALA 1QJGA 2ML6A 4GB5A 3X42A 1FZUA 3STDA 4HM6B 1RSNA 2HMKB 1K8A4 1LOXA 1OHOA 3OWUA 1PYLA 3FH1A 1ULIB 5BU4A 1I70A 1O7PB 1VQ93 2SARA 4KFDA 1JB2A 3FSDA 5KP3A 3CD63 3RGAA 2STDA 1Q7HA 2V1LA 2QA43 1UI8A 2L1SA 2XEPA 1MWTA 1ZX2A 4MMYB 1QMAA 2XGNA 1V57A 1GSPA 2CH9A 3H3HA 2MF7A 2CWTA 4K1UA 3PYJA 4GHOA 3OV4A 2CWVA 1I3FA 4ILFA 5CF2A 2QEX3 3PCRA 2CC3A 1AY7A 4O8SA 3DM8A 3CU3A 3LOYA 1DYUA 1IV7A 2KF3A 1V58A 7GSPA 1VZZA 4HM1B 5BVBA 3CPOA 1E97A 3MSOA 1OPYA 3G16A 1N9EA 1UUVB 3D4AA 3X41A 1QVG2 3WOFB 3GWRA 1OGZA 1YGEA 1KQS2 1JN5B 1GOYA 4N6UA 5IG4A 2XSHB 4AKZA 1YVSA 4FMBA 3NBBA 3V98A 4BL2A 4HM7B 4CDLA 3EHCA 2P0MA 3K0ZA 3OX9A 1BOXA 1D6ZA 2BMOB 4JRFA 1IQYA 2LQVA 3EF8A 3DGOA 1EG9B 1VQ63 2K0MA 2L4VA 3WA3A 2GEXA 1VQK3 3T0UA 6RNTA 1TU5A 1BRKA 2ZA4A 3A5EA 4LZIA 3F8HA 4HOHA 2CFWA 1MNLA 5AEWB 5BXQA 1D6UA 2B1XB 5IG0A 1GS3A 2P09A 3D5GA 1Y4KA 2CFDA 3LYGA 1I2EA 2KCDA 1KD14 1UW1A 4FMDA 5EVHA 2BNGA 5EQLA 1UCKA 1JJ22 1DMNA 3M8CA 1MGRA 1FW7A 4AKYA 2OWPA 1QAFA 1BNFA 1YNVX 3BNEA 5I97A 3GZBA 2JDIH 4G1MB 5AIGA 4O3VA 3NM2A 1DVDA 3CCS3 3NXJA 2OCTA 1BANA 1K28A 1NNVA 5KP1A 4XDVA 4ORLA 3BNCA 1T2HA 2O3OA 1RMSA 3JUOA 3Q3FA 4OK0A 3X3ZA 1X1XA 2RBIA 1UDII 1VQP3 1BNSA 5IERA 4FCJA 1VQO3 4R1KA 1B2UA 2FNQA 4HZ9B 3B4PA 4LSOA 4LMIA 4WYKA 3BLZA 3HIIA 1MGWA 3LT8A 1B20A 3DH2A 1BIRA 2D42A 1JB5A 3FG1A 3ZG0A 1K734 1JV2B 4XM4A 2HMNB 1YHQ3 2FGTA 2GXFA 4L7KA 3DGLA 3ROBA 1TP6A 2W0QA 1TFOA 3IMAB 3GAXA 2F98A 1OGXA 4BTWA 5FGOA 1OF5B 2CFKA 1BU4A 1X1WA 2Z7AA 3N54B 4EXRA 5AEUB 1PY3A 2Y73A 1YJN3 3ER7A 1Z1SA 1B2XA 3AMOA 2XSOB 3V99A 2BHMA 1OHSA 1DVCA 1CYVA 2F4YA 2IA7A 2WOHA 2C10A 4WHAA 4FCMA 1MWSA 4I5QA 1GY6A 4O2HA 1GY5A 1U5OA 1UCJA 1W6GA 2F5MA 3CMA3 1BVIA 3A76A 1RN7A 2YFJB 2CFGA 1B2MA 5LC6A 5CK6A 1Q814 1RRLA 1LOWA 3BNDA 1W02A 3LTAA 3RNTA 1WQLB 4HM2B 1J2BA 4HKVB 3F9SA 3B7CA 3SOYA 3SXXA 3GZXB 5IG3A 1B2ZA 1NWWA 1W4NA 4HM0B 2R4IA 4EBGA 2KAAA 3U1WA 2W56A 1LOYA 1GD4A 1I0XA 1WTHA 2GU3A 3AHSA 4O02B 4BTYA 3KZTA 1EEJA 4KZ1A 4RZMA 1IQ8A 3CME3 3FF2A 4KFFA 1T3BA 1VQQA 4NHFA 4L8OA 2RCDA 2GBWB 5EEOA 5M19A 5D82A 1OUNA 3VF1A 2LYXA 3G0KA 1O7HB 2HMLB 1CQSA 3UB1A 3LTBA 3EBTA 3EX9A 2PNCA 5AI1A 3NQYA 3CCM3 1IVXA 3LH4A 3KCHA 3EN8A 1SQWA 3KFQC 3CCJ3 2IMJA 3WR2A 2RGQA 3JVCA 3MKIA 1SPUA 3GZYB 3NBRA 3OWSA 5M1AA 3BNBA 3SVAA 2OOVC 1IVUA 1SIHA 2INXA 1IQXA 3CCV3 1LQMB 1FUSA 1LRAA 1Q42A 1UGIA 1BRNL 1HYFA 1JB4A 1WMOA 3HOHA 3N8BA 4LGQA 1O7NB 4N6MA 3SOAA 1G0TA 1JKGA 1B27A 1RNTA 4R9KA 1JBRA 1E3VA 1O7WB 3OXAA 2WOFA 1RGGA 4XB5A 1RGAA 2K54A 4EW5A 2XRXB 1FYSA 1TRQA 1WMNA 5AIFA 1BNJA 1LVNA 1DMMA 3NX0A 2E2VA 2CWUA 3CPW2 4J8TA 2KXGA 1R4CA 1BNEA 1IV9A 1BRJA 1O7MB 1ASKA 2AAEA 2UGIA 4J5KA 3CCU3 1S723 6GSPA 1G96A 4EV2A 3X3XA 3Q90A 2CHCA 4HJLB 3NV0A 3RGRA 2CIUA 3D79A 3FCSB 1LNIA 1ROVA 1V74A 1VQ53 4AEQA 4HYZA 4TX4A 3CCE3 1BRHA 3MYTA 5IF6A 1IK3A 5CF1A 3JUMA 1GMRA 1VQ83 5G2GA 1W6YA 4EYCA 1X1UA 3WA2X 1TIJA 4I4KA 2KF5A 2CG1A 1E3RA 2GU1A 3GZRA 4CPKA 3B4OA 1W5ZA 1M9GA 3CXC2 2BT3A 1OCVA 3LXUX 3SEDA 1A90A 1FGRA 1RGCA 1BNIA 5TGNA 4CJNA 1JZDA 2HOHA 3WHOA 3LMLA 2WGQA 4NREA 2ZDJA 2W6JH 3ALAA 1RLSA 1US1A 1SJWA 2P38A 2P0XA 3ZG5A 5HGRA 1VQ73 3IJEB 1RKYA 2CW9A 1B2SA 1DMQA 1LXEA 4X2HA 3OWYA 2ML5A 1JNQA 3B8LA 5STDA 3WDGB 3OW22 1Q824 4N6OB 1AV4A 3URPA 5ELUA 1EQKA 4CCVA 3GRDA 4MEIA 1NDOB 2E2TA 1LNHA 2OQEA 5IW9A 5ELJA 2Z77A 3AHWA 1A2PA 1WMPA 1VQL3 3EQQB 5GSPA 1TJDA 1YGWA 3ECFA 3K5TA 1AQZA 1RGFA 2MC8A 2R41A 3SYUA 2CK3H 3RDEA 1CYUA 2PZVA 1CEWI 2KRTA 2QIYA 2F56A 2J8XB 1NB3I 3BIRA 3I553 2HMOB 2IYJA 4BIRA 2C4BA 2HMJB 1I3IA 1RGLA 5IEOA 3N9HA 8RNTA 3PXMA 1TRPA 3LT9A 1I2GA 2OTJ3 1W01A 3QRDA 4L8PA 1ISKA 3KSED 1RCKA 1Q40A 4LYLB 4BTXA 4K1VA 2OTL3 1BSEA 1RNBA 1FGOA 1ZGXA 2BMRB 2OOVA 1GMPA 1B3SA 3L0RA 4PEJA 3DMCA 3D5IA 3V92A 1R4YA 5D83A 3F40A 3KSPA 1RRHA 4K61A 4HM5B 4IT7A 3WMDA 2W04A 3DXOA 3PGBA 2O9UX 3ZFZA 2C11A 1W7CA 3UNLA 3FG4A 3JUNA 3K9MC 2BMQB 1K41A 1HU9A 2ZL8A 3E99A 1GY7A 4EV5A 3BB9A 3D3LA 1RGHA 1IYYA 1F8NA 2GEYA 1W00A 2OQEC 3FZWA 5AYRB 3UJMA 3FKAA 1JBTA 4OVMA 9RNTA 3CNXA 3KE7A 1UCIA 2RSXA 1W6CA 1GOVA 1LQGC 4RNZA 4XDWA 1OF5A 3T8UA 4MMXB 4RNYA 2CFLA
chains in the Genus database with same CATH topology
5JBSA 3F7SA 5A0OB 5AIIA 1NU3A 2W03A 2A15A 3EC9A 4KFEA 1BUQA 1N9JA 3I0YA 3KKGA 1JKGB 3K7CA 2Z76A 3K63A 2CG0A 3KIIA 2W9QA 2Y74A 4XBTA 2F99A 3JUPA 2XFSA 1FGTA 1NB5I 5JPUA 2IUKA 5IEPA 1OHPA 2WO0A 3CCR3 1WNHA 2XF3A 3G713 4HZBB 2YFIB 3FG3A 3PCSA 3NV0B 4WFOA 2M7OA 1AVLA 4N6V0 1YIJ3 1YJ93 4ZM8A 3EN1B 1UUWB 3DY5A 3Q1CA 1AVKA 5KP4A 1U8CB 3VGNA 1STFI 3LTCA 2UX0A 1N8R4 1NO3A 3DGMA 3X40A 4N6LA 2IUJA 2SBLA 2WGOA 1O7GB 1GYBA 1M904 3MPHA 3HI7A 2BO9B 1YI23 1QVF2 3X3YA 3IPTA 3F14A 2XFTA 3EJVA 1KSIA 6STDA 4MJDA 4WWUC 5CXOA 3MHEA 3UL5A 3CCQ3 3S27A 1UI7A 3WOEB 1IVVA 3LTDA 4R9LA 4HBRA 4IIAA 1QAKA 3F8XA 3NM7A 1FUWA 1EKMA 4STDA 2YFLB 3KN4A 3QK9A 2E2UA 1C7HA 3VSYA 3Q2PA 2B24B 1IVWA 1L5GB 5IG5A 4N6NB 1KWIA 1N5HA 3S28A 3NBJA 4WYKB 4WP5A 1AR0A 2JQ5A 3O8YA 1FGMA 2HMMB 1JRQA 1STDA 1JN5A 1N8QA 3MG2A 3CC43 4J9AA 3F7XA 5JPPA 1D6YA 1YVBI 3S29A 1VQN3 3EBYA 2QGUA 3JUQA 4JF8A 4X2OA 1NJI4 3MWZA 5AIHA 1RJOA 3J7Yd 3EE1A 2Q07A 1IT7A 3AMOB 1GD3A 3U97A 3D9RA 4FR9A 1Q40B 1Q864 5FW5A 1W2B2 3HK4A 2XGLA 1K9M4 1OACA 3MG1A 3S67A 1PU4A 4K90B 4EC6A 1A2KA 4MMZB 8CHOA 4OUQA 2XR8B 3NHXA 1W2ZA 1A67A 4FCZA 1Q7Y4 1A2VA 1T5YA 4IPBA 1VQ43 3G6E3 1FGQA 3FF0A 1TFKA 4U13A 5LC7A 2W2CA 3I563 5D81A 3CCL3 3CC23 2F86B 1SIIA 3SX1A 2W56B 4N6TA 1OH0A 4KVHA 1MOLA 3DZLA 5DRVA 1FA3A 4XBYA 3DUKA 4RBNA 2YX9A 3SLUA 4Q53A 1S5AA 3FGYA 5DREA 3PZWA 1IT8A 1ROAA 4HM3B 4HVNA 2W9PA 4FMCA 1IU7A 3LZAA 3CNMA 3DGNA 3WODG 4XBXA 3G8ZA 1YJW3 1KC84 4R80A 7STDA 4GL6A 1ZO2A 3MG3A 3HIGA 3S5CA 3HX8A 3NQZA 4FMAA 4R4KA 2RFRA 1HKXA 4HM4B 5AYSC 2XH9A 3HZPA 1YIT3 2Z6BA 4N3VA 2GBXB 4H61A 2CKFB 3UL6A 3H51A 2FXTA 2I9WA 1VQM3 1N5PA 1PFPA 3FLJA 1TUHA 4HM8B 1M1XB 4LEHA 3PS8A 3NUVA 4H3UA 3TDGA 3G4S3 2P05A 1EA2A 3EB8A 1M1K4 1ULJB 2D1WA 4QWTA 3CC73 3T8NA 1IDPA 5IENA 5CLKA 1QALA 1QJGA 2ML6A 4GB5A 3X42A 3STDA 4HM6B 2HMKB 1K8A4 1LOXA 1OHOA 3OWUA 3FH1A 1ULIB 1VQ93 1O7PB 4KFDA 1JB2A 3FSDA 5KP3A 3CD63 3RGAA 2STDA 2V1LA 2QA43 1UI8A 2XEPA 1ZX2A 4MMYB 1QMAA 2XGNA 2CH9A 3H3HA 2MF7A 2CWTA 4K1UA 3PYJA 3OV4A 2CWVA 5CF2A 2QEX3 3PCRA 2CC3A 4O8SA 3DM8A 3CU3A 3LOYA 1DYUA 1IV7A 1VZZA 4HM1B 5BVBA 3CPOA 1E97A 3MSOA 1OPYA 3G16A 1N9EA 1UUVB 3X41A 1QVG2 3WOFB 3GWRA 1OGZA 1YGEA 1KQS2 1JN5B 4N6UA 5IG4A 2XSHB 4AKZA 4FMBA 3NBBA 3V98A 4HM7B 4CDLA 3EHCA 2P0MA 3K0ZA 3OX9A 2BMOB 1D6ZA 4JRFA 1IQYA 2LQVA 3EF8A 3DGOA 1EG9B 1VQ63 2K0MA 2L4VA 3WA3A 2GEXA 1VQK3 3T0UA 1TU5A 4LZIA 3F8HA 5AEWB 2CFWA 1MNLA 5BXQA 1D6UA 2B1XB 5IG0A 1GS3A 2P09A 2CFDA 1Y4KA 3LYGA 2KCDA 1KD14 1UW1A 4FMDA 5EVHA 2BNGA 5EQLA 1JJ22 1DMNA 3M8CA 4AKYA 2OWPA 1QAFA 3BNEA 5I97A 3GZBA 2JDIH 4G1MB 5AIGA 4O3VA 3NM2A 1DVDA 3CCS3 3NXJA 2OCTA 1K28A 5KP1A 4XDVA 4ORLA 3BNCA 2O3OA 3JUOA 3X3ZA 4OK0A 1VQP3 5IERA 4FCJA 1VQO3 4R1KA 2FNQA 4HZ9B 3B4PA 4LSOA 4LMIA 4WYKA 3BLZA 3HIIA 3LT8A 2D42A 1JB5A 3FG1A 1K734 1JV2B 4XM4A 2HMNB 1YHQ3 2FGTA 2GXFA 4L7KA 3DGLA 3ROBA 1TP6A 2W0QA 1TFOA 3IMAB 3GAXA 2F98A 1OGXA 4BTWA 5FGOA 1OF5B 2CFKA 2Z7AA 3N54B 4EXRA 5AEUB 2Y73A 1YJN3 3ER7A 1Z1SA 3AMOA 2XSOB 3V99A 2BHMA 1OHSA 1DVCA 1CYVA 2IA7A 2WOHA 2C10A 4WHAA 4FCMA 4O2HA 1GY6A 1GY5A 1U5OA 1W6GA 3CMA3 3A76A 1RN7A 2YFJB 2CFGA 5LC6A 5CK6A 1Q814 1RRLA 3BNDA 1W02A 3LTAA 1WQLB 4HM2B 1J2BA 4HKVB 3F9SA 3B7CA 3SOYA 3SXXA 3GZXB 5IG3A 1NWWA 1W4NA 4HM0B 2R4IA 4EBGA 3U1WA 2W56A 1GD4A 1WTHA 2GU3A 4O02B 4BTYA 3KZTA 4KZ1A 4RZMA 1IQ8A 3CME3 3FF2A 4KFFA 4NHFA 4L8OA 2RCDA 2GBWB 5EEOA 5D82A 1OUNA 3VF1A 2LYXA 3G0KA 1O7HB 2HMLB 1CQSA 3UB1A 3LTBA 3EBTA 3EX9A 2PNCA 5AI1A 3NQYA 3CCM3 1IVXA 3LH4A 3EN8A 1SQWA 3KFQC 3CCJ3 2IMJA 2RGQA 3JVCA 3MKIA 1SPUA 3GZYB 3NBRA 3OWSA 3BNBA 3SVAA 2OOVC 1IVUA 1SIHA 2INXA 1IQXA 3CCV3 1Q42A 1JB4A 1WMOA 3N8BA 4LGQA 1O7NB 4N6MA 3SOAA 1JKGA 4R9KA 1E3VA 1O7WB 3OXAA 2WOFA 4XB5A 2K54A 2XRXB 1WMNA 5AIFA 1LVNA 1DMMA 3NX0A 2E2VA 2CWUA 3CPW2 4J8TA 2KXGA 1R4CA 1IV9A 1O7MB 1ASKA 1S723 3CCU3 1G96A 4EV2A 3X3XA 3Q90A 2CHCA 4HJLB 3NV0A 3RGRA 2CIUA 3FCSB 1ROVA 1V74A 1VQ53 4AEQA 4HYZA 4TX4A 3CCE3 3MYTA 1IK3A 5IF6A 5CF1A 3JUMA 1VQ83 5G2GA 1W6YA 4EYCA 3WA2X 1TIJA 4I4KA 2CG1A 1E3RA 2GU1A 3GZRA 3B4OA 1W5ZA 1M9GA 3CXC2 2BT3A 1OCVA 3LXUX 3SEDA 1A90A 1FGRA 5TGNA 3LMLA 2WGQA 4NREA 2ZDJA 2W6JH 3ALAA 1US1A 1SJWA 2P38A 2P0XA 1VQ73 5HGRA 3IJEB 1RKYA 2CW9A 1LXEA 1DMQA 4X2HA 5STDA 3OWYA 2ML5A 1JNQA 3B8LA 3WDGB 3OW22 1Q824 4N6OB 1AV4A 5ELUA 1EQKA 4CCVA 3GRDA 4MEIA 1NDOB 2E2TA 1LNHA 2OQEA 5IW9A 5ELJA 2Z77A 1WMPA 1VQL3 3EQQB 3ECFA 3K5TA 2MC8A 2CK3H 3RDEA 1CYUA 2PZVA 1CEWI 2KRTA 2QIYA 1NB3I 3I553 2HMOB 2HMJB 5IEOA 3N9HA 3PXMA 3LT9A 2OTJ3 1W01A 3QRDA 4L8PA 1ISKA 3KSED 4BTXA 1Q40A 4K1VA 2OTL3 1FGOA 2BMRB 2OOVA 3L0RA 4PEJA 3DMCA 3V92A 5D83A 3F40A 3KSPA 1RRHA 4K61A 4HM5B 4IT7A 3WMDA 2W04A 3DXOA 3PGBA 2O9UX 2C11A 1W7CA 3UNLA 3FG4A 3JUNA 3K9MC 2ZL8A 2BMQB 1K41A 1HU9A 3E99A 1GY7A 4EV5A 3BB9A 3D3LA 1F8NA 2GEYA 1W00A 2OQEC 3FZWA 5AYRB 3UJMA 3FKAA 4OVMA 3CNXA 3KE7A 4XDWA 2RSXA 1W6CA 4RNZA 1OF5A 3T8UA 4MMXB 4RNYA 2CFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQL A;  1MOL A;  1FA3 A;  3NX0 A;  5A0O B;  2KXG A;  1R4C A;  1IV9 A;  1N9J A;  1G96 A;  1DVD A;  2W9Q A;  2OCT A;  1ROA A;  2W9P A;  1NB5 I;  4TX4 A;  1WNH A;  4EYC A;  1TIJ A;  1M9G A;  4N6V 0;  4ZM8 A;  1A90 A;  3UL6 A;  1STF I;  3GAX A;  3IMA B;  1N5P A;  1PFP A;  4N6L A;  3PS8 A;  2BO9 B;  1DVC A;  1CYV A;  1LXE A;  3UL5 A;  4N6O B;  1RN7 A;  5ELU A;  1EQK A;  5LC6 A;  1FUW A;  4CCV A;  5ELJ A;  3Q2P A;  4N6N B;  1CYU A;  1KWI A;  1CEW I;  1N5H A;  1GD4 A;  1NB3 I;  2CH9 A;  3PYJ A;  3PXM A;  3QRD A;  3KSE D;  1IV7 A;  1YVB I;  3L0R A;  3MWZ A;  3LH4 A;  3KFQ C;  4IT7 A;  1GD3 A;  4N6U A;  2O9U X;  3K9M C;  3S67 A;  3SVA A;  1A67 A;  4LZI A;  4N6M A;  5LC7 A;  1MNL A;  4N6T A; 
#chains in the Genus database with same CATH topology
 5JBS A;  3F7S A;  1BNG A;  1UUG B;  5A0O B;  5AII A;  1NU3 A;  2W03 A;  2A15 A;  1X1Y A;  3BU4 A;  3EC9 A;  1N9J A;  3I0Y A;  4KFE A;  3KKG A;  1JKG B;  1ZS7 A;  1BUQ A;  3K7C A;  2Z76 A;  3K63 A;  2CG0 A;  1C54 A;  3KII A;  2W9Q A;  2Y74 A;  4XBT A;  1SAR A;  2F99 A;  5RNT A;  3JUP A;  2XFS A;  1FGT A;  1NB5 I;  5JPU A;  2K3D A;  5G1K A;  2IUK A;  5IEP A;  1OHP A;  2WO0 A;  3CCR 3;  1WNH A;  2RNT A;  2XF3 A;  3G71 3;  4HZB B;  1BSB A;  5G1L A;  2YFI B;  3FG3 A;  3PCS A;  3NV0 B;  4WFO A;  1RHL A;  2M7O A;  1AVL A;  4N6V 0;  1YIJ 3;  1YJ9 3;  1TTO A;  4ZM8 A;  3EN1 B;  1UUW B;  3DY5 A;  3Q1C A;  1AVK A;  1DET A;  5KP4 A;  1U8C B;  3VGN A;  1STF I;  3LTC A;  1BSD A;  2UX0 A;  1N8R 4;  1NO3 A;  3DGM A;  3X40 A;  4N6L A;  2IUJ A;  2SBL A;  5HOH A;  2WGO A;  1O7G B;  1GYB A;  1M90 4;  3MPH A;  3HI7 A;  2BO9 B;  1YI2 3;  1QVF 2;  3X3Y A;  3IPT A;  3F14 A;  2XFT A;  3EJV A;  1KSI A;  6STD A;  1RN1 A;  4MJD A;  4WWU C;  3MHE A;  5CXO A;  3UL5 A;  3CCQ 3;  2H0I A;  1UI7 A;  1RCL A;  3S27 A;  3WOE B;  1IVV A;  1RDS A;  3LTD A;  1GMQ A;  1HZ1 A;  4R9L A;  4HBR A;  4IIA A;  1QAK A;  3F8X A;  3NM7 A;  1BUJ A;  1EKM A;  1FUW A;  4STD A;  1RN4 A;  1MWU A;  2YFL B;  3KN4 A;  3QK9 A;  2E2U A;  1C7H A;  7RNT A;  3VSY A;  3Q2P A;  2B24 B;  1JZO A;  4BU4 A;  1IVW A;  1MWR A;  1BSA A;  4NPB A;  2H0G A;  1L5G B;  5IG5 A;  4N6N B;  1KWI A;  1UGH I;  1N5H A;  3S28 A;  3NBJ A;  4WYK B;  1I8V A;  4WP5 A;  1RGK A;  1AR0 A;  2JQ5 A;  3O8Y A;  1FGM A;  2HMM B;  1JRQ A;  1STD A;  1JN5 A;  2CX1 A;  2IY2 A;  1N8Q A;  3MG2 A;  3CC4 3;  4J9A A;  1LOV A;  3F7X A;  2BIR A;  5JPP A;  1D6Y A;  1YVB I;  3S29 A;  1VQN 3;  1BNR A;  2CX0 A;  2QGU A;  3EBY A;  5M18 A;  3JUQ A;  4HAA A;  4JF8 A;  4X2O A;  1NJI 4;  3MWZ A;  5AIH A;  1RJO A;  3J7Y d;  3EE1 A;  2Q07 A;  1IT7 A;  3AMO B;  5BIR A;  1GD3 A;  4GSP A;  3U97 A;  3D9R A;  4FR9 A;  1JBS A;  1Q40 B;  1Q86 4;  3AGN A;  5FW5 A;  1W2B 2;  2H0H A;  1BGS A;  2XGL A;  1OAC A;  3HK4 A;  3MG1 A;  3S67 A;  1K9M 4;  1PU4 A;  4K90 B;  4EC6 A;  1A2K A;  4MMZ B;  8CHO A;  4OUQ A;  2XR8 B;  1BSC A;  1W2Z A;  3NHX A;  4FCZ A;  1Q7Y 4;  1A67 A;  1A2V A;  1T5Y A;  4IPB A;  1VQ4 3;  3G6E 3;  1FGQ A;  1G02 A;  3FF0 A;  1TFK A;  4U13 A;  5LC7 A;  2W2C A;  3I56 3;  5D81 A;  3CCL 3;  1Q9E A;  1BAO A;  1GOU A;  2F86 B;  1SII A;  3CC2 3;  3SX1 A;  2W56 B;  4N6T A;  1OH0 A;  3AGO A;  4KVH A;  1MOL A;  3DZL A;  5DRV A;  1FA3 A;  4XBY A;  3DUK A;  4RBN A;  1BRI A;  1UCL A;  2YX9 A;  3SLU A;  1B21 A;  4Q53 A;  1I2F A;  2UUG C;  1S5A A;  2GSP A;  2AAD A;  3FGY A;  5DRE A;  3PZW A;  1RGE A;  4KT3 B;  1IT8 A;  1ROA A;  4HM3 B;  4HVN A;  2W9P A;  4FMC A;  1IU7 A;  3LZA A;  3CNM A;  3DGN A;  3WOD G;  4BL3 A;  4XBX A;  3G8Z A;  1YJW 3;  1KC8 4;  1I0V A;  3DGY A;  4R80 A;  7STD A;  4GL6 A;  1T2I A;  1ZO2 A;  3MG3 A;  3HIG A;  3S5C A;  3HX8 A;  3NQZ A;  2F5W A;  1BRS A;  4FMA A;  4R4K A;  1DE3 A;  2RFR A;  1HKX A;  4RNT A;  4J5G A;  4HM4 B;  1EUI C;  2XH9 A;  5AYS C;  4DKI A;  2KF6 A;  3HZP A;  1YIT 3;  2Z6B A;  4N3V A;  2GBX B;  4H61 A;  1RTU A;  2CKF B;  3UL6 A;  3H51 A;  2FXT A;  2I9W A;  2ZHX B;  1VQM 3;  1N5P A;  3GSP A;  1PFP A;  3FLJ A;  1TUH A;  1FUT A;  1M1X B;  2BU4 A;  4HM8 B;  4LEH A;  3PS8 A;  1CH0 A;  3NUV A;  4H3U A;  3TDG A;  3G4S 3;  2P05 A;  1EA2 A;  3EB8 A;  2KF4 A;  1M1K 4;  1ULJ B;  2D1W A;  4QWT A;  3CC7 3;  3T8N A;  1BRG A;  1IDP A;  5IEN A;  5CLK A;  1QAL A;  1QJG A;  2ML6 A;  4GB5 A;  3X42 A;  1FZU A;  3STD A;  4HM6 B;  1RSN A;  2HMK B;  1K8A 4;  1LOX A;  1OHO A;  3OWU A;  1PYL A;  3FH1 A;  1ULI B;  5BU4 A;  1I70 A;  1O7P B;  1VQ9 3;  2SAR A;  4KFD A;  1JB2 A;  3FSD A;  5KP3 A;  3CD6 3;  3RGA A;  2STD A;  1Q7H A;  2V1L A;  2QA4 3;  1UI8 A;  2L1S A;  2XEP A;  1MWT A;  1ZX2 A;  4MMY B;  1QMA A;  2XGN A;  1V57 A;  1GSP A;  2CH9 A;  3H3H A;  2MF7 A;  2CWT A;  4K1U A;  3PYJ A;  4GHO A;  3OV4 A;  2CWV A;  1I3F A;  4ILF A;  5CF2 A;  2QEX 3;  3PCR A;  2CC3 A;  1AY7 A;  4O8S A;  3DM8 A;  3CU3 A;  3LOY A;  1DYU A;  1IV7 A;  2KF3 A;  1V58 A;  7GSP A;  1VZZ A;  4HM1 B;  5BVB A;  3CPO A;  1E97 A;  3MSO A;  1OPY A;  3G16 A;  1N9E A;  1UUV B;  3D4A A;  3X41 A;  1QVG 2;  3WOF B;  3GWR A;  1OGZ A;  1YGE A;  1KQS 2;  1JN5 B;  1GOY A;  4N6U A;  5IG4 A;  2XSH B;  4AKZ A;  1YVS A;  4FMB A;  3NBB A;  3V98 A;  4BL2 A;  4HM7 B;  4CDL A;  3EHC A;  2P0M A;  3K0Z A;  3OX9 A;  1BOX A;  1D6Z A;  2BMO B;  4JRF A;  1IQY A;  2LQV A;  3EF8 A;  3DGO A;  1EG9 B;  1VQ6 3;  2K0M A;  2L4V A;  3WA3 A;  2GEX A;  1VQK 3;  3T0U A;  6RNT A;  1TU5 A;  1BRK A;  2ZA4 A;  3A5E A;  4LZI A;  3F8H A;  4HOH A;  2CFW A;  1MNL A;  5AEW B;  5BXQ A;  1D6U A;  2B1X B;  5IG0 A;  1GS3 A;  2P09 A;  3D5G A;  1Y4K A;  2CFD A;  3LYG A;  1I2E A;  2KCD A;  1KD1 4;  1UW1 A;  4FMD A;  5EVH A;  2BNG A;  5EQL A;  1UCK A;  1JJ2 2;  1DMN A;  3M8C A;  1MGR A;  1FW7 A;  4AKY A;  2OWP A;  1QAF A;  1BNF A;  1YNV X;  3BNE A;  5I97 A;  3GZB A;  2JDI H;  4G1M B;  5AIG A;  4O3V A;  3NM2 A;  1DVD A;  3CCS 3;  3NXJ A;  2OCT A;  1BAN A;  1K28 A;  1NNV A;  5KP1 A;  4XDV A;  4ORL A;  3BNC A;  1T2H A;  2O3O A;  1RMS A;  3JUO A;  3Q3F A;  4OK0 A;  3X3Z A;  1X1X A;  2RBI A;  1UDI I;  1VQP 3;  1BNS A;  5IER A;  4FCJ A;  1VQO 3;  4R1K A;  1B2U A;  2FNQ A;  4HZ9 B;  3B4P A;  4LSO A;  4LMI A;  4WYK A;  3BLZ A;  3HII A;  1MGW A;  3LT8 A;  1B20 A;  3DH2 A;  1BIR A;  2D42 A;  1JB5 A;  3FG1 A;  3ZG0 A;  1K73 4;  1JV2 B;  4XM4 A;  2HMN B;  1YHQ 3;  2FGT A;  2GXF A;  4L7K A;  3DGL A;  3ROB A;  1TP6 A;  2W0Q A;  1TFO A;  3IMA B;  3GAX A;  2F98 A;  1OGX A;  4BTW A;  5FGO A;  1OF5 B;  2CFK A;  1BU4 A;  1X1W A;  2Z7A A;  3N54 B;  4EXR A;  5AEU B;  1PY3 A;  2Y73 A;  1YJN 3;  3ER7 A;  1Z1S A;  1B2X A;  3AMO A;  2XSO B;  3V99 A;  2BHM A;  1OHS A;  1DVC A;  1CYV A;  2F4Y A;  2IA7 A;  2WOH A;  2C10 A;  4WHA A;  4FCM A;  1MWS A;  4I5Q A;  1GY6 A;  4O2H A;  1GY5 A;  1U5O A;  1UCJ A;  1W6G A;  2F5M A;  3CMA 3;  1BVI A;  3A76 A;  1RN7 A;  2YFJ B;  2CFG A;  1B2M A;  5LC6 A;  5CK6 A;  1Q81 4;  1RRL A;  1LOW A;  3BND A;  1W02 A;  3LTA A;  3RNT A;  1WQL B;  4HM2 B;  1J2B A;  4HKV B;  3F9S A;  3B7C A;  3SOY A;  3SXX A;  3GZX B;  5IG3 A;  1B2Z A;  1NWW A;  1W4N A;  4HM0 B;  2R4I A;  4EBG A;  2KAA A;  3U1W A;  2W56 A;  1LOY A;  1GD4 A;  1I0X A;  1WTH A;  2GU3 A;  3AHS A;  4O02 B;  4BTY A;  3KZT A;  1EEJ A;  4KZ1 A;  4RZM A;  1IQ8 A;  3CME 3;  3FF2 A;  4KFF A;  1T3B A;  1VQQ A;  4NHF A;  4L8O A;  2RCD A;  2GBW B;  5EEO A;  5M19 A;  5D82 A;  1OUN A;  3VF1 A;  2LYX A;  3G0K A;  1O7H B;  2HML B;  1CQS A;  3UB1 A;  3LTB A;  3EBT A;  3EX9 A;  2PNC A;  5AI1 A;  3NQY A;  3CCM 3;  1IVX A;  3LH4 A;  3KCH A;  3EN8 A;  1SQW A;  3KFQ C;  3CCJ 3;  2IMJ A;  3WR2 A;  2RGQ A;  3JVC A;  3MKI A;  1SPU A;  3GZY B;  3NBR A;  3OWS A;  5M1A A;  3BNB A;  3SVA A;  2OOV C;  1IVU A;  1SIH A;  2INX A;  1IQX A;  3CCV 3;  1LQM B;  1FUS A;  1LRA A;  1Q42 A;  1UGI A;  1BRN L;  1HYF A;  1JB4 A;  1WMO A;  3HOH A;  3N8B A;  4LGQ A;  1O7N B;  4N6M A;  3SOA A;  1G0T A;  1JKG A;  1B27 A;  1RNT A;  4R9K A;  1JBR A;  1E3V A;  1O7W B;  3OXA A;  2WOF A;  1RGG A;  4XB5 A;  1RGA A;  2K54 A;  4EW5 A;  2XRX B;  1FYS A;  1TRQ A;  1WMN A;  5AIF A;  1BNJ A;  1LVN A;  1DMM A;  3NX0 A;  2E2V A;  2CWU A;  3CPW 2;  4J8T A;  2KXG A;  1R4C A;  1BNE A;  1IV9 A;  1BRJ A;  1O7M B;  1ASK A;  2AAE A;  2UGI A;  4J5K A;  3CCU 3;  1S72 3;  6GSP A;  1G96 A;  4EV2 A;  3X3X A;  3Q90 A;  2CHC A;  4HJL B;  3NV0 A;  3RGR A;  2CIU A;  3D79 A;  3FCS B;  1LNI A;  1ROV A;  1V74 A;  1VQ5 3;  4AEQ A;  4HYZ A;  4TX4 A;  3CCE 3;  1BRH A;  3MYT A;  5IF6 A;  1IK3 A;  5CF1 A;  3JUM A;  1GMR A;  1VQ8 3;  5G2G A;  1W6Y A;  4EYC A;  1X1U A;  3WA2 X;  1TIJ A;  4I4K A;  2KF5 A;  2CG1 A;  1E3R A;  2GU1 A;  3GZR A;  4CPK A;  3B4O A;  1W5Z A;  1M9G A;  3CXC 2;  2BT3 A;  1OCV A;  3LXU X;  3SED A;  1A90 A;  1FGR A;  1RGC A;  1BNI A;  5TGN A;  4CJN A;  1JZD A;  2HOH A;  3WHO A;  3LML A;  2WGQ A;  4NRE A;  2ZDJ A;  2W6J H;  3ALA A;  1RLS A;  1US1 A;  1SJW A;  2P38 A;  2P0X A;  3ZG5 A;  5HGR A;  1VQ7 3;  3IJE B;  1RKY A;  2CW9 A;  1B2S A;  1DMQ A;  1LXE A;  4X2H A;  3OWY A;  2ML5 A;  1JNQ A;  3B8L A;  5STD A;  3WDG B;  3OW2 2;  1Q82 4;  4N6O B;  1AV4 A;  3URP A;  5ELU A;  1EQK A;  4CCV A;  3GRD A;  4MEI A;  1NDO B;  2E2T A;  1LNH A;  2OQE A;  5IW9 A;  5ELJ A;  2Z77 A;  3AHW A;  1A2P A;  1WMP A;  1VQL 3;  3EQQ B;  5GSP A;  1TJD A;  1YGW A;  3ECF A;  3K5T A;  1AQZ A;  1RGF A;  2MC8 A;  2R41 A;  3SYU A;  2CK3 H;  3RDE A;  1CYU A;  2PZV A;  1CEW I;  2KRT A;  2QIY A;  2F56 A;  2J8X B;  1NB3 I;  3BIR A;  3I55 3;  2HMO B;  2IYJ A;  4BIR A;  2C4B A;  2HMJ B;  1I3I A;  1RGL A;  5IEO A;  3N9H A;  8RNT A;  3PXM A;  1TRP A;  3LT9 A;  1I2G A;  2OTJ 3;  1W01 A;  3QRD A;  4L8P A;  1ISK A;  3KSE D;  1RCK A;  1Q40 A;  4LYL B;  4BTX A;  4K1V A;  2OTL 3;  1BSE A;  1RNB A;  1FGO A;  1ZGX A;  2BMR B;  2OOV A;  1GMP A;  1B3S A;  3L0R A;  4PEJ A;  3DMC A;  3D5I A;  3V92 A;  1R4Y A;  5D83 A;  3F40 A;  3KSP A;  1RRH A;  4K61 A;  4HM5 B;  4IT7 A;  3WMD A;  2W04 A;  3DXO A;  3PGB A;  2O9U X;  3ZFZ A;  2C11 A;  1W7C A;  3UNL A;  3FG4 A;  3JUN A;  3K9M C;  2BMQ B;  1K41 A;  1HU9 A;  2ZL8 A;  3E99 A;  1GY7 A;  4EV5 A;  3BB9 A;  3D3L A;  1RGH A;  1IYY A;  1F8N A;  2GEY A;  1W00 A;  2OQE C;  3FZW A;  5AYR B;  3UJM A;  3FKA A;  1JBT A;  4OVM A;  9RNT A;  3CNX A;  3KE7 A;  1UCI A;  2RSX A;  1W6C A;  1GOV A;  1LQG C;  4RNZ A;  4XDW A;  1OF5 A;  3T8U A;  4MMX B;  4RNY A;  2CFL A; 
#chains in the Genus database with same CATH homology
 5JBS A;  3F7S A;  5A0O B;  5AII A;  1NU3 A;  2W03 A;  2A15 A;  3EC9 A;  4KFE A;  1BUQ A;  1N9J A;  3I0Y A;  3KKG A;  1JKG B;  3K7C A;  2Z76 A;  3K63 A;  2CG0 A;  3KII A;  2W9Q A;  2Y74 A;  4XBT A;  2F99 A;  3JUP A;  2XFS A;  1FGT A;  1NB5 I;  5JPU A;  2IUK A;  5IEP A;  1OHP A;  2WO0 A;  3CCR 3;  1WNH A;  2XF3 A;  3G71 3;  4HZB B;  2YFI B;  3FG3 A;  3PCS A;  3NV0 B;  4WFO A;  2M7O A;  1AVL A;  4N6V 0;  1YIJ 3;  1YJ9 3;  4ZM8 A;  3EN1 B;  1UUW B;  3DY5 A;  3Q1C A;  1AVK A;  5KP4 A;  1U8C B;  3VGN A;  1STF I;  3LTC A;  2UX0 A;  1N8R 4;  1NO3 A;  3DGM A;  3X40 A;  4N6L A;  2IUJ A;  2SBL A;  2WGO A;  1O7G B;  1GYB A;  1M90 4;  3MPH A;  3HI7 A;  2BO9 B;  1YI2 3;  1QVF 2;  3X3Y A;  3IPT A;  3F14 A;  2XFT A;  3EJV A;  1KSI A;  6STD A;  4MJD A;  4WWU C;  5CXO A;  3MHE A;  3UL5 A;  3CCQ 3;  3S27 A;  1UI7 A;  3WOE B;  1IVV A;  3LTD A;  4R9L A;  4HBR A;  4IIA A;  1QAK A;  3F8X A;  3NM7 A;  1FUW A;  1EKM A;  4STD A;  2YFL B;  3KN4 A;  3QK9 A;  2E2U A;  1C7H A;  3VSY A;  3Q2P A;  2B24 B;  1IVW A;  1L5G B;  5IG5 A;  4N6N B;  1KWI A;  1N5H A;  3S28 A;  3NBJ A;  4WYK B;  4WP5 A;  1AR0 A;  2JQ5 A;  3O8Y A;  1FGM A;  2HMM B;  1JRQ A;  1STD A;  1JN5 A;  1N8Q A;  3MG2 A;  3CC4 3;  4J9A A;  3F7X A;  5JPP A;  1D6Y A;  1YVB I;  3S29 A;  1VQN 3;  3EBY A;  2QGU A;  3JUQ A;  4JF8 A;  4X2O A;  1NJI 4;  3MWZ A;  5AIH A;  1RJO A;  3J7Y d;  3EE1 A;  2Q07 A;  1IT7 A;  3AMO B;  1GD3 A;  3U97 A;  3D9R A;  4FR9 A;  1Q40 B;  1Q86 4;  5FW5 A;  1W2B 2;  3HK4 A;  2XGL A;  1K9M 4;  1OAC A;  3MG1 A;  3S67 A;  1PU4 A;  4K90 B;  4EC6 A;  1A2K A;  4MMZ B;  8CHO A;  4OUQ A;  2XR8 B;  3NHX A;  1W2Z A;  1A67 A;  4FCZ A;  1Q7Y 4;  1A2V A;  1T5Y A;  4IPB A;  1VQ4 3;  3G6E 3;  1FGQ A;  3FF0 A;  1TFK A;  4U13 A;  5LC7 A;  2W2C A;  3I56 3;  5D81 A;  3CCL 3;  3CC2 3;  2F86 B;  1SII A;  3SX1 A;  2W56 B;  4N6T A;  1OH0 A;  4KVH A;  1MOL A;  3DZL A;  5DRV A;  1FA3 A;  4XBY A;  3DUK A;  4RBN A;  2YX9 A;  3SLU A;  4Q53 A;  1S5A A;  3FGY A;  5DRE A;  3PZW A;  1IT8 A;  1ROA A;  4HM3 B;  4HVN A;  2W9P A;  4FMC A;  1IU7 A;  3LZA A;  3CNM A;  3DGN A;  3WOD G;  4XBX A;  3G8Z A;  1YJW 3;  1KC8 4;  4R80 A;  7STD A;  4GL6 A;  1ZO2 A;  3MG3 A;  3HIG A;  3S5C A;  3HX8 A;  3NQZ A;  4FMA A;  4R4K A;  2RFR A;  1HKX A;  4HM4 B;  5AYS C;  2XH9 A;  3HZP A;  1YIT 3;  2Z6B A;  4N3V A;  2GBX B;  4H61 A;  2CKF B;  3UL6 A;  3H51 A;  2FXT A;  2I9W A;  1VQM 3;  1N5P A;  1PFP A;  3FLJ A;  1TUH A;  4HM8 B;  1M1X B;  4LEH A;  3PS8 A;  3NUV A;  4H3U A;  3TDG A;  3G4S 3;  2P05 A;  1EA2 A;  3EB8 A;  1M1K 4;  1ULJ B;  2D1W A;  4QWT A;  3CC7 3;  3T8N A;  1IDP A;  5IEN A;  5CLK A;  1QAL A;  1QJG A;  2ML6 A;  4GB5 A;  3X42 A;  3STD A;  4HM6 B;  2HMK B;  1K8A 4;  1LOX A;  1OHO A;  3OWU A;  3FH1 A;  1ULI B;  1VQ9 3;  1O7P B;  4KFD A;  1JB2 A;  3FSD A;  5KP3 A;  3CD6 3;  3RGA A;  2STD A;  2V1L A;  2QA4 3;  1UI8 A;  2XEP A;  1ZX2 A;  4MMY B;  1QMA A;  2XGN A;  2CH9 A;  3H3H A;  2MF7 A;  2CWT A;  4K1U A;  3PYJ A;  3OV4 A;  2CWV A;  5CF2 A;  2QEX 3;  3PCR A;  2CC3 A;  4O8S A;  3DM8 A;  3CU3 A;  3LOY A;  1DYU A;  1IV7 A;  1VZZ A;  4HM1 B;  5BVB A;  3CPO A;  1E97 A;  3MSO A;  1OPY A;  3G16 A;  1N9E A;  1UUV B;  3X41 A;  1QVG 2;  3WOF B;  3GWR A;  1OGZ A;  1YGE A;  1KQS 2;  1JN5 B;  4N6U A;  5IG4 A;  2XSH B;  4AKZ A;  4FMB A;  3NBB A;  3V98 A;  4HM7 B;  4CDL A;  3EHC A;  2P0M A;  3K0Z A;  3OX9 A;  2BMO B;  1D6Z A;  4JRF A;  1IQY A;  2LQV A;  3EF8 A;  3DGO A;  1EG9 B;  1VQ6 3;  2K0M A;  2L4V A;  3WA3 A;  2GEX A;  1VQK 3;  3T0U A;  1TU5 A;  4LZI A;  3F8H A;  5AEW B;  2CFW A;  1MNL A;  5BXQ A;  1D6U A;  2B1X B;  5IG0 A;  1GS3 A;  2P09 A;  2CFD A;  1Y4K A;  3LYG A;  2KCD A;  1KD1 4;  1UW1 A;  4FMD A;  5EVH A;  2BNG A;  5EQL A;  1JJ2 2;  1DMN A;  3M8C A;  4AKY A;  2OWP A;  1QAF A;  3BNE A;  5I97 A;  3GZB A;  2JDI H;  4G1M B;  5AIG A;  4O3V A;  3NM2 A;  1DVD A;  3CCS 3;  3NXJ A;  2OCT A;  1K28 A;  5KP1 A;  4XDV A;  4ORL A;  3BNC A;  2O3O A;  3JUO A;  3X3Z A;  4OK0 A;  1VQP 3;  5IER A;  4FCJ A;  1VQO 3;  4R1K A;  2FNQ A;  4HZ9 B;  3B4P A;  4LSO A;  4LMI A;  4WYK A;  3BLZ A;  3HII A;  3LT8 A;  2D42 A;  1JB5 A;  3FG1 A;  1K73 4;  1JV2 B;  4XM4 A;  2HMN B;  1YHQ 3;  2FGT A;  2GXF A;  4L7K A;  3DGL A;  3ROB A;  1TP6 A;  2W0Q A;  1TFO A;  3IMA B;  3GAX A;  2F98 A;  1OGX A;  4BTW A;  5FGO A;  1OF5 B;  2CFK A;  2Z7A A;  3N54 B;  4EXR A;  5AEU B;  2Y73 A;  1YJN 3;  3ER7 A;  1Z1S A;  3AMO A;  2XSO B;  3V99 A;  2BHM A;  1OHS A;  1DVC A;  1CYV A;  2IA7 A;  2WOH A;  2C10 A;  4WHA A;  4FCM A;  4O2H A;  1GY6 A;  1GY5 A;  1U5O A;  1W6G A;  3CMA 3;  3A76 A;  1RN7 A;  2YFJ B;  2CFG A;  5LC6 A;  5CK6 A;  1Q81 4;  1RRL A;  3BND A;  1W02 A;  3LTA A;  1WQL B;  4HM2 B;  1J2B A;  4HKV B;  3F9S A;  3B7C A;  3SOY A;  3SXX A;  3GZX B;  5IG3 A;  1NWW A;  1W4N A;  4HM0 B;  2R4I A;  4EBG A;  3U1W A;  2W56 A;  1GD4 A;  1WTH A;  2GU3 A;  4O02 B;  4BTY A;  3KZT A;  4KZ1 A;  4RZM A;  1IQ8 A;  3CME 3;  3FF2 A;  4KFF A;  4NHF A;  4L8O A;  2RCD A;  2GBW B;  5EEO A;  5D82 A;  1OUN A;  3VF1 A;  2LYX A;  3G0K A;  1O7H B;  2HML B;  1CQS A;  3UB1 A;  3LTB A;  3EBT A;  3EX9 A;  2PNC A;  5AI1 A;  3NQY A;  3CCM 3;  1IVX A;  3LH4 A;  3EN8 A;  1SQW A;  3KFQ C;  3CCJ 3;  2IMJ A;  2RGQ A;  3JVC A;  3MKI A;  1SPU A;  3GZY B;  3NBR A;  3OWS A;  3BNB A;  3SVA A;  2OOV C;  1IVU A;  1SIH A;  2INX A;  1IQX A;  3CCV 3;  1Q42 A;  1JB4 A;  1WMO A;  3N8B A;  4LGQ A;  1O7N B;  4N6M A;  3SOA A;  1JKG A;  4R9K A;  1E3V A;  1O7W B;  3OXA A;  2WOF A;  4XB5 A;  2K54 A;  2XRX B;  1WMN A;  5AIF A;  1LVN A;  1DMM A;  3NX0 A;  2E2V A;  2CWU A;  3CPW 2;  4J8T A;  2KXG A;  1R4C A;  1IV9 A;  1O7M B;  1ASK A;  1S72 3;  3CCU 3;  1G96 A;  4EV2 A;  3X3X A;  3Q90 A;  2CHC A;  4HJL B;  3NV0 A;  3RGR A;  2CIU A;  3FCS B;  1ROV A;  1V74 A;  1VQ5 3;  4AEQ A;  4HYZ A;  4TX4 A;  3CCE 3;  3MYT A;  1IK3 A;  5IF6 A;  5CF1 A;  3JUM A;  1VQ8 3;  5G2G A;  1W6Y A;  4EYC A;  3WA2 X;  1TIJ A;  4I4K A;  2CG1 A;  1E3R A;  2GU1 A;  3GZR A;  3B4O A;  1W5Z A;  1M9G A;  3CXC 2;  2BT3 A;  1OCV A;  3LXU X;  3SED A;  1A90 A;  1FGR A;  5TGN A;  3LML A;  2WGQ A;  4NRE A;  2ZDJ A;  2W6J H;  3ALA A;  1US1 A;  1SJW A;  2P38 A;  2P0X A;  1VQ7 3;  5HGR A;  3IJE B;  1RKY A;  2CW9 A;  1LXE A;  1DMQ A;  4X2H A;  5STD A;  3OWY A;  2ML5 A;  1JNQ A;  3B8L A;  3WDG B;  3OW2 2;  1Q82 4;  4N6O B;  1AV4 A;  5ELU A;  1EQK A;  4CCV A;  3GRD A;  4MEI A;  1NDO B;  2E2T A;  1LNH A;  2OQE A;  5IW9 A;  5ELJ A;  2Z77 A;  1WMP A;  1VQL 3;  3EQQ B;  3ECF A;  3K5T A;  2MC8 A;  2CK3 H;  3RDE A;  1CYU A;  2PZV A;  1CEW I;  2KRT A;  2QIY A;  1NB3 I;  3I55 3;  2HMO B;  2HMJ B;  5IEO A;  3N9H A;  3PXM A;  3LT9 A;  2OTJ 3;  1W01 A;  3QRD A;  4L8P A;  1ISK A;  3KSE D;  4BTX A;  1Q40 A;  4K1V A;  2OTL 3;  1FGO A;  2BMR B;  2OOV A;  3L0R A;  4PEJ A;  3DMC A;  3V92 A;  5D83 A;  3F40 A;  3KSP A;  1RRH A;  4K61 A;  4HM5 B;  4IT7 A;  3WMD A;  2W04 A;  3DXO A;  3PGB A;  2O9U X;  2C11 A;  1W7C A;  3UNL A;  3FG4 A;  3JUN A;  3K9M C;  2ZL8 A;  2BMQ B;  1K41 A;  1HU9 A;  3E99 A;  1GY7 A;  4EV5 A;  3BB9 A;  3D3L A;  1F8N A;  2GEY A;  1W00 A;  2OQE C;  3FZW A;  5AYR B;  3UJM A;  3FKA A;  4OVM A;  3CNX A;  3KE7 A;  4XDW A;  2RSX A;  1W6C A;  4RNZ A;  1OF5 A;  3T8U A;  4MMX B;  4RNY A;  2CFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...