3QRDA

Crystal structure of l68v mutant of human cystatin c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
total genus 18
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3qrdA00
1YVBI 4N6UA 3PXMA 1A90A 1CYUA 1EQKA 2OCTA 4TX4A 1NB3I 1FUWA 1KWIA 3IMAB 1CYVA 4N6NB 3UL6A 1FA3A 3KFQC 3L0RA 1DVCA 4N6MA 2BO9B 4N6TA 2O9UX 3MWZA 4ZM8A 4N6OB 3Q2PA 1MOLA 4IT7A 1N9JA 5LC6A 1N5PA 1IV9A 1IV7A 1G96A 1WNHA 2KXGA 1ROAA 3KSED 4N6V0 4LZIA 3K9MC 1PFPA 1TIJA 2W9QA 3PS8A 1A67A 3NX0A 3LH4A 1CEWI 3GAXA 1RN7A 3SVAA 1LXEA 1M9GA 2W9PA 5ELJA 4CCVA 1N5HA 1GD3A 3S67A 3UL5A 1MNLA 2CH9A 1NB5I 1GD4A 1STFI 5LC7A 3QRDA 3PYJA 5EQLA 1R4CA 4EYCA 5A0OB 5ELUA 1DVDA 4N6LA
chains in the Genus database with same CATH superfamily
5CLKA 3WOEB 3LTCA 1YVBI 3FGYA 1K8A4 2HMLB 4N6UA 2OTJ3 1O7PB 4HM1B 2CWUA 1UCIA 4IPBA 5DRVA 1PU4A 1A90A 1W6CA 5CF2A 1YIJ3 3EB8A 3KCHA 3DGOA 4TX4A 4KVHA 3FG4A 2XSOB 3IMAB 1YGEA 2GEYA 3DXOA 4N6NB 5BU4A 1A2KA 1QAKA 1ISKA 3ROBA 1Q824 2K3DA 4KFFA 3F7SA 4HZBB 2WGQA 3KZTA 5AIGA 4HOHA 1T2IA 1BANA 3MG3A 4KT3B 4N6MA 3GZBA 3AGNA 1OGXA 3OWYA 1O7HB 1GOUA 5IERA 2O9UX 2XR8B 5AYSC 1W2ZA 3CC23 1W6GA 1TFKA 2CG1A 3X3YA 2UGIA 4BIRA 4R4KA 1L5GB 2CFGA 1E97A 1SIIA 5AI1A 3MHEA 3BNDA 1SPUA 4X2HA 1KC84 3IPTA 3K0ZA 3TDGA 1N5PA 3KKGA 2UX0A 1C7HA 3ALAA 4HM2B 1KQS2 1IQXA 3V98A 4KFDA 3ER7A 4WHAA 3PGBA 1OH0A 1VZZA 2PZVA 3T8NA 2HMJB 3SEDA 2UUGC 1ROVA 3EJVA 4HBRA 3KN4A 1ROAA 2CWTA 1G0TA 3MKIA 3KSED 2CX1A 2Y74A 3MSOA 1LQGC 4K61A 4XBTA 1B2SA 1AV4A 1D6YA 1US1A 1PYLA 1W4NA 3AMOA 2H0GA 4FMDA 4RBNA 5CXOA 2GU3A 4LMIA 1UDII 1PFPA 1JZOA 1BRJA 1OHSA 1RCKA 3G8ZA 1VQ53 3SX1A 1TRPA 3SLUA 1VQO3 1IYYA 1IQYA 3PS8A 1GY5A 3ZG5A 1Q40A 3FG3A 2L4VA 2Q07A 3LH4A 1CEWI 3HIGA 4WFOA 2D42A 3AHSA 3H3HA 3UJMA 1B27A 1ULJB 3SVAA 5IG4A 3HX8A 4PEJA 1M9GA 1BSEA 1IDPA 9RNTA 3S28A 4WYKB 5IENA 5EVHA 1TFOA 3G6E3 1OHPA 3HZPA 1SIHA 3S67A 3EBYA 3X3ZA 4LYLB 1MNLA 1S5AA 1TJDA 4FCJA 2CFKA 2FNQA 3D3LA 1EEJA 2CK3H 2HMKB 3FZWA 1OPYA 3FF2A 3EE1A 2GU1A 1V57A 4HVNA 3SXXA 1VQ93 5AEWB 3PCRA 2C11A 1STFI 1JKGA 2RNTA 3D4AA 3WA2X 1HZ1A 4AKYA 3KSPA 2WOFA 3PYJA 1B3SA 3JUOA 4XDWA 4O3VA 1R4CA 1OCVA 2H0IA 1BU4A 3F8XA 3CCV3 3RGAA 4HM7B 4L7KA 5A0OB 3K63A 1QALA 3FCSB 1TRQA 4Q53A 1O7NB 3FG1A 1LRAA 4N6LA 4XDVA 4BL2A 1UUWB 2BNGA 2JDIH 3OX9A 1RDSA 1K28A 2KCDA 5KP1A 2XGNA 3LTAA 1Q864 4IIAA 3STDA 1IT7A 1JJ22 4HM3B 3ECFA 3N9HA 1CYUA 1EQKA 1STDA 2OCTA 1BAOA 3ZG0A 4EXRA 3KE7A 1N9EA 1NB3I 2Z6BA 3FLJA 3NHXA 1E3RA 1W00A 1B2ZA 3BIRA 3RGRA 4H61A 2BMOB 1SARA 1CYVA 1GMPA 3CPOA 1RN4A 1GSPA 1NNVA 1RGCA 2ZL8A 5CF1A 2BIRA 4N3VA 1UI8A 2KRTA 1ZGXA 3I563 1I0VA 5HOHA 1O7GB 2W0QA 4FMBA 4XM4A 3BLZA 1VQN3 3LZAA 3DGLA 4CJNA 1TU5A 3GSPA 4HM6B 1MGWA 8CHOA 5IF6A 3CCL3 2FXTA 1EG9B 3D5IA 1UW1A 2WGOA 1F8NA 4RNZA 3NV0A 4OK0A 1PY3A 1VQM3 1BVIA 1IVXA 2L1SA 4L8PA 3F14A 4KZ1A 4LGQA 4ILFA 4IT7A 2ZHXB 3F40A 4L8OA 4RZMA 2YX9A 2W56A 1W2B2 2CFWA 1M1XB 1JBSA 3MG1A 2QGUA 3E99A 1BNFA 3DMCA 3D9RA 3PCSA 1MWSA 3GZRA 1I70A 2J8XB 2BMRB 5EEOA 3NBBA 3F8HA 3RNTA 1G96A 1WNHA 1X1XA 3HOHA 2XH9A 2GBXB 1DETA 3A5EA 3MPHA 4GSPA 3VSYA 1FUTA 5FW5A 1O7MB 1GY6A 1UGIA 3CCU3 2GSPA 1HU9A 3B4PA 3CD63 4MJDA 3MG2A 1QMAA 4G1MB 2Z7AA 3D5GA 1VQQA 2CX0A 2XGLA 1BRIA 2LQVA 3DUKA 1YGWA 5AYRB 2RCDA 1DYUA 4HYZA 3GZYB 4LZIA 2BHMA 4QWTA 1JRQA 2SARA 3BNCA 1W7CA 1TIJA 3N54B 1VQ63 2W9QA 1DMNA 3BNBA 3CCQ3 3LXUX 1OHOA 3NX0A 4EBGA 3CC73 1JN5A 3LTDA 1WTHA 1I2FA 3B7CA 1Q42A 3JUQA 4HM4B 5AEUB 5D83A 1JB5A 2LYXA 1DMQA 1RTUA 1LXEA 1SQWA 3PZWA 4RNTA 2W9PA 5KP4A 4FMAA 1GYBA 3AMOB 5M18A 1W02A 5ELJA 4CCVA 1N5HA 1GD3A 2R4IA 3G16A 5TGNA 3DGNA 3JVCA 2RFRA 3Q90A 4U13A 1RNBA 1B2UA 1T5YA 5M1AA 1NB5I 3EBTA 3NUVA 4XB5A 1IVVA 1Q40B 1JNQA 4O2HA 1WMOA 4I5QA 2IA7A 4WWUC 5LC7A 3CCM3 2GBWB 2MC8A 2P0MA 5JPUA 1BRNL 3K7CA 1HYFA 4XBYA 4OVMA 3FF0A 2OQEA 1DVDA 4FMCA 4HAAA 2OQEC 1ZX2A 1U8CB 1TTOA 3BU4A 3EX9A 3B4OA 3CCJ3 3CCS3 3CNXA 1OF5A 1RGEA 2JQ5A 1MWTA 3DGMA 2IY2A 3SOYA 2IMJA 2YFLB 1RGLA 1BRGA 3CME3 1X1WA 3FKAA 1RJOA 3Q3FA 1B21A 2BMQB 3DZLA 4I4KA 1EUIC 1Q9EA 1JKGB 1SJWA 3LMLA 3WOFB 4HKVB 3NBRA 4NPBA 4EW5A 2STDA 1AVKA 3K5TA 2W2CA 4AEQA 5IG3A 1C54A 1RMSA 3OW22 1BUJA 2ZDJA 1FA3A 1B2XA 1OACA 3KFQC 1FGQA 3WA3A 2QA43 3L0RA 4ORLA 5JPPA 1RGFA 1T3BA 1RNTA 3D79A 4JF8A 2MF7A 3OWUA 1W01A 1QVF2 2BO9B 4N6TA 4XBXA 1UCLA 1A2VA 1GOYA 1I3FA 2Z76A 2Z77A 3U97A 3EN1B 4STDA 3Q2PA 1GS3A 4R9KA 5IG0A 3X3XA 1EKMA 2B1XB 2RSXA 1T2HA 2C4BA 2KAAA 3WHOA 2SBLA 3GZXB 5D82A 1FYSA 4BU4A 1N9JA 5BVBA 1QAFA 1R4YA 2P38A 2XFSA 3V92A 4O8SA 3LT8A 3MYTA 4O02B 4DKIA 1VQ83 1Q7HA 4MMYB 1BSDA 3NQZA 4K90B 1JB4A 4BL3A 1IV7A 1RKYA 4HM8B 5AIHA 5D81A 1VQP3 1FGTA 2KXGA 2F56A 2M7OA 1BOXA 2CKFB 5G1KA 3N8BA 4GHOA 6RNTA 1BRKA 3WODG 6GSPA 3NM7A 3CC43 1BGSA 4K1UA 5FGOA 3NXJA 5I97A 2CIUA 1JBTA 2E2TA 3NV0B 4HJLB 4K1VA 4BTXA 3CMA3 1I8VA 3X42A 1BRHA 1J2BA 1GY7A 2W56B 1TP6A 5G1LA 1ASKA 3X40A 1BRSA 1NWWA 4FCMA 2V1LA 3SOAA 1VQ43 1UI7A 1GMRA 3DGYA 5STDA 4BTWA 2CG0A 2INXA 2IYJA 2HMMB 1BSAA 2Y73A 1BNEA 1IT8A 2RBIA 1RGAA 1RGHA 4R1KA 4RNYA 5G2GA 1K9M4 1A67A 4J9AA 3RDEA 1QVG2 2F99A 3VF1A 2P0XA 2R41A 4HM5B 2K54A 3GAXA 4MMZB 1RN7A 1VQL3 1ZS7A 1WQLB 5DREA 3WDGB 1NO3A 3T0UA 2W6JH 1UUGB 1IVWA 7RNTA 4JRFA 3M8CA 5IG5A 4FR9A 3WR2A 1DMMA 8RNTA 4OUQA 4R80A 3DM8A 3UL5A 3URPA 1FGOA 2AAEA 4GL6A 1K41A 4GB5A 2BT3A 2F5MA 1YJN3 4MMXB 6STDA 1GD4A 1NDOB 5HGRA 1YJW3 1X1UA 2BU4A 1JN5B 1GMQA 1RN1A 3QRDA 2XF3A 1AR0A 1UUVB 2XEPA 3H51A 2IUJA 2O3OA 1LQMB 3JUMA 3A76A 2F4YA 1LOYA 2D1WA 1MGRA 5ELUA 1YI23 3S5CA 3F9SA 1JZDA 3OXAA 1BSBA 4FCZA 5BXQA 2CFLA 1W6YA 1Q7Y4 2RGQA 5M19A 1BUQA 1NJI4 1V58A 3QK9A 2K0MA 3I0YA 3PXMA 1M904 1BNSA 4LSOA 1EA2A 1FUSA 4BTYA 3LOYA 1E3VA 4EV5A 1N8R4 3NBJA 1X1YA 1AY7A 2ZA4A 3AGOA 5CK6A 4MEIA 1KWIA 3KIIA 1FUWA 2OOVA 3S27A 1YHQ3 1RGGA 2OOVC 3BNEA 3NM2A 3UL6A 2CFDA 2CWVA 1KD14 5IEPA 1DE3A 4CDLA 2PNCA 3F7XA 3AHWA 1O7WB 2W04A 1DVCA 1AQZA 2HMNB 3G0KA 1BIRA 3HIIA 3LT9A 4NREA 4EV2A 1OF5B 2CC3A 1WMPA 1RHLA 3LTBA 1IK3A 1K734 1BNJA 1W5ZA 3WMDA 4CPKA 1I3IA 3CXC2 1HKXA 5AIFA 3MWZA 2HMOB 1OGZA 4ZM8A 4LEHA 4N6OB 1LNIA 1A2PA 1V74A 3FH1A 3VGNA 1GOVA 3B8LA 1ZO2A 3UNLA 1RLSA 1LOXA 1JB2A 1MOLA 1D6ZA 3V99A 1MWRA 2ML5A 3HK4A 1Q814 7STDA 3GWRA 5KP3A 2AADA 5LC6A 4J5GA 1VQK3 2E2UA 1LVNA 1IV9A 3O8YA 5GSPA 4NHFA 1Z1SA 1LNHA 2WO0A 3HI7A 4KFEA 1OUNA 2KF4A 2F98A 2XSHB 1IQ8A 1BNRA 3I553 1RSNA 2I9WA 3SYUA 1UCJA 1BSCA 2FGTA 3CPW2 4R9LA 2P09A 7GSPA 5BIRA 3J7Yd 1IU7A 4HZ9B 1UGHI 2GXFA 3EHCA 4N6V0 4WYKA 1Y4KA 1RGKA 3G713 1B2MA 3EC9A 2W03A 3OV4A 1FW7A 1LOWA 5AIIA 3FSDA 3K9MC 2WOHA 3G4S3 1M1K4 1D6UA 1N8QA 1B20A 2YFJB 4HM0B 2C10A 3CCE3 2XFTA 4J5KA 1AVLA 1JV2B 1ULIB 2CW9A 3Q1CA 1VQ73 1NU3A 3GRDA 1RRLA 1BNIA 1G02A 2CHCA 2OTL3 5JBSA 3BB9A 2YFIB 1UCKA 3CCR3 1S723 2QEX3 3EF8A 2HOHA 2IUKA 2KF3A 1I0XA 3EQQB 5RNTA 2B24B 1QJGA 2KF5A 3ZFZA 1RCLA 3T8UA 3OWSA 1WMNA 1CQSA 1FGRA 3EN8A 5IEOA 4J8TA 3JUNA 5IW9A 3UB1A 2CH9A 1KSIA 3S29A 1U5OA 1LOVA 2H0HA 4EC6A 1YIT3 3CU3A 4X2OA 2P05A 3JUPA 3IJEB 1CH0A 3X41A 4WP5A 2GEXA 3DY5A 2F5WA 2OWPA 3LYGA 1FZUA 1MWUA 1YVSA 3NQYA 2QIYA 1JBRA 1RRHA 2A15A 2E2VA 5EQLA 4EYCA 2ML6A 1IVUA 3CNMA 4AKZA 1YJ93 1FGMA 1TUHA 3DH2A 1YNVX 4H3UA 3U1WA 2XRXB 2F86B 1I2GA 2KF6A 1I2EA 1BNGA
chains in the Genus database with same CATH topology
5CLKA 3WOEB 3LTCA 1YVBI 3FGYA 1K8A4 2HMLB 4N6UA 2OTJ3 1O7PB 4HM1B 2CWUA 4IPBA 5DRVA 1PU4A 1A90A 1W6CA 5CF2A 1YIJ3 3EB8A 3DGOA 4TX4A 4KVHA 3FG4A 2XSOB 3IMAB 1YGEA 2GEYA 3DXOA 4N6NB 1A2KA 1QAKA 1ISKA 3ROBA 1Q824 4KFFA 3F7SA 4HZBB 2WGQA 3KZTA 5AIGA 3MG3A 4N6MA 3GZBA 1OGXA 3OWYA 1O7HB 5IERA 2O9UX 2XR8B 5AYSC 1W2ZA 3CC23 1W6GA 1TFKA 2CG1A 3X3YA 4R4KA 1L5GB 2CFGA 1E97A 1SIIA 5AI1A 3MHEA 3BNDA 1SPUA 4X2HA 1KC84 3IPTA 3K0ZA 3TDGA 1N5PA 3KKGA 2UX0A 1C7HA 3ALAA 4HM2B 1KQS2 1IQXA 3V98A 4KFDA 3ER7A 4WHAA 3PGBA 1OH0A 1VZZA 2PZVA 3T8NA 2HMJB 3SEDA 1ROVA 3EJVA 4HBRA 3KN4A 1ROAA 2CWTA 3MSOA 3MKIA 3KSED 2Y74A 4K61A 4XBTA 3AMOA 1AV4A 1D6YA 1US1A 1W4NA 4FMDA 4RBNA 5CXOA 2GU3A 4LMIA 1PFPA 1OHSA 1VQ53 3G8ZA 3SX1A 3SLUA 1VQO3 1IQYA 3PS8A 1GY5A 1Q40A 3FG3A 2L4VA 2Q07A 3LH4A 1CEWI 3HIGA 4WFOA 2D42A 3UJMA 3H3HA 1ULJB 3SVAA 5IG4A 3HX8A 4PEJA 1M9GA 1IDPA 3S28A 4WYKB 5IENA 5EVHA 1TFOA 3G6E3 1OHPA 3HZPA 1SIHA 3S67A 3EBYA 3X3ZA 1MNLA 1S5AA 4FCJA 4J9AA 2CFKA 2FNQA 3D3LA 3FZWA 2CK3H 2HMKB 1OPYA 3FF2A 3EE1A 2GU1A 4HVNA 3SXXA 1VQ93 5AEWB 3PCRA 2C11A 1STFI 1JKGA 3WA2X 4AKYA 3KSPA 2WOFA 3PYJA 3JUOA 4XDWA 4O3VA 1R4CA 1OCVA 3CCV3 3F8XA 3RGAA 4HM7B 4L7KA 5A0OB 3K63A 1QALA 3FCSB 4Q53A 1O7NB 3FG1A 4N6LA 4XDVA 1UUWB 2BNGA 2JDIH 3OX9A 1K28A 2KCDA 5KP1A 2XGNA 3LTAA 1Q864 4IIAA 3STDA 1IT7A 1JJ22 4HM3B 3ECFA 3N9HA 1CYUA 1EQKA 1STDA 2OCTA 4EXRA 3KE7A 1N9EA 1NB3I 2Z6BA 3FLJA 3NHXA 1E3RA 1W00A 3RGRA 4H61A 2BMOB 1CYVA 3CPOA 2ZL8A 5CF1A 4N3VA 1UI8A 2KRTA 3I563 1O7GB 2W0QA 4FMBA 4XM4A 3BLZA 1VQN3 3LZAA 3DGLA 1TU5A 4HM6B 8CHOA 5IF6A 3CCL3 2FXTA 1EG9B 1UW1A 2WGOA 1F8NA 4RNZA 3NV0A 4OK0A 1VQM3 1IVXA 1M1K4 4L8PA 4KZ1A 4LGQA 3T0UA 4IT7A 3F40A 4RZMA 2YX9A 2W56A 1W2B2 2CFWA 1M1XB 3MG1A 2QGUA 3E99A 3DMCA 3D9RA 3PCSA 3GZRA 2BMRB 5EEOA 3NBBA 3F8HA 1G96A 1WNHA 2XH9A 2GBXB 3MPHA 3VSYA 5FW5A 1O7MB 1GY6A 3CCU3 1HU9A 3B4PA 3CD63 4MJDA 3MG2A 1QMAA 4G1MB 2Z7AA 2XGLA 2LQVA 3DUKA 5AYRB 2RCDA 1DYUA 4HYZA 3GZYB 4LZIA 2BHMA 4QWTA 1JRQA 3BNCA 1W7CA 1TIJA 3N54B 1VQ63 2W9QA 1DMNA 3BNBA 3CCQ3 3LXUX 1OHOA 3NX0A 4EBGA 3CC73 1JN5A 3LTDA 1WTHA 3B7CA 3JUQA 1Q42A 4HM4B 5AEUB 5D83A 1JB5A 2LYXA 1DMQA 1SQWA 1LXEA 3PZWA 2W9PA 5KP4A 4FMAA 1GYBA 3AMOB 1W02A 5ELJA 4CCVA 1N5HA 1GD3A 2R4IA 3G16A 5TGNA 3DGNA 3JVCA 2RFRA 3Q90A 4U13A 1T5YA 1NB5I 3EBTA 3NUVA 4XB5A 1IVVA 1Q40B 1JNQA 4O2HA 1WMOA 2IA7A 4WWUC 5LC7A 3CCM3 2GBWB 2MC8A 2P0MA 5JPUA 3K7CA 4XBYA 4OVMA 3FF0A 2OQEA 1DVDA 4FMCA 2OQEC 1ZX2A 1U8CB 3EX9A 3B4OA 3CCJ3 3CCS3 3CNXA 1OF5A 2JQ5A 3DGMA 3SOYA 2IMJA 2YFLB 3CME3 3FKAA 1RJOA 2BMQB 3DZLA 4I4KA 1SJWA 3LMLA 1JKGB 3WOFB 5JBSA 4HKVB 3NBRA 2STDA 1AVKA 3K5TA 2W2CA 4AEQA 5IG3A 3OW22 2ZDJA 1FA3A 3KFQC 1OACA 1FGQA 3WA3A 2QA43 3L0RA 4ORLA 5JPPA 4JF8A 2MF7A 3OWUA 1W01A 1QVF2 2BO9B 4N6TA 4XBXA 1A2VA 2Z77A 2Z76A 3U97A 3EN1B 4STDA 3Q2PA 1GS3A 4R9KA 5IG0A 3X3XA 1EKMA 2B1XB 2RSXA 2SBLA 3GZXB 5D82A 1N9JA 5BVBA 1QAFA 2P38A 3V92A 2XFSA 4O8SA 3LT8A 3MYTA 4O02B 1VQ83 4MMYB 3NQZA 4K90B 1JB4A 1IV7A 1RKYA 4HM8B 5AIHA 5D81A 1VQP3 1FGTA 2KXGA 2M7OA 2CKFB 3N8BA 3CC43 3WODG 3NM7A 4K1UA 5FGOA 3NXJA 5I97A 2CIUA 3CMA3 2E2TA 3NV0B 4HJLB 4K1VA 4BTXA 3X42A 1J2BA 1GY7A 2W56B 1TP6A 3X40A 1ASKA 1NWWA 4FCMA 2V1LA 3SOAA 1VQ43 1UI7A 5STDA 4BTWA 2CG0A 2INXA 2HMMB 2Y73A 1IT8A 4R1KA 4RNYA 5G2GA 1K9M4 1A67A 3RDEA 1QVG2 2F99A 3VF1A 2P0XA 4HM5B 2K54A 3GAXA 4MMZB 1RN7A 1VQL3 1WQLB 5DREA 3WDGB 1NO3A 2W6JH 1IVWA 4JRFA 3M8CA 5IG5A 4FR9A 1DMMA 4OUQA 4R80A 3DM8A 3UL5A 1FGOA 4GL6A 1K41A 4GB5A 2BT3A 1YJN3 4MMXB 6STDA 1GD4A 1NDOB 5HGRA 1YJW3 1JN5B 3QRDA 2XF3A 1AR0A 1UUVB 2XEPA 3H51A 2IUJA 2O3OA 3JUMA 3A76A 2D1WA 5ELUA 1YI23 3S5CA 3F9SA 3OXAA 5BXQA 4FCZA 2CFLA 1W6YA 1Q7Y4 2RGQA 1BUQA 1NJI4 3QK9A 2K0MA 3I0YA 3PXMA 1M904 4LSOA 1EA2A 4BTYA 3LOYA 1E3VA 4EV5A 1N8R4 3NBJA 5CK6A 4MEIA 1KWIA 3KIIA 1FUWA 2OOVA 3S27A 1YHQ3 3BNEA 2OOVC 3NM2A 3UL6A 2CFDA 2CWVA 1KD14 5IEPA 4CDLA 2PNCA 3F7XA 1O7WB 2W04A 1DVCA 2HMNB 3G0KA 3HIIA 4NREA 3LT9A 4EV2A 1OF5B 2CC3A 1WMPA 3LTBA 1IK3A 1K734 1W5ZA 3WMDA 3CXC2 1HKXA 5AIFA 3MWZA 2HMOB 1OGZA 4ZM8A 4LEHA 4N6OB 1V74A 3FH1A 3VGNA 3B8LA 1ZO2A 3UNLA 1LOXA 1JB2A 1MOLA 1D6ZA 3V99A 2ML5A 3HK4A 1Q814 7STDA 3GWRA 5KP3A 5LC6A 1VQK3 2E2UA 1LVNA 1IV9A 3O8YA 4NHFA 1Z1SA 1LNHA 2WO0A 3HI7A 4KFEA 1OUNA 2F98A 2XSHB 1IQ8A 3I553 2I9WA 2FGTA 3CPW2 4R9LA 2P09A 3J7Yd 1IU7A 4HZ9B 2GXFA 3EHCA 4N6V0 4WYKA 1Y4KA 3G713 3EC9A 2W03A 3OV4A 5AIIA 3FSDA 3K9MC 2WOHA 3G4S3 1D6UA 1N8QA 2YFJB 4HM0B 2C10A 3CCE3 2XFTA 1AVLA 1JV2B 1ULIB 2CW9A 3Q1CA 1VQ73 1NU3A 3GRDA 1RRLA 2CHCA 2OTL3 3BB9A 2YFIB 3CCR3 1S723 2QEX3 3EF8A 2IUKA 3EQQB 2B24B 1QJGA 3T8UA 3OWSA 1WMNA 1CQSA 1FGRA 3EN8A 5IEOA 4J8TA 3JUNA 5IW9A 3UB1A 2CH9A 1KSIA 3S29A 1U5OA 4EC6A 1YIT3 3CU3A 4X2OA 2P05A 3JUPA 3IJEB 3X41A 4WP5A 2GEXA 3DY5A 2OWPA 3LYGA 3NQYA 2QIYA 1RRHA 2A15A 2E2VA 5EQLA 4EYCA 2ML6A 1IVUA 3CNMA 4AKZA 1YJ93 1FGMA 1TUHA 4H3UA 3U1WA 2XRXB 2F86B 3F14A 4L8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVB I;  4N6U A;  3PXM A;  1A90 A;  1CYU A;  1EQK A;  2OCT A;  4TX4 A;  1NB3 I;  1FUW A;  1KWI A;  3IMA B;  1CYV A;  4N6N B;  3UL6 A;  1FA3 A;  3KFQ C;  3L0R A;  1DVC A;  4N6M A;  2BO9 B;  4N6T A;  2O9U X;  3MWZ A;  4ZM8 A;  4N6O B;  3Q2P A;  1MOL A;  4IT7 A;  1N9J A;  5LC6 A;  1N5P A;  1IV9 A;  1IV7 A;  1G96 A;  1WNH A;  2KXG A;  1ROA A;  3KSE D;  4N6V 0;  4LZI A;  3K9M C;  1PFP A;  1TIJ A;  2W9Q A;  3PS8 A;  1A67 A;  3NX0 A;  3LH4 A;  1CEW I;  3GAX A;  1RN7 A;  3SVA A;  1LXE A;  1M9G A;  2W9P A;  5ELJ A;  4CCV A;  1N5H A;  1GD3 A;  3S67 A;  3UL5 A;  1MNL A;  2CH9 A;  1NB5 I;  1GD4 A;  1STF I;  5LC7 A;  3QRD A;  3PYJ A;  5EQL A;  1R4C A;  4EYC A;  5A0O B;  5ELU A;  1DVD A;  4N6L A; 
#chains in the Genus database with same CATH topology
 5CLK A;  3WOE B;  3LTC A;  1YVB I;  3FGY A;  1K8A 4;  2HML B;  4N6U A;  2OTJ 3;  1O7P B;  4HM1 B;  2CWU A;  1UCI A;  4IPB A;  5DRV A;  1PU4 A;  1A90 A;  1W6C A;  5CF2 A;  1YIJ 3;  3EB8 A;  3KCH A;  3DGO A;  4TX4 A;  4KVH A;  3FG4 A;  2XSO B;  3IMA B;  1YGE A;  2GEY A;  3DXO A;  4N6N B;  5BU4 A;  1A2K A;  1QAK A;  1ISK A;  3ROB A;  1Q82 4;  2K3D A;  4KFF A;  3F7S A;  4HZB B;  2WGQ A;  3KZT A;  5AIG A;  4HOH A;  1T2I A;  1BAN A;  3MG3 A;  4KT3 B;  4N6M A;  3GZB A;  3AGN A;  1OGX A;  3OWY A;  1O7H B;  1GOU A;  5IER A;  2O9U X;  2XR8 B;  5AYS C;  1W2Z A;  3CC2 3;  1W6G A;  1TFK A;  2CG1 A;  3X3Y A;  2UGI A;  4BIR A;  4R4K A;  1L5G B;  2CFG A;  1E97 A;  1SII A;  5AI1 A;  3MHE A;  3BND A;  1SPU A;  4X2H A;  1KC8 4;  3IPT A;  3K0Z A;  3TDG A;  1N5P A;  3KKG A;  2UX0 A;  1C7H A;  3ALA A;  4HM2 B;  1KQS 2;  1IQX A;  3V98 A;  4KFD A;  3ER7 A;  4WHA A;  3PGB A;  1OH0 A;  1VZZ A;  2PZV A;  3T8N A;  2HMJ B;  3SED A;  2UUG C;  1ROV A;  3EJV A;  4HBR A;  3KN4 A;  1ROA A;  2CWT A;  1G0T A;  3MKI A;  3KSE D;  2CX1 A;  2Y74 A;  3MSO A;  1LQG C;  4K61 A;  4XBT A;  1B2S A;  1AV4 A;  1D6Y A;  1US1 A;  1PYL A;  1W4N A;  3AMO A;  2H0G A;  4FMD A;  4RBN A;  5CXO A;  2GU3 A;  4LMI A;  1UDI I;  1PFP A;  1JZO A;  1BRJ A;  1OHS A;  1RCK A;  3G8Z A;  1VQ5 3;  3SX1 A;  1TRP A;  3SLU A;  1VQO 3;  1IYY A;  1IQY A;  3PS8 A;  1GY5 A;  3ZG5 A;  1Q40 A;  3FG3 A;  2L4V A;  2Q07 A;  3LH4 A;  1CEW I;  3HIG A;  4WFO A;  2D42 A;  3AHS A;  3H3H A;  3UJM A;  1B27 A;  1ULJ B;  3SVA A;  5IG4 A;  3HX8 A;  4PEJ A;  1M9G A;  1BSE A;  1IDP A;  9RNT A;  3S28 A;  4WYK B;  5IEN A;  5EVH A;  1TFO A;  3G6E 3;  1OHP A;  3HZP A;  1SIH A;  3S67 A;  3EBY A;  3X3Z A;  4LYL B;  1MNL A;  1S5A A;  1TJD A;  4FCJ A;  2CFK A;  2FNQ A;  3D3L A;  1EEJ A;  2CK3 H;  2HMK B;  3FZW A;  1OPY A;  3FF2 A;  3EE1 A;  2GU1 A;  1V57 A;  4HVN A;  3SXX A;  1VQ9 3;  5AEW B;  3PCR A;  2C11 A;  1STF I;  1JKG A;  2RNT A;  3D4A A;  3WA2 X;  1HZ1 A;  4AKY A;  3KSP A;  2WOF A;  3PYJ A;  1B3S A;  3JUO A;  4XDW A;  4O3V A;  1R4C A;  1OCV A;  2H0I A;  1BU4 A;  3F8X A;  3CCV 3;  3RGA A;  4HM7 B;  4L7K A;  5A0O B;  3K63 A;  1QAL A;  3FCS B;  1TRQ A;  4Q53 A;  1O7N B;  3FG1 A;  1LRA A;  4N6L A;  4XDV A;  4BL2 A;  1UUW B;  2BNG A;  2JDI H;  3OX9 A;  1RDS A;  1K28 A;  2KCD A;  5KP1 A;  2XGN A;  3LTA A;  1Q86 4;  4IIA A;  3STD A;  1IT7 A;  1JJ2 2;  4HM3 B;  3ECF A;  3N9H A;  1CYU A;  1EQK A;  1STD A;  2OCT A;  1BAO A;  3ZG0 A;  4EXR A;  3KE7 A;  1N9E A;  1NB3 I;  2Z6B A;  3FLJ A;  3NHX A;  1E3R A;  1W00 A;  1B2Z A;  3BIR A;  3RGR A;  4H61 A;  2BMO B;  1SAR A;  1CYV A;  1GMP A;  3CPO A;  1RN4 A;  1GSP A;  1NNV A;  1RGC A;  2ZL8 A;  5CF1 A;  2BIR A;  4N3V A;  1UI8 A;  2KRT A;  1ZGX A;  3I56 3;  1I0V A;  5HOH A;  1O7G B;  2W0Q A;  4FMB A;  4XM4 A;  3BLZ A;  1VQN 3;  3LZA A;  3DGL A;  4CJN A;  1TU5 A;  3GSP A;  4HM6 B;  1MGW A;  8CHO A;  5IF6 A;  3CCL 3;  2FXT A;  1EG9 B;  3D5I A;  1UW1 A;  2WGO A;  1F8N A;  4RNZ A;  3NV0 A;  4OK0 A;  1PY3 A;  1VQM 3;  1BVI A;  1IVX A;  2L1S A;  4L8P A;  3F14 A;  4KZ1 A;  4LGQ A;  4ILF A;  4IT7 A;  2ZHX B;  3F40 A;  4L8O A;  4RZM A;  2YX9 A;  2W56 A;  1W2B 2;  2CFW A;  1M1X B;  1JBS A;  3MG1 A;  2QGU A;  3E99 A;  1BNF A;  3DMC A;  3D9R A;  3PCS A;  1MWS A;  3GZR A;  1I70 A;  2J8X B;  2BMR B;  5EEO A;  3NBB A;  3F8H A;  3RNT A;  1G96 A;  1WNH A;  1X1X A;  3HOH A;  2XH9 A;  2GBX B;  1DET A;  3A5E A;  3MPH A;  4GSP A;  3VSY A;  1FUT A;  5FW5 A;  1O7M B;  1GY6 A;  1UGI A;  3CCU 3;  2GSP A;  1HU9 A;  3B4P A;  3CD6 3;  4MJD A;  3MG2 A;  1QMA A;  4G1M B;  2Z7A A;  3D5G A;  1VQQ A;  2CX0 A;  2XGL A;  1BRI A;  2LQV A;  3DUK A;  1YGW A;  5AYR B;  2RCD A;  1DYU A;  4HYZ A;  3GZY B;  4LZI A;  2BHM A;  4QWT A;  1JRQ A;  2SAR A;  3BNC A;  1W7C A;  1TIJ A;  3N54 B;  1VQ6 3;  2W9Q A;  1DMN A;  3BNB A;  3CCQ 3;  3LXU X;  1OHO A;  3NX0 A;  4EBG A;  3CC7 3;  1JN5 A;  3LTD A;  1WTH A;  1I2F A;  3B7C A;  1Q42 A;  3JUQ A;  4HM4 B;  5AEU B;  5D83 A;  1JB5 A;  2LYX A;  1DMQ A;  1RTU A;  1LXE A;  1SQW A;  3PZW A;  4RNT A;  2W9P A;  5KP4 A;  4FMA A;  1GYB A;  3AMO B;  5M18 A;  1W02 A;  5ELJ A;  4CCV A;  1N5H A;  1GD3 A;  2R4I A;  3G16 A;  5TGN A;  3DGN A;  3JVC A;  2RFR A;  3Q90 A;  4U13 A;  1RNB A;  1B2U A;  1T5Y A;  5M1A A;  1NB5 I;  3EBT A;  3NUV A;  4XB5 A;  1IVV A;  1Q40 B;  1JNQ A;  4O2H A;  1WMO A;  4I5Q A;  2IA7 A;  4WWU C;  5LC7 A;  3CCM 3;  2GBW B;  2MC8 A;  2P0M A;  5JPU A;  1BRN L;  3K7C A;  1HYF A;  4XBY A;  4OVM A;  3FF0 A;  2OQE A;  1DVD A;  4FMC A;  4HAA A;  2OQE C;  1ZX2 A;  1U8C B;  1TTO A;  3BU4 A;  3EX9 A;  3B4O A;  3CCJ 3;  3CCS 3;  3CNX A;  1OF5 A;  1RGE A;  2JQ5 A;  1MWT A;  3DGM A;  2IY2 A;  3SOY A;  2IMJ A;  2YFL B;  1RGL A;  1BRG A;  3CME 3;  1X1W A;  3FKA A;  1RJO A;  3Q3F A;  1B21 A;  2BMQ B;  3DZL A;  4I4K A;  1EUI C;  1Q9E A;  1JKG B;  1SJW A;  3LML A;  3WOF B;  4HKV B;  3NBR A;  4NPB A;  4EW5 A;  2STD A;  1AVK A;  3K5T A;  2W2C A;  4AEQ A;  5IG3 A;  1C54 A;  1RMS A;  3OW2 2;  1BUJ A;  2ZDJ A;  1FA3 A;  1B2X A;  1OAC A;  3KFQ C;  1FGQ A;  3WA3 A;  2QA4 3;  3L0R A;  4ORL A;  5JPP A;  1RGF A;  1T3B A;  1RNT A;  3D79 A;  4JF8 A;  2MF7 A;  3OWU A;  1W01 A;  1QVF 2;  2BO9 B;  4N6T A;  4XBX A;  1UCL A;  1A2V A;  1GOY A;  1I3F A;  2Z76 A;  2Z77 A;  3U97 A;  3EN1 B;  4STD A;  3Q2P A;  1GS3 A;  4R9K A;  5IG0 A;  3X3X A;  1EKM A;  2B1X B;  2RSX A;  1T2H A;  2C4B A;  2KAA A;  3WHO A;  2SBL A;  3GZX B;  5D82 A;  1FYS A;  4BU4 A;  1N9J A;  5BVB A;  1QAF A;  1R4Y A;  2P38 A;  2XFS A;  3V92 A;  4O8S A;  3LT8 A;  3MYT A;  4O02 B;  4DKI A;  1VQ8 3;  1Q7H A;  4MMY B;  1BSD A;  3NQZ A;  4K90 B;  1JB4 A;  4BL3 A;  1IV7 A;  1RKY A;  4HM8 B;  5AIH A;  5D81 A;  1VQP 3;  1FGT A;  2KXG A;  2F56 A;  2M7O A;  1BOX A;  2CKF B;  5G1K A;  3N8B A;  4GHO A;  6RNT A;  1BRK A;  3WOD G;  6GSP A;  3NM7 A;  3CC4 3;  1BGS A;  4K1U A;  5FGO A;  3NXJ A;  5I97 A;  2CIU A;  1JBT A;  2E2T A;  3NV0 B;  4HJL B;  4K1V A;  4BTX A;  3CMA 3;  1I8V A;  3X42 A;  1BRH A;  1J2B A;  1GY7 A;  2W56 B;  1TP6 A;  5G1L A;  1ASK A;  3X40 A;  1BRS A;  1NWW A;  4FCM A;  2V1L A;  3SOA A;  1VQ4 3;  1UI7 A;  1GMR A;  3DGY A;  5STD A;  4BTW A;  2CG0 A;  2INX A;  2IYJ A;  2HMM B;  1BSA A;  2Y73 A;  1BNE A;  1IT8 A;  2RBI A;  1RGA A;  1RGH A;  4R1K A;  4RNY A;  5G2G A;  1K9M 4;  1A67 A;  4J9A A;  3RDE A;  1QVG 2;  2F99 A;  3VF1 A;  2P0X A;  2R41 A;  4HM5 B;  2K54 A;  3GAX A;  4MMZ B;  1RN7 A;  1VQL 3;  1ZS7 A;  1WQL B;  5DRE A;  3WDG B;  1NO3 A;  3T0U A;  2W6J H;  1UUG B;  1IVW A;  7RNT A;  4JRF A;  3M8C A;  5IG5 A;  4FR9 A;  3WR2 A;  1DMM A;  8RNT A;  4OUQ A;  4R80 A;  3DM8 A;  3UL5 A;  3URP A;  1FGO A;  2AAE A;  4GL6 A;  1K41 A;  4GB5 A;  2BT3 A;  2F5M A;  1YJN 3;  4MMX B;  6STD A;  1GD4 A;  1NDO B;  5HGR A;  1YJW 3;  1X1U A;  2BU4 A;  1JN5 B;  1GMQ A;  1RN1 A;  3QRD A;  2XF3 A;  1AR0 A;  1UUV B;  2XEP A;  3H51 A;  2IUJ A;  2O3O A;  1LQM B;  3JUM A;  3A76 A;  2F4Y A;  1LOY A;  2D1W A;  1MGR A;  5ELU A;  1YI2 3;  3S5C A;  3F9S A;  1JZD A;  3OXA A;  1BSB A;  4FCZ A;  5BXQ A;  2CFL A;  1W6Y A;  1Q7Y 4;  2RGQ A;  5M19 A;  1BUQ A;  1NJI 4;  1V58 A;  3QK9 A;  2K0M A;  3I0Y A;  3PXM A;  1M90 4;  1BNS A;  4LSO A;  1EA2 A;  1FUS A;  4BTY A;  3LOY A;  1E3V A;  4EV5 A;  1N8R 4;  3NBJ A;  1X1Y A;  1AY7 A;  2ZA4 A;  3AGO A;  5CK6 A;  4MEI A;  1KWI A;  3KII A;  1FUW A;  2OOV A;  3S27 A;  1YHQ 3;  1RGG A;  2OOV C;  3BNE A;  3NM2 A;  3UL6 A;  2CFD A;  2CWV A;  1KD1 4;  5IEP A;  1DE3 A;  4CDL A;  2PNC A;  3F7X A;  3AHW A;  1O7W B;  2W04 A;  1DVC A;  1AQZ A;  2HMN B;  3G0K A;  1BIR A;  3HII A;  3LT9 A;  4NRE A;  4EV2 A;  1OF5 B;  2CC3 A;  1WMP A;  1RHL A;  3LTB A;  1IK3 A;  1K73 4;  1BNJ A;  1W5Z A;  3WMD A;  4CPK A;  1I3I A;  3CXC 2;  1HKX A;  5AIF A;  3MWZ A;  2HMO B;  1OGZ A;  4ZM8 A;  4LEH A;  4N6O B;  1LNI A;  1A2P A;  1V74 A;  3FH1 A;  3VGN A;  1GOV A;  3B8L A;  1ZO2 A;  3UNL A;  1RLS A;  1LOX A;  1JB2 A;  1MOL A;  1D6Z A;  3V99 A;  1MWR A;  2ML5 A;  3HK4 A;  1Q81 4;  7STD A;  3GWR A;  5KP3 A;  2AAD A;  5LC6 A;  4J5G A;  1VQK 3;  2E2U A;  1LVN A;  1IV9 A;  3O8Y A;  5GSP A;  4NHF A;  1Z1S A;  1LNH A;  2WO0 A;  3HI7 A;  4KFE A;  1OUN A;  2KF4 A;  2F98 A;  2XSH B;  1IQ8 A;  1BNR A;  3I55 3;  1RSN A;  2I9W A;  3SYU A;  1UCJ A;  1BSC A;  2FGT A;  3CPW 2;  4R9L A;  2P09 A;  7GSP A;  5BIR A;  3J7Y d;  1IU7 A;  4HZ9 B;  1UGH I;  2GXF A;  3EHC A;  4N6V 0;  4WYK A;  1Y4K A;  1RGK A;  3G71 3;  1B2M A;  3EC9 A;  2W03 A;  3OV4 A;  1FW7 A;  1LOW A;  5AII A;  3FSD A;  3K9M C;  2WOH A;  3G4S 3;  1M1K 4;  1D6U A;  1N8Q A;  1B20 A;  2YFJ B;  4HM0 B;  2C10 A;  3CCE 3;  2XFT A;  4J5K A;  1AVL A;  1JV2 B;  1ULI B;  2CW9 A;  3Q1C A;  1VQ7 3;  1NU3 A;  3GRD A;  1RRL A;  1BNI A;  1G02 A;  2CHC A;  2OTL 3;  5JBS A;  3BB9 A;  2YFI B;  1UCK A;  3CCR 3;  1S72 3;  2QEX 3;  3EF8 A;  2HOH A;  2IUK A;  2KF3 A;  1I0X A;  3EQQ B;  5RNT A;  2B24 B;  1QJG A;  2KF5 A;  3ZFZ A;  1RCL A;  3T8U A;  3OWS A;  1WMN A;  1CQS A;  1FGR A;  3EN8 A;  5IEO A;  4J8T A;  3JUN A;  5IW9 A;  3UB1 A;  2CH9 A;  1KSI A;  3S29 A;  1U5O A;  1LOV A;  2H0H A;  4EC6 A;  1YIT 3;  3CU3 A;  4X2O A;  2P05 A;  3JUP A;  3IJE B;  1CH0 A;  3X41 A;  4WP5 A;  2GEX A;  3DY5 A;  2F5W A;  2OWP A;  3LYG A;  1FZU A;  1MWU A;  1YVS A;  3NQY A;  2QIY A;  1JBR A;  1RRH A;  2A15 A;  2E2V A;  5EQL A;  4EYC A;  2ML6 A;  1IVU A;  3CNM A;  4AKZ A;  1YJ9 3;  1FGM A;  1TUH A;  3DH2 A;  1YNV X;  4H3U A;  3U1W A;  2XRX B;  2F86 B;  1I2G A;  2KF6 A;  1I2E A;  1BNG A; 
#chains in the Genus database with same CATH homology
 5CLK A;  3WOE B;  3LTC A;  1YVB I;  3FGY A;  1K8A 4;  2HML B;  4N6U A;  2OTJ 3;  1O7P B;  4HM1 B;  2CWU A;  4IPB A;  5DRV A;  1PU4 A;  1A90 A;  1W6C A;  5CF2 A;  1YIJ 3;  3EB8 A;  3DGO A;  4TX4 A;  4KVH A;  3FG4 A;  2XSO B;  3IMA B;  1YGE A;  2GEY A;  3DXO A;  4N6N B;  1A2K A;  1QAK A;  1ISK A;  3ROB A;  1Q82 4;  4KFF A;  3F7S A;  4HZB B;  2WGQ A;  3KZT A;  5AIG A;  3MG3 A;  4N6M A;  3GZB A;  1OGX A;  3OWY A;  1O7H B;  5IER A;  2O9U X;  2XR8 B;  5AYS C;  1W2Z A;  3CC2 3;  1W6G A;  1TFK A;  2CG1 A;  3X3Y A;  4R4K A;  1L5G B;  2CFG A;  1E97 A;  1SII A;  5AI1 A;  3MHE A;  3BND A;  1SPU A;  4X2H A;  1KC8 4;  3IPT A;  3K0Z A;  3TDG A;  1N5P A;  3KKG A;  2UX0 A;  1C7H A;  3ALA A;  4HM2 B;  1KQS 2;  1IQX A;  3V98 A;  4KFD A;  3ER7 A;  4WHA A;  3PGB A;  1OH0 A;  1VZZ A;  2PZV A;  3T8N A;  2HMJ B;  3SED A;  1ROV A;  3EJV A;  4HBR A;  3KN4 A;  1ROA A;  2CWT A;  3MSO A;  3MKI A;  3KSE D;  2Y74 A;  4K61 A;  4XBT A;  3AMO A;  1AV4 A;  1D6Y A;  1US1 A;  1W4N A;  4FMD A;  4RBN A;  5CXO A;  2GU3 A;  4LMI A;  1PFP A;  1OHS A;  1VQ5 3;  3G8Z A;  3SX1 A;  3SLU A;  1VQO 3;  1IQY A;  3PS8 A;  1GY5 A;  1Q40 A;  3FG3 A;  2L4V A;  2Q07 A;  3LH4 A;  1CEW I;  3HIG A;  4WFO A;  2D42 A;  3UJM A;  3H3H A;  1ULJ B;  3SVA A;  5IG4 A;  3HX8 A;  4PEJ A;  1M9G A;  1IDP A;  3S28 A;  4WYK B;  5IEN A;  5EVH A;  1TFO A;  3G6E 3;  1OHP A;  3HZP A;  1SIH A;  3S67 A;  3EBY A;  3X3Z A;  1MNL A;  1S5A A;  4FCJ A;  4J9A A;  2CFK A;  2FNQ A;  3D3L A;  3FZW A;  2CK3 H;  2HMK B;  1OPY A;  3FF2 A;  3EE1 A;  2GU1 A;  4HVN A;  3SXX A;  1VQ9 3;  5AEW B;  3PCR A;  2C11 A;  1STF I;  1JKG A;  3WA2 X;  4AKY A;  3KSP A;  2WOF A;  3PYJ A;  3JUO A;  4XDW A;  4O3V A;  1R4C A;  1OCV A;  3CCV 3;  3F8X A;  3RGA A;  4HM7 B;  4L7K A;  5A0O B;  3K63 A;  1QAL A;  3FCS B;  4Q53 A;  1O7N B;  3FG1 A;  4N6L A;  4XDV A;  1UUW B;  2BNG A;  2JDI H;  3OX9 A;  1K28 A;  2KCD A;  5KP1 A;  2XGN A;  3LTA A;  1Q86 4;  4IIA A;  3STD A;  1IT7 A;  1JJ2 2;  4HM3 B;  3ECF A;  3N9H A;  1CYU A;  1EQK A;  1STD A;  2OCT A;  4EXR A;  3KE7 A;  1N9E A;  1NB3 I;  2Z6B A;  3FLJ A;  3NHX A;  1E3R A;  1W00 A;  3RGR A;  4H61 A;  2BMO B;  1CYV A;  3CPO A;  2ZL8 A;  5CF1 A;  4N3V A;  1UI8 A;  2KRT A;  3I56 3;  1O7G B;  2W0Q A;  4FMB A;  4XM4 A;  3BLZ A;  1VQN 3;  3LZA A;  3DGL A;  1TU5 A;  4HM6 B;  8CHO A;  5IF6 A;  3CCL 3;  2FXT A;  1EG9 B;  1UW1 A;  2WGO A;  1F8N A;  4RNZ A;  3NV0 A;  4OK0 A;  1VQM 3;  1IVX A;  1M1K 4;  4L8P A;  4KZ1 A;  4LGQ A;  3T0U A;  4IT7 A;  3F40 A;  4RZM A;  2YX9 A;  2W56 A;  1W2B 2;  2CFW A;  1M1X B;  3MG1 A;  2QGU A;  3E99 A;  3DMC A;  3D9R A;  3PCS A;  3GZR A;  2BMR B;  5EEO A;  3NBB A;  3F8H A;  1G96 A;  1WNH A;  2XH9 A;  2GBX B;  3MPH A;  3VSY A;  5FW5 A;  1O7M B;  1GY6 A;  3CCU 3;  1HU9 A;  3B4P A;  3CD6 3;  4MJD A;  3MG2 A;  1QMA A;  4G1M B;  2Z7A A;  2XGL A;  2LQV A;  3DUK A;  5AYR B;  2RCD A;  1DYU A;  4HYZ A;  3GZY B;  4LZI A;  2BHM A;  4QWT A;  1JRQ A;  3BNC A;  1W7C A;  1TIJ A;  3N54 B;  1VQ6 3;  2W9Q A;  1DMN A;  3BNB A;  3CCQ 3;  3LXU X;  1OHO A;  3NX0 A;  4EBG A;  3CC7 3;  1JN5 A;  3LTD A;  1WTH A;  3B7C A;  3JUQ A;  1Q42 A;  4HM4 B;  5AEU B;  5D83 A;  1JB5 A;  2LYX A;  1DMQ A;  1SQW A;  1LXE A;  3PZW A;  2W9P A;  5KP4 A;  4FMA A;  1GYB A;  3AMO B;  1W02 A;  5ELJ A;  4CCV A;  1N5H A;  1GD3 A;  2R4I A;  3G16 A;  5TGN A;  3DGN A;  3JVC A;  2RFR A;  3Q90 A;  4U13 A;  1T5Y A;  1NB5 I;  3EBT A;  3NUV A;  4XB5 A;  1IVV A;  1Q40 B;  1JNQ A;  4O2H A;  1WMO A;  2IA7 A;  4WWU C;  5LC7 A;  3CCM 3;  2GBW B;  2MC8 A;  2P0M A;  5JPU A;  3K7C A;  4XBY A;  4OVM A;  3FF0 A;  2OQE A;  1DVD A;  4FMC A;  2OQE C;  1ZX2 A;  1U8C B;  3EX9 A;  3B4O A;  3CCJ 3;  3CCS 3;  3CNX A;  1OF5 A;  2JQ5 A;  3DGM A;  3SOY A;  2IMJ A;  2YFL B;  3CME 3;  3FKA A;  1RJO A;  2BMQ B;  3DZL A;  4I4K A;  1SJW A;  3LML A;  1JKG B;  3WOF B;  5JBS A;  4HKV B;  3NBR A;  2STD A;  1AVK A;  3K5T A;  2W2C A;  4AEQ A;  5IG3 A;  3OW2 2;  2ZDJ A;  1FA3 A;  3KFQ C;  1OAC A;  1FGQ A;  3WA3 A;  2QA4 3;  3L0R A;  4ORL A;  5JPP A;  4JF8 A;  2MF7 A;  3OWU A;  1W01 A;  1QVF 2;  2BO9 B;  4N6T A;  4XBX A;  1A2V A;  2Z77 A;  2Z76 A;  3U97 A;  3EN1 B;  4STD A;  3Q2P A;  1GS3 A;  4R9K A;  5IG0 A;  3X3X A;  1EKM A;  2B1X B;  2RSX A;  2SBL A;  3GZX B;  5D82 A;  1N9J A;  5BVB A;  1QAF A;  2P38 A;  3V92 A;  2XFS A;  4O8S A;  3LT8 A;  3MYT A;  4O02 B;  1VQ8 3;  4MMY B;  3NQZ A;  4K90 B;  1JB4 A;  1IV7 A;  1RKY A;  4HM8 B;  5AIH A;  5D81 A;  1VQP 3;  1FGT A;  2KXG A;  2M7O A;  2CKF B;  3N8B A;  3CC4 3;  3WOD G;  3NM7 A;  4K1U A;  5FGO A;  3NXJ A;  5I97 A;  2CIU A;  3CMA 3;  2E2T A;  3NV0 B;  4HJL B;  4K1V A;  4BTX A;  3X42 A;  1J2B A;  1GY7 A;  2W56 B;  1TP6 A;  3X40 A;  1ASK A;  1NWW A;  4FCM A;  2V1L A;  3SOA A;  1VQ4 3;  1UI7 A;  5STD A;  4BTW A;  2CG0 A;  2INX A;  2HMM B;  2Y73 A;  1IT8 A;  4R1K A;  4RNY A;  5G2G A;  1K9M 4;  1A67 A;  3RDE A;  1QVG 2;  2F99 A;  3VF1 A;  2P0X A;  4HM5 B;  2K54 A;  3GAX A;  4MMZ B;  1RN7 A;  1VQL 3;  1WQL B;  5DRE A;  3WDG B;  1NO3 A;  2W6J H;  1IVW A;  4JRF A;  3M8C A;  5IG5 A;  4FR9 A;  1DMM A;  4OUQ A;  4R80 A;  3DM8 A;  3UL5 A;  1FGO A;  4GL6 A;  1K41 A;  4GB5 A;  2BT3 A;  1YJN 3;  4MMX B;  6STD A;  1GD4 A;  1NDO B;  5HGR A;  1YJW 3;  1JN5 B;  3QRD A;  2XF3 A;  1AR0 A;  1UUV B;  2XEP A;  3H51 A;  2IUJ A;  2O3O A;  3JUM A;  3A76 A;  2D1W A;  5ELU A;  1YI2 3;  3S5C A;  3F9S A;  3OXA A;  5BXQ A;  4FCZ A;  2CFL A;  1W6Y A;  1Q7Y 4;  2RGQ A;  1BUQ A;  1NJI 4;  3QK9 A;  2K0M A;  3I0Y A;  3PXM A;  1M90 4;  4LSO A;  1EA2 A;  4BTY A;  3LOY A;  1E3V A;  4EV5 A;  1N8R 4;  3NBJ A;  5CK6 A;  4MEI A;  1KWI A;  3KII A;  1FUW A;  2OOV A;  3S27 A;  1YHQ 3;  3BNE A;  2OOV C;  3NM2 A;  3UL6 A;  2CFD A;  2CWV A;  1KD1 4;  5IEP A;  4CDL A;  2PNC A;  3F7X A;  1O7W B;  2W04 A;  1DVC A;  2HMN B;  3G0K A;  3HII A;  4NRE A;  3LT9 A;  4EV2 A;  1OF5 B;  2CC3 A;  1WMP A;  3LTB A;  1IK3 A;  1K73 4;  1W5Z A;  3WMD A;  3CXC 2;  1HKX A;  5AIF A;  3MWZ A;  2HMO B;  1OGZ A;  4ZM8 A;  4LEH A;  4N6O B;  1V74 A;  3FH1 A;  3VGN A;  3B8L A;  1ZO2 A;  3UNL A;  1LOX A;  1JB2 A;  1MOL A;  1D6Z A;  3V99 A;  2ML5 A;  3HK4 A;  1Q81 4;  7STD A;  3GWR A;  5KP3 A;  5LC6 A;  1VQK 3;  2E2U A;  1LVN A;  1IV9 A;  3O8Y A;  4NHF A;  1Z1S A;  1LNH A;  2WO0 A;  3HI7 A;  4KFE A;  1OUN A;  2F98 A;  2XSH B;  1IQ8 A;  3I55 3;  2I9W A;  2FGT A;  3CPW 2;  4R9L A;  2P09 A;  3J7Y d;  1IU7 A;  4HZ9 B;  2GXF A;  3EHC A;  4N6V 0;  4WYK A;  1Y4K A;  3G71 3;  3EC9 A;  2W03 A;  3OV4 A;  5AII A;  3FSD A;  3K9M C;  2WOH A;  3G4S 3;  1D6U A;  1N8Q A;  2YFJ B;  4HM0 B;  2C10 A;  3CCE 3;  2XFT A;  1AVL A;  1JV2 B;  1ULI B;  2CW9 A;  3Q1C A;  1VQ7 3;  1NU3 A;  3GRD A;  1RRL A;  2CHC A;  2OTL 3;  3BB9 A;  2YFI B;  3CCR 3;  1S72 3;  2QEX 3;  3EF8 A;  2IUK A;  3EQQ B;  2B24 B;  1QJG A;  3T8U A;  3OWS A;  1WMN A;  1CQS A;  1FGR A;  3EN8 A;  5IEO A;  4J8T A;  3JUN A;  5IW9 A;  3UB1 A;  2CH9 A;  1KSI A;  3S29 A;  1U5O A;  4EC6 A;  1YIT 3;  3CU3 A;  4X2O A;  2P05 A;  3JUP A;  3IJE B;  3X41 A;  4WP5 A;  2GEX A;  3DY5 A;  2OWP A;  3LYG A;  3NQY A;  2QIY A;  1RRH A;  2A15 A;  2E2V A;  5EQL A;  4EYC A;  2ML6 A;  1IVU A;  3CNM A;  4AKZ A;  1YJ9 3;  1FGM A;  1TUH A;  4H3U A;  3U1W A;  2XRX B;  2F86 B;  3F14 A;  4L8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...