3QRDA

Crystal structure of l68v mutant of human cystatin c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 18
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3qrdA00
4EYCA 1IV9A 4CCVA 3IMAB 3GAXA 3PYJA 1CYUA 4LZIA 1IV7A 4N6OB 4N6LA 4N6UA 1FA3A 1PFPA 1CEWI 2W9QA 2CH9A 1G96A 1M9GA 4TX4A 1FUWA 3Q2PA 1A90A 1GD4A 1EQKA 3KFQC 1MOLA 1NB5I 5ELJA 1TIJA 5LC7A 3SVAA 3KSED 2KXGA 4N6TA 1R4CA 3K9MC 5A0OB 3NX0A 1ROAA 1RN7A 2O9UX 4IT7A 3PS8A 1YVBI 5EQLA 1GD3A 3UL5A 2BO9B 3PXMA 4N6V0 1DVDA 4ZM8A 1DVCA 1WNHA 4N6MA 1STFI 4N6NB 1N5PA 3S67A 3QRDA 5ELUA 3UL6A 1NB3I 1CYVA 3LH4A 3MWZA 1N9JA 1MNLA 1N5HA 3L0RA 1KWIA 2W9PA 5LC6A 1A67A 2OCTA 1LXEA
chains in the Genus database with same CATH superfamily
1IV9A 1BNIA 3K0ZA 1O7HB 1AV4A 2I9WA 2ML6A 3MHEA 1BUQA 1N8QA 2MF7A 1RGHA 1W00A 2RCDA 3LTBA 2IUKA 1O7NB 3PYJA 4LYLB 2GU1A 3EN8A 5G2GA 1RGLA 1LQGC 7STDA 3LXUX 3LYGA 1RN1A 1IV7A 1ZS7A 2BMQB 1DMMA 3B8LA 5DREA 3BB9A 3U1WA 3EBTA 1VQ53 1BUJA 1FA3A 1KD14 2YFJB 4HM4B 1BNRA 4IPBA 1UI7A 1JNQA 2ZDJA 5IG3A 1QVG2 1BNJA 3EX9A 3WODG 2OWPA 1F8NA 1IVWA 2CH9A 3CCJ3 5AEWB 1RRHA 1W5ZA 5EEOA 4XB5A 1JKGB 1YJN3 1BNFA 3V98A 3ZFZA 2Z6BA 1FW7A 2F5MA 1K41A 3F14A 4EC6A 4TX4A 1MWRA 4K1VA 1BAOA 2RFRA 3JUNA 2LQVA 3CU3A 5FW5A 3V99A 3I563 3OWSA 5KP4A 5CXOA 2K54A 3GZXB 4CDLA 3Q2PA 3MG2A 3FCSB 2RBIA 2F5WA 1X1XA 1ZX2A 3SXXA 2OOVC 3AMOA 1B2MA 1YJ93 1C7HA 3UB1A 1E97A 4JRFA 2Y73A 3UNLA 4H3UA 1NB5I 1RNBA 1VQL3 3ZG0A 3E99A 1GMQA 4FMAA 1A2VA 2XFTA 4MJDA 4RZMA 3KCHA 1BRKA 1IQ8A 1WMPA 1IVUA 1QAFA 2Q07A 4EV5A 1RNTA 2W0QA 2ZHXB 2GU3A 1X1UA 3EE1A 3KSED 3G4S3 1FGOA 1A2PA 2ZA4A 4FCJA 1UCJA 2W04A 5IG0A 1T2HA 3HIGA 3OWUA 4LGQA 4PEJA 2XRXB 2OOVA 1EG9B 3KSPA 5BIRA 4J5KA 2XF3A 1EUIC 4RBNA 4BL3A 3VGNA 1FZUA 3BU4A 4MMZB 3G6E3 3PGBA 3CCL3 3BIRA 4KFFA 3NXJA 3UL5A 2BO9B 1TRPA 1RTUA 2BHMA 3LZAA 1FYSA 1Q42A 1M1K4 2XGLA 1E3RA 2W03A 5I97A 2PZVA 1IT8A 1WNHA 1TFKA 3HX8A 4R4KA 1S5AA 3KKGA 4N6NB 5CF2A 1N5PA 4XM4A 2L4VA 3S67A 4J9AA 1I2FA 4HM3B 1K734 1BU4A 1RCKA 2FNQA 2HMNB 1TJDA 3NQZA 3UL6A 5IW9A 2YFIB 5TGNA 1PYLA 1TUHA 2P38A 5IERA 4ILFA 2JDIH 1N9JA 1W2ZA 1U5OA 3EBYA 1I2EA 3FSDA 3DH2A 3DUKA 3QK9A 3J7Yd 2KF3A 4WYKB 2CFDA 2HMJB 4AEQA 2CK3H 1UCIA 3ER7A 4EBGA 3AHWA 2FGTA 4J8TA 1A67A 2BU4A 3B7CA 1B2XA 2OCTA 2Z76A 3BNDA 3FLJA 1RMSA 1TU5A 2KF4A 4CCVA 3IMAB 1HYFA 1Y4KA 4CPKA 3LT8A 3GRDA 1RHLA 3KE7A 4HM5B 3F8HA 1CYUA 1UUVB 3FH1A 4OVMA 1UCKA 1QAKA 4NREA 2YX9A 1SARA 1GSPA 1O7PB 3FGYA 5AEUB 1VQ73 2XH9A 3T8NA 5BXQA 1O7WB 1PY3A 1V58A 5IEPA 3WA3A 3EHCA 1LOXA 1YIJ3 4FMCA 2B24B 1M904 1RCLA 1VQ43 2XEPA 4KT3B 4JF8A 4WHAA 3WHOA 1WQLB 1G96A 2RNTA 3WR2A 2GEXA 1RGAA 1O7GB 3F40A 2H0GA 4O2HA 3VF1A 6RNTA 1JKGA 1I70A 3F7SA 4XBTA 1EEJA 3BNBA 3CPOA 1FGQA 4GSPA 4LEHA 3SLUA 1OACA 3Q3FA 5JPPA 1SIHA 4I4KA 2IY2A 3SEDA 3N8BA 2GEYA 1AQZA 1DE3A 3LOYA 4FMBA 5JPUA 1MGWA 3STDA 4STDA 2QEX3 4L7KA 1EQKA 2KCDA 2ZL8A 4BTYA 3ALAA 1MOLA 3JUMA 5EVHA 1OF5B 3Q1CA 3D5GA 5LC7A 2WGOA 3CCM3 1FGTA 1SQWA 3KIIA 4HM2B 1ISKA 1I3FA 1OHSA 4N6TA 3FG4A 1B3SA 1QMAA 1R4CA 1GMPA 3EN1B 2K3DA 3K9MC 2OTJ3 3CCR3 5A0OB 3BLZA 1ROAA 1TTOA 4EV2A 1OH0A 2CFLA 2CFGA 1YNVX 2HMLB 1IVVA 1N9EA 1JV2B 1V74A 1BRSA 1BSDA 1VQQA 1WMNA 2CX1A 1SPUA 2XGNA 1FUTA 1Q9EA 1QALA 3GZBA 4KFEA 4HM1B 4R9LA 5AIHA 5EQLA 3F8XA 1A2KA 4HM6B 5STDA 2YFLB 3PXMA 3NBRA 1BSBA 4HOHA 2CG1A 5HGRA 1GY6A 3S29A 3I0YA 1YHQ3 1YI23 4HKVB 2BNGA 7GSPA 1NU3A 3TDGA 5BU4A 3B4PA 1ZO2A 2CC3A 4N6MA 3CC43 1STFI 2HMMB 6STDA 4XDWA 3S28A 3M8CA 4K61A 1B2ZA 1X1YA 1GOUA 3RDEA 1Q824 2IYJA 2Z7AA 5CK6A 1I3IA 3KN4A 2P05A 1LNIA 3URPA 1RKYA 3D9RA 2CWVA 3LT9A 3LH4A 2JQ5A 3RGAA 1UCLA 1BRIA 4WFOA 2CHCA 3CCQ3 1S723 2CFKA 1JN5B 1MNLA 1I8VA 3ROBA 8RNTA 2CX0A 4O3VA 1BRJA 1GY5A 3EF8A 1BGSA 3FF2A 1KC84 1NNVA 2BIRA 3CD63 3T0UA 1BRHA 1LVNA 1TP6A 3MSOA 2HMOB 4HM8B 1DYUA 3MG1A 1X1WA 1BVIA 2E2TA 4WYKA 3CCE3 5M18A 2OTL3 2M7OA 1R4YA 1OCVA 2C10A 4LMIA 4KZ1A 1RGKA 1N8R4 1RGGA 1RLSA 4L8OA 2GXFA 1D6UA 1JZOA 3SYUA 3OW22 1AVLA 2XFSA 1OGZA 1VZZA 2FXTA 4MEIA 1ULJB 2MC8A 2D42A 1KSIA 2CKFB 3EB8A 3X40A 4FMDA 2W56B 1LQMB 3D5IA 3CME3 3CPW2 2GBXB 3V92A 3S27A 2RGQA 1UUWB 2IA7A 1GY7A 5IG5A 1DETA 1BSCA 1WTHA 1T5YA 2E2UA 1BIRA 2W9QA 1W6GA 4HM7B 4RNTA 5D81A 2R4IA 3DM8A 1FGMA 1IYYA 1LOVA 1ULIB 3CXC2 3PCRA 3CCV3 4O02B 2R41A 3FZWA 5IG4A 1T2IA 1BRNL 1M9GA 2SARA 1UGHI 4FCZA 3LTAA 1B2SA 4J5GA 4L8PA 3X41A 4BIRA 1FUWA 4LSOA 1BRGA 1MWTA 1Q40B 1SJWA 5AYRB 1DMNA 4FR9A 1QJGA 2GSPA 2W2CA 5IEOA 2HMKB 5FGOA 1WMOA 4HJLB 2GBWB 4EW5A 4BTXA 4H61A 1A90A 3CNMA 4WP5A 1VQM3 5AYSC 4HM0B 3WA2X 2HOHA 4RNZA 5ELJA 7RNTA 2WOFA 3SX1A 4NHFA 2F86B 3FKAA 4O8SA 1TRQA 1RGFA 2CIUA 3X3ZA 1Q814 1RGEA 3CC73 1W6CA 2PNCA 4U13A 3WOEB 1VQ63 3ZG5A 1UI8A 2KAAA 3NX0A 1OUNA 1RN7A 1RSNA 1FGRA 2INXA 3HI7A 3EJVA 5AIIA 2P09A 3JUPA 3PS8A 3HZPA 4R9KA 4XDVA 1YVBI 4GHOA 1AY7A 3ECFA 4GB5A 3O8YA 2CWUA 3HIIA 3NHXA 3EQQB 4GL6A 4X2OA 2F4YA 2P0MA 1YGWA 3OWYA 4N6V0 1DVDA 1ROVA 1VQN3 3FF0A 1HZ1A 4ZM8A 1Q7HA 3MKIA 2CFWA 1W6YA 1B21A 1NWWA 1DVCA 2H0HA 3DXOA 4HBRA 4IIAA 3CC23 3NV0B 3F7XA 2K0MA 2IUJA 1GS3A 2C11A 1BANA 5KP3A 1I0XA 3F9SA 3EC9A 1NJI4 1ZGXA 4HVNA 6GSPA 2IMJA 4RNYA 1SIIA 1AVKA 3X3XA 5G1KA 1HKXA 3OXAA 3D3LA 4X2HA 3MWZA 3AGNA 3X3YA 1NDOB 1CQSA 2W6JH 3SOAA 1UW1A 3DMCA 1IU7A 2C4BA 4BU4A 2A15A 5GSPA 2L1SA 3RNTA 1VQ83 1JN5A 3H3HA 3WMDA 5D83A 2WOHA 2UUGC 2AADA 1JBTA 2RSXA 1LRAA 1W7CA 1MWSA 1UGIA 1M1XB 2W9PA 3LTDA 4AKYA 2AAEA 5HOHA 1D6ZA 1GYBA 3DGYA 1D6YA 4I5QA 3SOYA 2ML5A 4KFDA 1I0VA 1O7MB 2SBLA 4EYCA 3DY5A 3GAXA 1J2BA 2Z77A 2Y74A 4AKZA 3Q90A 4XBYA 3VSYA 3RGRA 1JBSA 1T3BA 4G1MB 3CMA3 1I2GA 4LZIA 9RNTA 4EXRA 3HOHA 3A5EA 1MGRA 4N6OB 4N6LA 4N6UA 3GZRA 3N54B 1B20A 3IPTA 3N9HA 3G0KA 5IENA 3GZYB 1JZDA 3WDGB 1JB4A 3DGMA 2W56A 1EA2A 1PFPA 3K5TA 5M1AA 4WWUC 1CEWI 3UJMA 1RGCA 5RNTA 1VQ93 3NBBA 2OQEC 1GOVA 1KQS2 1LNHA 1IK3A 3NQYA 1VQO3 3AHSA 2J8XB 4FCMA 1W01A 3G713 3CCS3 2WGQA 1RJOA 4BL2A 3HK4A 1BSAA 4HZBB 3U97A 3FG3A 3PCSA 2F98A 2QA43 3JUOA 3NBJA 3CNXA 2BMOB 4QWTA 3A76A 1OHOA 1OHPA 2OQEA 3DGNA 1IQXA 3AMOB 3LMLA 1Q40A 3GWRA 3D79A 2CG0A 1BOXA 3BNEA 4R80A 3LTCA 1LOWA 3DGOA 1GD4A 2KRTA 3PZWA 5M19A 1PU4A 1TFOA 1Z1SA 3KFQC 3OV4A 1QVF2 1TIJA 1BNSA 1Q864 2KF6A 1OGXA 3SVAA 1JB5A 1JRQA 2V1LA 1MWUA 1STDA 4HZ9B 5CF1A 1BSEA 3K63A 1G0TA 2KXGA 2O3OA 2XSHB 1NO3A 1DMQA 4K1UA 1GOYA 1E3VA 4MMXB 5DRVA 4NPBA 1UUGB 2CWTA 3T8UA 1UDII 1RDSA 1IQYA 1EKMA 4R1KA 1W4NA 8CHOA 2H0IA 1IT7A 3IJEB 2O9UX 4IT7A 4HYZA 3X42A 2D1WA 3AGOA 3WOFB 5D82A 1YIT3 2F56A 1ASKA 1FUSA 1RN4A 1GD3A 1LOYA 4Q53A 2P0XA 1V57A 3DZLA 2KF5A 3JUQA 4DKIA 1OPYA 5IF6A 1K9M4 1BNGA 1VQK3 3MPHA 4XBXA 5KP1A 2STDA 3GSPA 1JJ22 3I553 1W2B2 4OK0A 1JBRA 1HU9A 1AR0A 3MG3A 1OF5A 3G8ZA 3JVCA 1W02A 3NV0A 4K90B 1C54A 2LYXA 2WO0A 1K28A 3QRDA 1RRLA 2F99A 5ELUA 4OUQA 1U8CB 2XR8B 1GMRA 1IVXA 1JB2A 1NB3I 1CYVA 1CH0A 2BT3A 1IDPA 1VQP3 1G02A 1YGEA 2BMRB 3K7CA 1L5GB 5G1LA 2UX0A 3NUVA 4MMYB 1BNEA 2UGIA 4N3VA 4ORLA 3S5CA 2QIYA 5AI1A 3DGLA 4KVHA 1N5HA 2E2VA 3NM7A 5BVBA 5JBSA 1YJW3 5CLKA 3L0RA 3MYTA 3NM2A 5AIGA 2B1XB 3B4OA 4HAAA 1B2UA 1KWIA 2CW9A 2XSOB 4CJNA 3FG1A 3OX9A 3CCU3 1B27A 4BTWA 1US1A 1YVSA 1K8A4 3KZTA 5LC6A 3H51A 3G16A 3D4AA 3BNCA 1Q7Y4 1LXEA 5AIFA 2QGUA
chains in the Genus database with same CATH topology
1IV9A 3K0ZA 1O7HB 1AV4A 2I9WA 2ML6A 3MHEA 1BUQA 1N8QA 2MF7A 1W00A 3LTBA 2RCDA 2IUKA 1O7NB 3PYJA 2GU1A 3EN8A 5G2GA 7STDA 3LXUX 3LYGA 1IV7A 2BMQB 1DMMA 3B8LA 5DREA 3BB9A 3U1WA 3EBTA 1VQ53 1FA3A 1KD14 2YFJB 4HM4B 4IPBA 1UI7A 1JNQA 2ZDJA 5IG3A 1QVG2 3EX9A 3WODG 2OWPA 1F8NA 1IVWA 2CH9A 3CCJ3 5AEWB 1RRHA 1W5ZA 5EEOA 4XB5A 1JKGB 1YJN3 3V98A 2Z6BA 1K41A 3F14A 4EC6A 4TX4A 4K1VA 5FW5A 2RFRA 3JUNA 2LQVA 3CU3A 3V99A 3I563 3OWSA 5KP4A 5CXOA 2K54A 3GZXB 4CDLA 3Q2PA 3MG2A 3FCSB 1ZX2A 3SXXA 2OOVC 3AMOA 1YJ93 1C7HA 3UB1A 1E97A 4JRFA 2Y73A 3UNLA 4H3UA 1NB5I 1VQL3 3E99A 4FMAA 1A2VA 2XFTA 4MJDA 4RZMA 1IQ8A 1WMPA 1IVUA 1QAFA 2Q07A 4EV5A 2W0QA 3G4S3 2GU3A 3EE1A 3KSED 1FGOA 4FCJA 2W04A 5IG0A 3HIGA 3OWUA 4LGQA 4PEJA 2XRXB 2OOVA 1EG9B 3KSPA 2XF3A 4RBNA 3VGNA 3G6E3 4MMZB 3PGBA 3CCL3 4KFFA 3NXJA 3UL5A 2BO9B 2BHMA 3LZAA 1Q42A 1M1K4 2XGLA 1E3RA 2W03A 5I97A 2PZVA 1IT8A 1WNHA 1TFKA 3HX8A 4R4KA 1S5AA 3KKGA 4N6NB 5CF2A 1N5PA 4XM4A 2L4VA 3S67A 4J9AA 4HM3B 1K734 2FNQA 2HMNB 3NQZA 3UL6A 5IW9A 2YFIB 5TGNA 1TUHA 2P38A 5IERA 2JDIH 1N9JA 1W2ZA 1U5OA 3EBYA 3FSDA 3DUKA 3QK9A 3J7Yd 4WYKB 2CFDA 2HMJB 4AEQA 2CK3H 3ER7A 4EBGA 2FGTA 4J8TA 1A67A 3B7CA 1TU5A 2Z76A 2OCTA 3BNDA 3FLJA 4CCVA 3IMAB 1Y4KA 3LT8A 3GRDA 3KE7A 4HM5B 3F8HA 1CYUA 1UUVB 3FH1A 4OVMA 1QAKA 4NREA 2YX9A 3FGYA 1O7PB 5AEUB 1VQ73 2XH9A 3T8NA 5BXQA 1O7WB 5IEPA 3WA3A 3EHCA 1LOXA 1YIJ3 4FMCA 2B24B 1M904 2XEPA 4JF8A 4WHAA 1WQLB 1G96A 2GEXA 3F40A 1O7GB 4O2HA 3VF1A 1JKGA 3F7SA 4XBTA 3BNBA 3CPOA 1FGQA 3SLUA 4LEHA 5JPPA 1OACA 1SIHA 4I4KA 3SEDA 3N8BA 2GEYA 3LOYA 4FMBA 5JPUA 3STDA 4STDA 2QEX3 4L7KA 1EQKA 2KCDA 2ZL8A 4BTYA 3ALAA 1MOLA 3JUMA 5EVHA 1OF5B 3Q1CA 5LC7A 2WGOA 3CCM3 1FGTA 1SQWA 3KIIA 4HM2B 1ISKA 1OHSA 4N6TA 3FG4A 1QMAA 1R4CA 3EN1B 2OTJ3 3K9MC 3CCR3 5A0OB 3BLZA 1ROAA 4EV2A 1OH0A 2CFLA 2CFGA 2HMLB 1IVVA 1N9EA 1JV2B 1V74A 2XGNA 3D3LA 1WMNA 3EB8A 3IJEB 1SPUA 4KFEA 1QALA 3GZBA 4R9LA 4HM1B 5AIHA 5EQLA 3F8XA 1A2KA 4HM6B 5STDA 2YFLB 3PXMA 3NBRA 2CG1A 5HGRA 1GY6A 3S29A 3I0YA 1YHQ3 1YI23 4HKVB 2BNGA 1NU3A 3TDGA 3CC43 3B4PA 1ZO2A 2CC3A 4N6MA 1STFI 2HMMB 6STDA 4XDWA 3S28A 3M8CA 4K61A 3RDEA 1Q824 2Z7AA 5CK6A 3KN4A 2P05A 1RKYA 3D9RA 2CWVA 3LT9A 3LH4A 2JQ5A 3RGAA 4WFOA 2CHCA 3CCQ3 1S723 2CFKA 1JN5B 1MNLA 3ROBA 4O3VA 1GY5A 3EF8A 1KC84 3FF2A 3CD63 3T0UA 1LVNA 1TP6A 3MSOA 2HMOB 4HM8B 1DYUA 3MG1A 3CCE3 2OTL3 2E2TA 4WYKA 2M7OA 1OCVA 2C10A 4LMIA 4KZ1A 1N8R4 4L8OA 2GXFA 1D6UA 3OW22 1AVLA 2XFSA 1OGZA 1VZZA 2FXTA 4MEIA 1ULJB 2MC8A 2D42A 1KSIA 2CKFB 3X40A 4FMDA 2W56B 3CPW2 3CME3 2GBXB 3V92A 3S27A 2RGQA 1UUWB 2IA7A 1GY7A 5IG5A 1WTHA 1T5YA 2E2UA 4HM7B 2W9QA 1W6GA 5D81A 2R4IA 3DM8A 1FGMA 1ULIB 3CXC2 3PCRA 3CCV3 4O02B 5IG4A 3FZWA 1M9GA 4FCZA 3LTAA 4L8PA 3X41A 1FUWA 4LSOA 1Q40B 1SJWA 5AYRB 1DMNA 4FR9A 1QJGA 2W2CA 5IEOA 2HMKB 5FGOA 1WMOA 4HJLB 2GBWB 4BTXA 4H61A 1A90A 3CNMA 4WP5A 1VQM3 5AYSC 4HM0B 3WA2X 4RNZA 5ELJA 2WOFA 3SX1A 4NHFA 2F86B 3FKAA 4O8SA 2CIUA 3X3ZA 1Q814 3CC73 1W6CA 2PNCA 4U13A 3WOEB 1VQ63 1UI8A 3NX0A 1OUNA 1RN7A 1FGRA 2INXA 3HI7A 3EJVA 5AIIA 2P09A 3JUPA 3PS8A 3HZPA 4R9KA 4XDVA 1YVBI 3ECFA 4GB5A 3O8YA 2CWUA 3HIIA 3NHXA 3EQQB 4GL6A 4X2OA 2P0MA 3OWYA 4N6V0 1DVDA 1ROVA 1VQN3 3FF0A 4ZM8A 3MKIA 2CFWA 1W6YA 1NWWA 3DXOA 1DVCA 4HBRA 3CC23 1VQ43 4IIAA 3NV0B 3F7XA 2K0MA 2IUJA 1GS3A 2C11A 5KP3A 3F9SA 3EC9A 1NJI4 4HVNA 2IMJA 4RNYA 1SIIA 1AVKA 3X3XA 1HKXA 3OXAA 4X2HA 3MWZA 3X3YA 2W6JH 1CQSA 1NDOB 3SOAA 1UW1A 3DMCA 1IU7A 2A15A 1VQ83 1JN5A 3H3HA 3WMDA 5D83A 2WOHA 2RSXA 1W7CA 3LTDA 4AKYA 1M1XB 2W9PA 1D6ZA 1GYBA 1D6YA 3SOYA 2ML5A 4KFDA 1O7MB 2SBLA 4EYCA 3DY5A 3GAXA 1J2BA 2Z77A 2Y74A 4AKZA 3Q90A 4XBYA 3VSYA 3RGRA 4G1MB 3CMA3 4LZIA 4EXRA 4N6OB 4N6LA 4N6UA 3GZRA 3N54B 3IPTA 3N9HA 3G0KA 5IENA 3GZYB 3WDGB 1JB4A 3DGMA 2W56A 1EA2A 1PFPA 3K5TA 4WWUC 1CEWI 3UJMA 1VQ93 3NBBA 2OQEC 1KQS2 1LNHA 1IK3A 3NQYA 1VQO3 4FCMA 3G713 1W01A 3CCS3 2WGQA 1RJOA 3HK4A 4HZBB 3U97A 3FG3A 3PCSA 2F98A 2QA43 3JUOA 3NBJA 3CNXA 2BMOB 4QWTA 3A76A 1OHOA 1OHPA 2OQEA 3DGNA 1IQXA 3AMOB 3LMLA 1Q40A 3GWRA 2CG0A 3BNEA 4R80A 3LTCA 3DGOA 1GD4A 2KRTA 3PZWA 1PU4A 1TFOA 1Z1SA 3KFQC 3OV4A 1QVF2 1TIJA 1Q864 1OGXA 3SVAA 1JB5A 1JRQA 2V1LA 1STDA 4HZ9B 5CF1A 3K63A 2KXGA 2XSHB 2O3OA 1NO3A 1DMQA 4K1UA 5DRVA 1E3VA 4MMXB 2CWTA 3T8UA 4R1KA 1IQYA 1EKMA 1W4NA 8CHOA 1IT7A 2O9UX 4IT7A 4HYZA 3X42A 2D1WA 3WOFB 5D82A 1YIT3 1ASKA 1GD3A 4Q53A 2P0XA 3DZLA 3JUQA 5IF6A 1K9M4 1OPYA 1VQK3 3MPHA 4XBXA 5KP1A 2STDA 1JJ22 3I553 1W2B2 4OK0A 1HU9A 1AR0A 3MG3A 1OF5A 3G8ZA 3JVCA 1W02A 3NV0A 4K90B 2LYXA 2WO0A 1K28A 3QRDA 1RRLA 2F99A 5ELUA 4OUQA 1U8CB 2XR8B 1IVXA 1JB2A 1NB3I 1CYVA 2BT3A 1IDPA 1VQP3 1YGEA 2BMRB 3K7CA 1L5GB 2UX0A 3NUVA 4MMYB 4N3VA 4ORLA 3S5CA 2QIYA 5AI1A 3DGLA 4KVHA 1N5HA 2E2VA 3NM7A 5BVBA 5JBSA 1YJW3 5CLKA 3L0RA 3MYTA 3NM2A 5AIGA 2B1XB 3B4OA 1KWIA 2CW9A 2XSOB 3FG1A 3OX9A 3CCU3 4BTWA 1US1A 1K8A4 3KZTA 5LC6A 3H51A 3G16A 3BNCA 1Q7Y4 1LXEA 5AIFA 2QGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYC A;  1IV9 A;  4CCV A;  3IMA B;  3GAX A;  3PYJ A;  1CYU A;  4LZI A;  1IV7 A;  4N6O B;  4N6L A;  4N6U A;  1FA3 A;  1PFP A;  1CEW I;  2W9Q A;  2CH9 A;  1G96 A;  1M9G A;  4TX4 A;  1FUW A;  3Q2P A;  1A90 A;  1GD4 A;  1EQK A;  3KFQ C;  1MOL A;  1NB5 I;  5ELJ A;  1TIJ A;  5LC7 A;  3SVA A;  3KSE D;  2KXG A;  4N6T A;  1R4C A;  3K9M C;  5A0O B;  3NX0 A;  1ROA A;  1RN7 A;  2O9U X;  4IT7 A;  3PS8 A;  1YVB I;  5EQL A;  1GD3 A;  3UL5 A;  2BO9 B;  3PXM A;  4N6V 0;  1DVD A;  4ZM8 A;  1DVC A;  1WNH A;  4N6M A;  1STF I;  4N6N B;  1N5P A;  3S67 A;  3QRD A;  5ELU A;  3UL6 A;  1NB3 I;  1CYV A;  3LH4 A;  3MWZ A;  1N9J A;  1MNL A;  1N5H A;  3L0R A;  1KWI A;  2W9P A;  5LC6 A;  1A67 A;  2OCT A;  1LXE A; 
#chains in the Genus database with same CATH topology
 1IV9 A;  1BNI A;  3K0Z A;  1O7H B;  1AV4 A;  2I9W A;  2ML6 A;  3MHE A;  1BUQ A;  1N8Q A;  2MF7 A;  1RGH A;  1W00 A;  2RCD A;  3LTB A;  2IUK A;  1O7N B;  3PYJ A;  4LYL B;  2GU1 A;  3EN8 A;  5G2G A;  1RGL A;  1LQG C;  7STD A;  3LXU X;  3LYG A;  1RN1 A;  1IV7 A;  1ZS7 A;  2BMQ B;  1DMM A;  3B8L A;  5DRE A;  3BB9 A;  3U1W A;  3EBT A;  1VQ5 3;  1BUJ A;  1FA3 A;  1KD1 4;  2YFJ B;  4HM4 B;  1BNR A;  4IPB A;  1UI7 A;  1JNQ A;  2ZDJ A;  5IG3 A;  1QVG 2;  1BNJ A;  3EX9 A;  3WOD G;  2OWP A;  1F8N A;  1IVW A;  2CH9 A;  3CCJ 3;  5AEW B;  1RRH A;  1W5Z A;  5EEO A;  4XB5 A;  1JKG B;  1YJN 3;  1BNF A;  3V98 A;  3ZFZ A;  2Z6B A;  1FW7 A;  2F5M A;  1K41 A;  3F14 A;  4EC6 A;  4TX4 A;  1MWR A;  4K1V A;  1BAO A;  2RFR A;  3JUN A;  2LQV A;  3CU3 A;  5FW5 A;  3V99 A;  3I56 3;  3OWS A;  5KP4 A;  5CXO A;  2K54 A;  3GZX B;  4CDL A;  3Q2P A;  3MG2 A;  3FCS B;  2RBI A;  2F5W A;  1X1X A;  1ZX2 A;  3SXX A;  2OOV C;  3AMO A;  1B2M A;  1YJ9 3;  1C7H A;  3UB1 A;  1E97 A;  4JRF A;  2Y73 A;  3UNL A;  4H3U A;  1NB5 I;  1RNB A;  1VQL 3;  3ZG0 A;  3E99 A;  1GMQ A;  4FMA A;  1A2V A;  2XFT A;  4MJD A;  4RZM A;  3KCH A;  1BRK A;  1IQ8 A;  1WMP A;  1IVU A;  1QAF A;  2Q07 A;  4EV5 A;  1RNT A;  2W0Q A;  2ZHX B;  2GU3 A;  1X1U A;  3EE1 A;  3KSE D;  3G4S 3;  1FGO A;  1A2P A;  2ZA4 A;  4FCJ A;  1UCJ A;  2W04 A;  5IG0 A;  1T2H A;  3HIG A;  3OWU A;  4LGQ A;  4PEJ A;  2XRX B;  2OOV A;  1EG9 B;  3KSP A;  5BIR A;  4J5K A;  2XF3 A;  1EUI C;  4RBN A;  4BL3 A;  3VGN A;  1FZU A;  3BU4 A;  4MMZ B;  3G6E 3;  3PGB A;  3CCL 3;  3BIR A;  4KFF A;  3NXJ A;  3UL5 A;  2BO9 B;  1TRP A;  1RTU A;  2BHM A;  3LZA A;  1FYS A;  1Q42 A;  1M1K 4;  2XGL A;  1E3R A;  2W03 A;  5I97 A;  2PZV A;  1IT8 A;  1WNH A;  1TFK A;  3HX8 A;  4R4K A;  1S5A A;  3KKG A;  4N6N B;  5CF2 A;  1N5P A;  4XM4 A;  2L4V A;  3S67 A;  4J9A A;  1I2F A;  4HM3 B;  1K73 4;  1BU4 A;  1RCK A;  2FNQ A;  2HMN B;  1TJD A;  3NQZ A;  3UL6 A;  5IW9 A;  2YFI B;  5TGN A;  1PYL A;  1TUH A;  2P38 A;  5IER A;  4ILF A;  2JDI H;  1N9J A;  1W2Z A;  1U5O A;  3EBY A;  1I2E A;  3FSD A;  3DH2 A;  3DUK A;  3QK9 A;  3J7Y d;  2KF3 A;  4WYK B;  2CFD A;  2HMJ B;  4AEQ A;  2CK3 H;  1UCI A;  3ER7 A;  4EBG A;  3AHW A;  2FGT A;  4J8T A;  1A67 A;  2BU4 A;  3B7C A;  1B2X A;  2OCT A;  2Z76 A;  3BND A;  3FLJ A;  1RMS A;  1TU5 A;  2KF4 A;  4CCV A;  3IMA B;  1HYF A;  1Y4K A;  4CPK A;  3LT8 A;  3GRD A;  1RHL A;  3KE7 A;  4HM5 B;  3F8H A;  1CYU A;  1UUV B;  3FH1 A;  4OVM A;  1UCK A;  1QAK A;  4NRE A;  2YX9 A;  1SAR A;  1GSP A;  1O7P B;  3FGY A;  5AEU B;  1VQ7 3;  2XH9 A;  3T8N A;  5BXQ A;  1O7W B;  1PY3 A;  1V58 A;  5IEP A;  3WA3 A;  3EHC A;  1LOX A;  1YIJ 3;  4FMC A;  2B24 B;  1M90 4;  1RCL A;  1VQ4 3;  2XEP A;  4KT3 B;  4JF8 A;  4WHA A;  3WHO A;  1WQL B;  1G96 A;  2RNT A;  3WR2 A;  2GEX A;  1RGA A;  1O7G B;  3F40 A;  2H0G A;  4O2H A;  3VF1 A;  6RNT A;  1JKG A;  1I70 A;  3F7S A;  4XBT A;  1EEJ A;  3BNB A;  3CPO A;  1FGQ A;  4GSP A;  4LEH A;  3SLU A;  1OAC A;  3Q3F A;  5JPP A;  1SIH A;  4I4K A;  2IY2 A;  3SED A;  3N8B A;  2GEY A;  1AQZ A;  1DE3 A;  3LOY A;  4FMB A;  5JPU A;  1MGW A;  3STD A;  4STD A;  2QEX 3;  4L7K A;  1EQK A;  2KCD A;  2ZL8 A;  4BTY A;  3ALA A;  1MOL A;  3JUM A;  5EVH A;  1OF5 B;  3Q1C A;  3D5G A;  5LC7 A;  2WGO A;  3CCM 3;  1FGT A;  1SQW A;  3KII A;  4HM2 B;  1ISK A;  1I3F A;  1OHS A;  4N6T A;  3FG4 A;  1B3S A;  1QMA A;  1R4C A;  1GMP A;  3EN1 B;  2K3D A;  3K9M C;  2OTJ 3;  3CCR 3;  5A0O B;  3BLZ A;  1ROA A;  1TTO A;  4EV2 A;  1OH0 A;  2CFL A;  2CFG A;  1YNV X;  2HML B;  1IVV A;  1N9E A;  1JV2 B;  1V74 A;  1BRS A;  1BSD A;  1VQQ A;  1WMN A;  2CX1 A;  1SPU A;  2XGN A;  1FUT A;  1Q9E A;  1QAL A;  3GZB A;  4KFE A;  4HM1 B;  4R9L A;  5AIH A;  5EQL A;  3F8X A;  1A2K A;  4HM6 B;  5STD A;  2YFL B;  3PXM A;  3NBR A;  1BSB A;  4HOH A;  2CG1 A;  5HGR A;  1GY6 A;  3S29 A;  3I0Y A;  1YHQ 3;  1YI2 3;  4HKV B;  2BNG A;  7GSP A;  1NU3 A;  3TDG A;  5BU4 A;  3B4P A;  1ZO2 A;  2CC3 A;  4N6M A;  3CC4 3;  1STF I;  2HMM B;  6STD A;  4XDW A;  3S28 A;  3M8C A;  4K61 A;  1B2Z A;  1X1Y A;  1GOU A;  3RDE A;  1Q82 4;  2IYJ A;  2Z7A A;  5CK6 A;  1I3I A;  3KN4 A;  2P05 A;  1LNI A;  3URP A;  1RKY A;  3D9R A;  2CWV A;  3LT9 A;  3LH4 A;  2JQ5 A;  3RGA A;  1UCL A;  1BRI A;  4WFO A;  2CHC A;  3CCQ 3;  1S72 3;  2CFK A;  1JN5 B;  1MNL A;  1I8V A;  3ROB A;  8RNT A;  2CX0 A;  4O3V A;  1BRJ A;  1GY5 A;  3EF8 A;  1BGS A;  3FF2 A;  1KC8 4;  1NNV A;  2BIR A;  3CD6 3;  3T0U A;  1BRH A;  1LVN A;  1TP6 A;  3MSO A;  2HMO B;  4HM8 B;  1DYU A;  3MG1 A;  1X1W A;  1BVI A;  2E2T A;  4WYK A;  3CCE 3;  5M18 A;  2OTL 3;  2M7O A;  1R4Y A;  1OCV A;  2C10 A;  4LMI A;  4KZ1 A;  1RGK A;  1N8R 4;  1RGG A;  1RLS A;  4L8O A;  2GXF A;  1D6U A;  1JZO A;  3SYU A;  3OW2 2;  1AVL A;  2XFS A;  1OGZ A;  1VZZ A;  2FXT A;  4MEI A;  1ULJ B;  2MC8 A;  2D42 A;  1KSI A;  2CKF B;  3EB8 A;  3X40 A;  4FMD A;  2W56 B;  1LQM B;  3D5I A;  3CME 3;  3CPW 2;  2GBX B;  3V92 A;  3S27 A;  2RGQ A;  1UUW B;  2IA7 A;  1GY7 A;  5IG5 A;  1DET A;  1BSC A;  1WTH A;  1T5Y A;  2E2U A;  1BIR A;  2W9Q A;  1W6G A;  4HM7 B;  4RNT A;  5D81 A;  2R4I A;  3DM8 A;  1FGM A;  1IYY A;  1LOV A;  1ULI B;  3CXC 2;  3PCR A;  3CCV 3;  4O02 B;  2R41 A;  3FZW A;  5IG4 A;  1T2I A;  1BRN L;  1M9G A;  2SAR A;  1UGH I;  4FCZ A;  3LTA A;  1B2S A;  4J5G A;  4L8P A;  3X41 A;  4BIR A;  1FUW A;  4LSO A;  1BRG A;  1MWT A;  1Q40 B;  1SJW A;  5AYR B;  1DMN A;  4FR9 A;  1QJG A;  2GSP A;  2W2C A;  5IEO A;  2HMK B;  5FGO A;  1WMO A;  4HJL B;  2GBW B;  4EW5 A;  4BTX A;  4H61 A;  1A90 A;  3CNM A;  4WP5 A;  1VQM 3;  5AYS C;  4HM0 B;  3WA2 X;  2HOH A;  4RNZ A;  5ELJ A;  7RNT A;  2WOF A;  3SX1 A;  4NHF A;  2F86 B;  3FKA A;  4O8S A;  1TRQ A;  1RGF A;  2CIU A;  3X3Z A;  1Q81 4;  1RGE A;  3CC7 3;  1W6C A;  2PNC A;  4U13 A;  3WOE B;  1VQ6 3;  3ZG5 A;  1UI8 A;  2KAA A;  3NX0 A;  1OUN A;  1RN7 A;  1RSN A;  1FGR A;  2INX A;  3HI7 A;  3EJV A;  5AII A;  2P09 A;  3JUP A;  3PS8 A;  3HZP A;  4R9K A;  4XDV A;  1YVB I;  4GHO A;  1AY7 A;  3ECF A;  4GB5 A;  3O8Y A;  2CWU A;  3HII A;  3NHX A;  3EQQ B;  4GL6 A;  4X2O A;  2F4Y A;  2P0M A;  1YGW A;  3OWY A;  4N6V 0;  1DVD A;  1ROV A;  1VQN 3;  3FF0 A;  1HZ1 A;  4ZM8 A;  1Q7H A;  3MKI A;  2CFW A;  1W6Y A;  1B21 A;  1NWW A;  1DVC A;  2H0H A;  3DXO A;  4HBR A;  4IIA A;  3CC2 3;  3NV0 B;  3F7X A;  2K0M A;  2IUJ A;  1GS3 A;  2C11 A;  1BAN A;  5KP3 A;  1I0X A;  3F9S A;  3EC9 A;  1NJI 4;  1ZGX A;  4HVN A;  6GSP A;  2IMJ A;  4RNY A;  1SII A;  1AVK A;  3X3X A;  5G1K A;  1HKX A;  3OXA A;  3D3L A;  4X2H A;  3MWZ A;  3AGN A;  3X3Y A;  1NDO B;  1CQS A;  2W6J H;  3SOA A;  1UW1 A;  3DMC A;  1IU7 A;  2C4B A;  4BU4 A;  2A15 A;  5GSP A;  2L1S A;  3RNT A;  1VQ8 3;  1JN5 A;  3H3H A;  3WMD A;  5D83 A;  2WOH A;  2UUG C;  2AAD A;  1JBT A;  2RSX A;  1LRA A;  1W7C A;  1MWS A;  1UGI A;  1M1X B;  2W9P A;  3LTD A;  4AKY A;  2AAE A;  5HOH A;  1D6Z A;  1GYB A;  3DGY A;  1D6Y A;  4I5Q A;  3SOY A;  2ML5 A;  4KFD A;  1I0V A;  1O7M B;  2SBL A;  4EYC A;  3DY5 A;  3GAX A;  1J2B A;  2Z77 A;  2Y74 A;  4AKZ A;  3Q90 A;  4XBY A;  3VSY A;  3RGR A;  1JBS A;  1T3B A;  4G1M B;  3CMA 3;  1I2G A;  4LZI A;  9RNT A;  4EXR A;  3HOH A;  3A5E A;  1MGR A;  4N6O B;  4N6L A;  4N6U A;  3GZR A;  3N54 B;  1B20 A;  3IPT A;  3N9H A;  3G0K A;  5IEN A;  3GZY B;  1JZD A;  3WDG B;  1JB4 A;  3DGM A;  2W56 A;  1EA2 A;  1PFP A;  3K5T A;  5M1A A;  4WWU C;  1CEW I;  3UJM A;  1RGC A;  5RNT A;  1VQ9 3;  3NBB A;  2OQE C;  1GOV A;  1KQS 2;  1LNH A;  1IK3 A;  3NQY A;  1VQO 3;  3AHS A;  2J8X B;  4FCM A;  1W01 A;  3G71 3;  3CCS 3;  2WGQ A;  1RJO A;  4BL2 A;  3HK4 A;  1BSA A;  4HZB B;  3U97 A;  3FG3 A;  3PCS A;  2F98 A;  2QA4 3;  3JUO A;  3NBJ A;  3CNX A;  2BMO B;  4QWT A;  3A76 A;  1OHO A;  1OHP A;  2OQE A;  3DGN A;  1IQX A;  3AMO B;  3LML A;  1Q40 A;  3GWR A;  3D79 A;  2CG0 A;  1BOX A;  3BNE A;  4R80 A;  3LTC A;  1LOW A;  3DGO A;  1GD4 A;  2KRT A;  3PZW A;  5M19 A;  1PU4 A;  1TFO A;  1Z1S A;  3KFQ C;  3OV4 A;  1QVF 2;  1TIJ A;  1BNS A;  1Q86 4;  2KF6 A;  1OGX A;  3SVA A;  1JB5 A;  1JRQ A;  2V1L A;  1MWU A;  1STD A;  4HZ9 B;  5CF1 A;  1BSE A;  3K63 A;  1G0T A;  2KXG A;  2O3O A;  2XSH B;  1NO3 A;  1DMQ A;  4K1U A;  1GOY A;  1E3V A;  4MMX B;  5DRV A;  4NPB A;  1UUG B;  2CWT A;  3T8U A;  1UDI I;  1RDS A;  1IQY A;  1EKM A;  4R1K A;  1W4N A;  8CHO A;  2H0I A;  1IT7 A;  3IJE B;  2O9U X;  4IT7 A;  4HYZ A;  3X42 A;  2D1W A;  3AGO A;  3WOF B;  5D82 A;  1YIT 3;  2F56 A;  1ASK A;  1FUS A;  1RN4 A;  1GD3 A;  1LOY A;  4Q53 A;  2P0X A;  1V57 A;  3DZL A;  2KF5 A;  3JUQ A;  4DKI A;  1OPY A;  5IF6 A;  1K9M 4;  1BNG A;  1VQK 3;  3MPH A;  4XBX A;  5KP1 A;  2STD A;  3GSP A;  1JJ2 2;  3I55 3;  1W2B 2;  4OK0 A;  1JBR A;  1HU9 A;  1AR0 A;  3MG3 A;  1OF5 A;  3G8Z A;  3JVC A;  1W02 A;  3NV0 A;  4K90 B;  1C54 A;  2LYX A;  2WO0 A;  1K28 A;  3QRD A;  1RRL A;  2F99 A;  5ELU A;  4OUQ A;  1U8C B;  2XR8 B;  1GMR A;  1IVX A;  1JB2 A;  1NB3 I;  1CYV A;  1CH0 A;  2BT3 A;  1IDP A;  1VQP 3;  1G02 A;  1YGE A;  2BMR B;  3K7C A;  1L5G B;  5G1L A;  2UX0 A;  3NUV A;  4MMY B;  1BNE A;  2UGI A;  4N3V A;  4ORL A;  3S5C A;  2QIY A;  5AI1 A;  3DGL A;  4KVH A;  1N5H A;  2E2V A;  3NM7 A;  5BVB A;  5JBS A;  1YJW 3;  5CLK A;  3L0R A;  3MYT A;  3NM2 A;  5AIG A;  2B1X B;  3B4O A;  4HAA A;  1B2U A;  1KWI A;  2CW9 A;  2XSO B;  4CJN A;  3FG1 A;  3OX9 A;  3CCU 3;  1B27 A;  4BTW A;  1US1 A;  1YVS A;  1K8A 4;  3KZT A;  5LC6 A;  3H51 A;  3G16 A;  3D4A A;  3BNC A;  1Q7Y 4;  1LXE A;  5AIF A;  2QGU A; 
#chains in the Genus database with same CATH homology
 1IV9 A;  3K0Z A;  1O7H B;  1AV4 A;  2I9W A;  2ML6 A;  3MHE A;  1BUQ A;  1N8Q A;  2MF7 A;  1W00 A;  3LTB A;  2RCD A;  2IUK A;  1O7N B;  3PYJ A;  2GU1 A;  3EN8 A;  5G2G A;  7STD A;  3LXU X;  3LYG A;  1IV7 A;  2BMQ B;  1DMM A;  3B8L A;  5DRE A;  3BB9 A;  3U1W A;  3EBT A;  1VQ5 3;  1FA3 A;  1KD1 4;  2YFJ B;  4HM4 B;  4IPB A;  1UI7 A;  1JNQ A;  2ZDJ A;  5IG3 A;  1QVG 2;  3EX9 A;  3WOD G;  2OWP A;  1F8N A;  1IVW A;  2CH9 A;  3CCJ 3;  5AEW B;  1RRH A;  1W5Z A;  5EEO A;  4XB5 A;  1JKG B;  1YJN 3;  3V98 A;  2Z6B A;  1K41 A;  3F14 A;  4EC6 A;  4TX4 A;  4K1V A;  5FW5 A;  2RFR A;  3JUN A;  2LQV A;  3CU3 A;  3V99 A;  3I56 3;  3OWS A;  5KP4 A;  5CXO A;  2K54 A;  3GZX B;  4CDL A;  3Q2P A;  3MG2 A;  3FCS B;  1ZX2 A;  3SXX A;  2OOV C;  3AMO A;  1YJ9 3;  1C7H A;  3UB1 A;  1E97 A;  4JRF A;  2Y73 A;  3UNL A;  4H3U A;  1NB5 I;  1VQL 3;  3E99 A;  4FMA A;  1A2V A;  2XFT A;  4MJD A;  4RZM A;  1IQ8 A;  1WMP A;  1IVU A;  1QAF A;  2Q07 A;  4EV5 A;  2W0Q A;  3G4S 3;  2GU3 A;  3EE1 A;  3KSE D;  1FGO A;  4FCJ A;  2W04 A;  5IG0 A;  3HIG A;  3OWU A;  4LGQ A;  4PEJ A;  2XRX B;  2OOV A;  1EG9 B;  3KSP A;  2XF3 A;  4RBN A;  3VGN A;  3G6E 3;  4MMZ B;  3PGB A;  3CCL 3;  4KFF A;  3NXJ A;  3UL5 A;  2BO9 B;  2BHM A;  3LZA A;  1Q42 A;  1M1K 4;  2XGL A;  1E3R A;  2W03 A;  5I97 A;  2PZV A;  1IT8 A;  1WNH A;  1TFK A;  3HX8 A;  4R4K A;  1S5A A;  3KKG A;  4N6N B;  5CF2 A;  1N5P A;  4XM4 A;  2L4V A;  3S67 A;  4J9A A;  4HM3 B;  1K73 4;  2FNQ A;  2HMN B;  3NQZ A;  3UL6 A;  5IW9 A;  2YFI B;  5TGN A;  1TUH A;  2P38 A;  5IER A;  2JDI H;  1N9J A;  1W2Z A;  1U5O A;  3EBY A;  3FSD A;  3DUK A;  3QK9 A;  3J7Y d;  4WYK B;  2CFD A;  2HMJ B;  4AEQ A;  2CK3 H;  3ER7 A;  4EBG A;  2FGT A;  4J8T A;  1A67 A;  3B7C A;  1TU5 A;  2Z76 A;  2OCT A;  3BND A;  3FLJ A;  4CCV A;  3IMA B;  1Y4K A;  3LT8 A;  3GRD A;  3KE7 A;  4HM5 B;  3F8H A;  1CYU A;  1UUV B;  3FH1 A;  4OVM A;  1QAK A;  4NRE A;  2YX9 A;  3FGY A;  1O7P B;  5AEU B;  1VQ7 3;  2XH9 A;  3T8N A;  5BXQ A;  1O7W B;  5IEP A;  3WA3 A;  3EHC A;  1LOX A;  1YIJ 3;  4FMC A;  2B24 B;  1M90 4;  2XEP A;  4JF8 A;  4WHA A;  1WQL B;  1G96 A;  2GEX A;  3F40 A;  1O7G B;  4O2H A;  3VF1 A;  1JKG A;  3F7S A;  4XBT A;  3BNB A;  3CPO A;  1FGQ A;  3SLU A;  4LEH A;  5JPP A;  1OAC A;  1SIH A;  4I4K A;  3SED A;  3N8B A;  2GEY A;  3LOY A;  4FMB A;  5JPU A;  3STD A;  4STD A;  2QEX 3;  4L7K A;  1EQK A;  2KCD A;  2ZL8 A;  4BTY A;  3ALA A;  1MOL A;  3JUM A;  5EVH A;  1OF5 B;  3Q1C A;  5LC7 A;  2WGO A;  3CCM 3;  1FGT A;  1SQW A;  3KII A;  4HM2 B;  1ISK A;  1OHS A;  4N6T A;  3FG4 A;  1QMA A;  1R4C A;  3EN1 B;  2OTJ 3;  3K9M C;  3CCR 3;  5A0O B;  3BLZ A;  1ROA A;  4EV2 A;  1OH0 A;  2CFL A;  2CFG A;  2HML B;  1IVV A;  1N9E A;  1JV2 B;  1V74 A;  2XGN A;  3D3L A;  1WMN A;  3EB8 A;  3IJE B;  1SPU A;  4KFE A;  1QAL A;  3GZB A;  4R9L A;  4HM1 B;  5AIH A;  5EQL A;  3F8X A;  1A2K A;  4HM6 B;  5STD A;  2YFL B;  3PXM A;  3NBR A;  2CG1 A;  5HGR A;  1GY6 A;  3S29 A;  3I0Y A;  1YHQ 3;  1YI2 3;  4HKV B;  2BNG A;  1NU3 A;  3TDG A;  3CC4 3;  3B4P A;  1ZO2 A;  2CC3 A;  4N6M A;  1STF I;  2HMM B;  6STD A;  4XDW A;  3S28 A;  3M8C A;  4K61 A;  3RDE A;  1Q82 4;  2Z7A A;  5CK6 A;  3KN4 A;  2P05 A;  1RKY A;  3D9R A;  2CWV A;  3LT9 A;  3LH4 A;  2JQ5 A;  3RGA A;  4WFO A;  2CHC A;  3CCQ 3;  1S72 3;  2CFK A;  1JN5 B;  1MNL A;  3ROB A;  4O3V A;  1GY5 A;  3EF8 A;  1KC8 4;  3FF2 A;  3CD6 3;  3T0U A;  1LVN A;  1TP6 A;  3MSO A;  2HMO B;  4HM8 B;  1DYU A;  3MG1 A;  3CCE 3;  2OTL 3;  2E2T A;  4WYK A;  2M7O A;  1OCV A;  2C10 A;  4LMI A;  4KZ1 A;  1N8R 4;  4L8O A;  2GXF A;  1D6U A;  3OW2 2;  1AVL A;  2XFS A;  1OGZ A;  1VZZ A;  2FXT A;  4MEI A;  1ULJ B;  2MC8 A;  2D42 A;  1KSI A;  2CKF B;  3X40 A;  4FMD A;  2W56 B;  3CPW 2;  3CME 3;  2GBX B;  3V92 A;  3S27 A;  2RGQ A;  1UUW B;  2IA7 A;  1GY7 A;  5IG5 A;  1WTH A;  1T5Y A;  2E2U A;  4HM7 B;  2W9Q A;  1W6G A;  5D81 A;  2R4I A;  3DM8 A;  1FGM A;  1ULI B;  3CXC 2;  3PCR A;  3CCV 3;  4O02 B;  5IG4 A;  3FZW A;  1M9G A;  4FCZ A;  3LTA A;  4L8P A;  3X41 A;  1FUW A;  4LSO A;  1Q40 B;  1SJW A;  5AYR B;  1DMN A;  4FR9 A;  1QJG A;  2W2C A;  5IEO A;  2HMK B;  5FGO A;  1WMO A;  4HJL B;  2GBW B;  4BTX A;  4H61 A;  1A90 A;  3CNM A;  4WP5 A;  1VQM 3;  5AYS C;  4HM0 B;  3WA2 X;  4RNZ A;  5ELJ A;  2WOF A;  3SX1 A;  4NHF A;  2F86 B;  3FKA A;  4O8S A;  2CIU A;  3X3Z A;  1Q81 4;  3CC7 3;  1W6C A;  2PNC A;  4U13 A;  3WOE B;  1VQ6 3;  1UI8 A;  3NX0 A;  1OUN A;  1RN7 A;  1FGR A;  2INX A;  3HI7 A;  3EJV A;  5AII A;  2P09 A;  3JUP A;  3PS8 A;  3HZP A;  4R9K A;  4XDV A;  1YVB I;  3ECF A;  4GB5 A;  3O8Y A;  2CWU A;  3HII A;  3NHX A;  3EQQ B;  4GL6 A;  4X2O A;  2P0M A;  3OWY A;  4N6V 0;  1DVD A;  1ROV A;  1VQN 3;  3FF0 A;  4ZM8 A;  3MKI A;  2CFW A;  1W6Y A;  1NWW A;  3DXO A;  1DVC A;  4HBR A;  3CC2 3;  1VQ4 3;  4IIA A;  3NV0 B;  3F7X A;  2K0M A;  2IUJ A;  1GS3 A;  2C11 A;  5KP3 A;  3F9S A;  3EC9 A;  1NJI 4;  4HVN A;  2IMJ A;  4RNY A;  1SII A;  1AVK A;  3X3X A;  1HKX A;  3OXA A;  4X2H A;  3MWZ A;  3X3Y A;  2W6J H;  1CQS A;  1NDO B;  3SOA A;  1UW1 A;  3DMC A;  1IU7 A;  2A15 A;  1VQ8 3;  1JN5 A;  3H3H A;  3WMD A;  5D83 A;  2WOH A;  2RSX A;  1W7C A;  3LTD A;  4AKY A;  1M1X B;  2W9P A;  1D6Z A;  1GYB A;  1D6Y A;  3SOY A;  2ML5 A;  4KFD A;  1O7M B;  2SBL A;  4EYC A;  3DY5 A;  3GAX A;  1J2B A;  2Z77 A;  2Y74 A;  4AKZ A;  3Q90 A;  4XBY A;  3VSY A;  3RGR A;  4G1M B;  3CMA 3;  4LZI A;  4EXR A;  4N6O B;  4N6L A;  4N6U A;  3GZR A;  3N54 B;  3IPT A;  3N9H A;  3G0K A;  5IEN A;  3GZY B;  3WDG B;  1JB4 A;  3DGM A;  2W56 A;  1EA2 A;  1PFP A;  3K5T A;  4WWU C;  1CEW I;  3UJM A;  1VQ9 3;  3NBB A;  2OQE C;  1KQS 2;  1LNH A;  1IK3 A;  3NQY A;  1VQO 3;  4FCM A;  3G71 3;  1W01 A;  3CCS 3;  2WGQ A;  1RJO A;  3HK4 A;  4HZB B;  3U97 A;  3FG3 A;  3PCS A;  2F98 A;  2QA4 3;  3JUO A;  3NBJ A;  3CNX A;  2BMO B;  4QWT A;  3A76 A;  1OHO A;  1OHP A;  2OQE A;  3DGN A;  1IQX A;  3AMO B;  3LML A;  1Q40 A;  3GWR A;  2CG0 A;  3BNE A;  4R80 A;  3LTC A;  3DGO A;  1GD4 A;  2KRT A;  3PZW A;  1PU4 A;  1TFO A;  1Z1S A;  3KFQ C;  3OV4 A;  1QVF 2;  1TIJ A;  1Q86 4;  1OGX A;  3SVA A;  1JB5 A;  1JRQ A;  2V1L A;  1STD A;  4HZ9 B;  5CF1 A;  3K63 A;  2KXG A;  2XSH B;  2O3O A;  1NO3 A;  1DMQ A;  4K1U A;  5DRV A;  1E3V A;  4MMX B;  2CWT A;  3T8U A;  4R1K A;  1IQY A;  1EKM A;  1W4N A;  8CHO A;  1IT7 A;  2O9U X;  4IT7 A;  4HYZ A;  3X42 A;  2D1W A;  3WOF B;  5D82 A;  1YIT 3;  1ASK A;  1GD3 A;  4Q53 A;  2P0X A;  3DZL A;  3JUQ A;  5IF6 A;  1K9M 4;  1OPY A;  1VQK 3;  3MPH A;  4XBX A;  5KP1 A;  2STD A;  1JJ2 2;  3I55 3;  1W2B 2;  4OK0 A;  1HU9 A;  1AR0 A;  3MG3 A;  1OF5 A;  3G8Z A;  3JVC A;  1W02 A;  3NV0 A;  4K90 B;  2LYX A;  2WO0 A;  1K28 A;  3QRD A;  1RRL A;  2F99 A;  5ELU A;  4OUQ A;  1U8C B;  2XR8 B;  1IVX A;  1JB2 A;  1NB3 I;  1CYV A;  2BT3 A;  1IDP A;  1VQP 3;  1YGE A;  2BMR B;  3K7C A;  1L5G B;  2UX0 A;  3NUV A;  4MMY B;  4N3V A;  4ORL A;  3S5C A;  2QIY A;  5AI1 A;  3DGL A;  4KVH A;  1N5H A;  2E2V A;  3NM7 A;  5BVB A;  5JBS A;  1YJW 3;  5CLK A;  3L0R A;  3MYT A;  3NM2 A;  5AIG A;  2B1X B;  3B4O A;  1KWI A;  2CW9 A;  2XSO B;  3FG1 A;  3OX9 A;  3CCU 3;  4BTW A;  1US1 A;  1K8A 4;  3KZT A;  5LC6 A;  3H51 A;  3G16 A;  3BNC A;  1Q7Y 4;  1LXE A;  5AIF A;  2QGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...