3QRDA

Crystal structure of l68v mutant of human cystatin c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-C
publication title Crystal structure of L68V mutant of human cystatin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 18
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3qrdA00
3LH4A 2KXGA 1GD4A 1MOLA 2OCTA 4N6OB 3L0RA 1CYUA 1TIJA 4LZIA 4N6MA 3NX0A 5A0OB 3QRDA 1NB3I 1IV9A 3Q2PA 1R4CA 1WNHA 2BO9B 3UL6A 1CEWI 4N6TA 1IV7A 1EQKA 4N6UA 1RN7A 1FA3A 1G96A 2CH9A 1N9JA 3PS8A 1MNLA 4N6LA 1M9GA 3KFQC 1DVCA 4IT7A 3UL5A 1FUWA 5EQLA 5LC7A 1PFPA 1N5PA 3SVAA 2W9QA 5ELUA 4N6V0 1STFI 3S67A 1GD3A 2O9UX 3IMAB 3KSED 1KWIA 1DVDA 1A67A 4N6NB 3GAXA 1LXEA 3PXMA 3MWZA 1YVBI 5LC6A 1CYVA 4EYCA 4ZM8A 2W9PA 3K9MC 1N5HA 5ELJA 1ROAA 4CCVA 4TX4A 1NB5I 3PYJA 1A90A
chains in the Genus database with same CATH superfamily
8RNTA 3CCL3 1RMSA 1BU4A 4J5GA 1VQ53 3FZWA 3GWRA 2E2UA 1Q7HA 3I553 3SXXA 2OCTA 4XBYA 4HM2B 1BOXA 4N3VA 1QVG2 3DM8A 2STDA 3T0UA 3A5EA 3HK4A 4KFDA 1JB2A 3EBYA 3PZWA 3CCV3 1E3RA 1GMPA 1WMNA 1I0XA 1AV4A 2XH9A 1Q7Y4 4IIAA 4MJDA 2RNTA 3KZTA 4J9AA 4KVHA 2QGUA 2MC8A 1GY7A 4X2HA 3K0ZA 3I563 1MGRA 2FGTA 4AEQA 2Z76A 1OHSA 4H3UA 1NB3I 1BRNL 1A2KA 3Q2PA 3QK9A 1OCVA 1DMNA 1OF5A 3FH1A 1TFKA 3UL6A 3S28A 2GEXA 3BNBA 3CCJ3 2F4YA 3PGBA 3H51A 4R9KA 3JVCA 3OXAA 1M904 3NUVA 4KFEA 1LQMB 2WOFA 1RDSA 1I0VA 2K3DA 4FMAA 4NREA 4N6UA 1LRAA 1T5YA 5DREA 1O7WB 3CNMA 4KZ1A 5EEOA 3MPHA 1X1UA 1JB5A 8CHOA 1ULIB 2AAEA 2W56A 3I0YA 3N8BA 3AHSA 4CPKA 1RN4A 3EHCA 1G96A 4XM4A 1GOVA 1RNBA 2GSPA 3CCR3 4AKZA 2UUGC 3S5CA 2D42A 4HM4B 1RKYA 2GXFA 1ASKA 3VF1A 3HOHA 1VQM3 2FNQA 2XGLA 3J7Yd 2IY2A 3U97A 1US1A 3LYGA 3VSYA 3OWUA 1R4YA 1G0TA 3RDEA 4WYKA 4JRFA 3KFQC 1N8R4 3UL5A 1IVXA 1X1XA 1LNHA 2R41A 4J5KA 1YIT3 1BRHA 2R4IA 1LOXA 1IT7A 2QIYA 3FG3A 4G1MB 3CMA3 3B4OA 2C11A 5EVHA 4FMDA 4O2HA 1BUJA 3EBTA 1W01A 4OVMA 1BSBA 1ZO2A 4HZBB 4EC6A 1BNSA 1RCLA 1MWRA 3NM2A 6GSPA 5ELUA 4LEHA 4EBGA 3CXC2 5BXQA 3G713 2GBXB 1FGOA 3V99A 1AVLA 2YX9A 5IEPA 1JBSA 5AYSC 1C54A 1SQWA 2HMMB 1BNEA 3WODG 1K28A 1QALA 3KSED 1TRQA 2KF6A 3CME3 3BNCA 1GS3A 9RNTA 4HBRA 1I70A 3G0KA 1FGTA 3IPTA 3AHWA 3FG1A 3SOYA 4HM1B 1BNFA 1I8VA 3NHXA 3OWSA 3UB1A 2GBWB 1YNVX 3WHOA 1HU9A 1HKXA 4HKVB 5I97A 5IG0A 1BSCA 1SARA 4XB5A 5AEWB 3LTCA 5LC6A 2CWVA 3ROBA 1VQP3 3CC43 2UGIA 3V98A 2RBIA 4LGQA 3CCE3 3LOYA 4NPBA 1BUQA 5DRVA 2INXA 1RRHA 4LMIA 1VQ43 1CYVA 3JUOA 3EN8A 4GL6A 2W9PA 1RNTA 2P05A 2RSXA 3K9MC 3MSOA 4BL2A 1ROAA 1UUWB 3KKGA 4RNYA 2CWTA 2PNCA 4RNZA 4LSOA 3RGAA 4CCVA 3LTAA 1UCIA 4HM0B 4RNTA 1E3VA 1W6YA 4FCJA 4FMCA 3CPW2 1Z1SA 1V74A 1Q864 1D6ZA 3GSPA 4RZMA 3GZRA 1DYUA 2RCDA 1RRLA 2BMQB 5TGNA 1W6CA 5AIIA 1BVIA 4N6OB 2P0XA 4XBXA 4LZIA 3WOEB 3HIGA 3OWYA 1STDA 1JN5A 2IUJA 5IG3A 3D5IA 1U8CB 3N9HA 2V1LA 2M7OA 3NX0A 1YGEA 3X3YA 1K8A4 3AGOA 2F56A 2OWPA 1IV9A 3Q90A 2BO9B 3NBRA 3FSDA 1JZDA 3EF8A 4K1UA 1S5AA 1IVVA 3BU4A 2HMJB 3G6E3 3LMLA 1CEWI 2GU3A 3AMOB 1EA2A 1IV7A 2AADA 3BNEA 2P09A 3KIIA 1IVWA 1LOVA 1VQ83 3NV0B 1KSIA 1OUNA 1OHOA 4HM8B 1RN7A 3FGYA 4HM6B 1ROVA 5AYRB 1FA3A 2HMLB 1B2SA 4MEIA 1T2HA 3F7SA 2KCDA 1JBTA 1D6UA 1U5OA 4IPBA 2HOHA 3DUKA 1RN1A 5IG4A 5BU4A 2W03A 5RNTA 1Q40A 1N9JA 3D9RA 3E99A 3GZXB 1HZ1A 4EXRA 4AKYA 7STDA 2B24B 2BIRA 1GMRA 2W0QA 4BTWA 2ZA4A 2XGNA 4XDVA 3FF0A 2Z7AA 2IA7A 3CCM3 2CKFB 1LQGC 4KFFA 1WMPA 3G8ZA 3MG2A 1QVF2 1I2EA 1Y4KA 4FR9A 3EJVA 4O02B 2ZDJA 1SIHA 1UUVB 1RSNA 1VZZA 4WWUC 2JQ5A 2XRXB 1YVSA 1KC84 1UGIA 3F9SA 1BRGA 1IQ8A 3EQQB 3GZBA 4STDA 5IERA 5JPUA 2KAAA 2IMJA 1RGLA 4BTXA 3GZYB 1W5ZA 1BNJA 3ECFA 4L8OA 3JUQA 1GOUA 1KD14 3RNTA 1GOYA 1V57A 4HM5B 4HYZA 3IJEB 3LT8A 3X3XA 2O9UX 4U13A 1IQXA 1NWWA 1M1XB 2C4BA 1KWIA 1FUSA 4X2OA 1DVDA 2WOHA 2ML5A 1Q814 1G02A 1TP6A 5AIHA 1DMMA 1OACA 3SOAA 3SYUA 2PZVA 2XFSA 1BAOA 4Q53A 2Y73A 3NQYA 4NHFA 5STDA 5BVBA 4HZ9B 2CFLA 5M18A 1UUGB 3H3HA 3HZPA 1I3IA 2HMOB 3VGNA 2CFGA 1JZOA 1T3BA 2BMOB 2CC3A 3D3LA 2YFJB 5M19A 2OTJ3 1WTHA 1RGAA 3WMDA 5G1KA 3B8LA 5BIRA 3HX8A 3EE1A 3F8XA 3NQZA 1X1YA 4EYCA 5HOHA 4ILFA 2BU4A 2CG1A 3PCRA 1JRQA 3X41A 3CD63 3N54B 2CX0A 1A2PA 4WP5A 1VQN3 4LYLB 1FYSA 4TX4A 5G1LA 1RTUA 1NB5I 1BNGA 1GSPA 1DETA 2J8XB 1UCKA 4L8PA 3WR2A 3ZFZA 1DE3A 3LH4A 3B7CA 1UGHI 1C7HA 2SBLA 4H61A 4ORLA 2CWUA 1E97A 4XBTA 5G2GA 1MOLA 1SPUA 3O8YA 4BTYA 1Q42A 4HVNA 3DGLA 5JBSA 1AQZA 1K41A 4L7KA 5AEUB 3T8NA 1PY3A 1CYUA 1TIJA 1QJGA 4N6MA 3WA3A 1JKGB 1YJ93 3CCS3 1YHQ3 1I2GA 1X1WA 4EW5A 1WQLB 1DMQA 4K61A 1RLSA 1W02A 1NNVA 2K54A 1UCLA 5IG5A 5A0OB 3DH2A 1NJI4 1IYYA 1WNHA 2OTL3 2XSOB 3DGYA 2FXTA 1SIIA 2F5MA 4R9LA 1NDOB 4CDLA 1I2FA 4CJNA 3BLZA 2F86B 5M1AA 1O7PB 3D5GA 3SX1A 4R4KA 1LOYA 6STDA 1O7NB 3U1WA 1B2MA 1NO3A 5CK6A 2QEX3 2B1XB 1GY5A 1HYFA 3CCU3 1F8NA 1FUTA 3EN1B 3DXOA 3CNXA 2XSHB 2OQEA 3D4AA 1MWTA 1AVKA 4FCMA 1RGHA 5HGRA 2CFWA 1AR0A 1EG9B 1YIJ3 4MMXB 1MNLA 1VQO3 4OUQA 4N6LA 2Z6BA 2OOVC 1OPYA 2CG0A 5AIGA 1OGZA 4IT7A 1L5GB 1QAFA 1TTOA 3PCSA 4JF8A 1FUWA 1LOWA 2Z77A 3K5TA 5IEOA 1VQL3 2RFRA 2BMRB 1W7CA 4I5QA 4MMYB 5LC7A 3UNLA 1RGKA 2D1WA 4DKIA 1JBRA 3JUNA 1MGWA 3DMCA 4GHOA 4J8TA 2BT3A 1BIRA 1BNRA 5CF1A 3TDGA 1N5PA 2HMKB 1FGQA 1EKMA 2KF4A 4QWTA 5AI1A 3SVAA 1LVNA 4I4KA 4O8SA 1STFI 3D79A 2H0IA 4O3VA 5CXOA 1Q9EA 6RNTA 1V58A 1B27A 2ML6A 3S29A 3S67A 3F14A 1FZUA 3AMOA 3IMAB 3X3ZA 3LTBA 2CW9A 3STDA 2F98A 3CPOA 1PYLA 4HM7B 2H0HA 2O3OA 3NV0A 3JUPA 3F40A 3M8CA 3G16A 3URPA 1NU3A 3GAXA 1M1K4 2P0MA 4FMBA 1A2VA 2CFDA 1CH0A 3LZAA 1BRKA 3V92A 3WDGB 3MYTA 1TFOA 1OF5B 3MWZA 3SLUA 1YVBI 4K1VA 3X42A 5AIFA 3NBJA 3NM7A 1B2UA 1YGWA 2BNGA 3NBBA 2ZL8A 5GSPA 3UJMA 3F8HA 3EC9A 5D82A 1BANA 2P38A 1EUIC 3FCSB 1D6YA 2LQVA 3CU3A 3LXUX 1KQS2 1SJWA 4K90B 3DGOA 4KT3B 2CX1A 1IQYA 5ELJA 3ZG5A 4R1KA 2W56B 3MG3A 1W2B2 3B4PA 1GYBA 3PYJA 2XF3A 1A90A 3ALAA 4MMZB 3OW22 3OX9A 1UI7A 1VQQA 2KXGA 1GD4A 1BRIA 1ZS7A 2K0MA 1IDPA 1YI23 1LNIA 1O7MB 1IU7A 2SARA 4GB5A 4WYKB 1YJW3 3L0RA 2ZHXB 3DY5A 2Q07A 3CCQ3 1OHPA 2E2TA 3RGRA 1IK3A 2LYXA 3LTDA 2WGOA 4R80A 1BNIA 1VQ93 1FGRA 3BNDA 2KRTA 1OH0A 3DGNA 1W6GA 1BSAA 1RJOA 2W04A 3JUMA 1W2ZA 3HIIA 3QRDA 3T8UA 1B20A 3FLJA 1RGGA 1MWSA 2IUKA 1B2XA 1R4CA 4WHAA 2BHMA 3DGMA 3KSPA 2KF5A 5IENA 2Y74A 3G4S3 1GY6A 1BSEA 2A15A 2XFTA 5IW9A 2C10A 4N6TA 1B21A 2CIUA 3KN4A 2CK3H 1EQKA 2L4VA 1AY7A 3BIRA 1TJDA 3K63A 4PEJA 4HM3B 1JB4A 1ULJB 5FGOA 4HJLB 1K9M4 3DZLA 3HI7A 1B3SA 1RGEA 1W4NA 2XEPA 1RGCA 3FF2A 3WOFB 3SEDA 3ZG0A 1VQK3 2XR8B 1EEJA 2CH9A 1UCJA 5KP1A 3AGNA 4RBNA 1ZGXA 3FKAA 3PS8A 4GSPA 5FW5A 1ZX2A 1VQ63 2WO0A 1IVUA 1M9GA 1UI8A 1JNQA 4BIRA 1DVCA 1QMAA 5EQLA 3OV4A 1Q824 1OGXA 4EV5A 2F99A 3KE7A 3BB9A 1JKGA 3K7CA 1PU4A 1FW7A 1J2BA 1PFPA 1VQ73 2H0GA 5CF2A 4BU4A 5KP4A 2W2CA 3CC23 2F5WA 3KCHA 1BGSA 2MF7A 4WFOA 1RHLA 1WMOA 4XDWA 4BL3A 3GRDA 1TU5A 2YFIB 1IT8A 2W9QA 2UX0A 1BRJA 4HAAA 4N6V0 4HOHA 2CFKA 5KP3A 1S723 5JPPA 1O7HB 4FCZA 1GD3A 1RGFA 2GEYA 2GU1A 3NXJA 3CC73 2YFLB 5D81A 1JN5B 7RNTA 3MHEA 2IYJA 5IF6A 1A67A 1TRPA 1RCKA 3WA2X 4N6NB 1GMQA 4OK0A 3FG4A 3MG1A 4EV2A 1LXEA 1K734 1W00A 3PXMA 1UW1A 2HMNB 2OQEC 2QA43 1TUHA 1JJ22 1I3FA 1QAKA 3ER7A 1JV2B 3EB8A 3Q3FA 2OOVA 1N9EA 1CQSA 2I9WA 7GSPA 2CHCA 3S27A 5CLKA 4ZM8A 3X40A 1N5HA 1B2ZA 5D83A 1BSDA 3Q1CA 1BRSA 1O7GB 2L1SA 1ISKA 3A76A 1N8QA 2W6JH 1FGMA 1MWUA 2WGQA 2KF3A 2RGQA 3LT9A 1UDII 3MKIA 3EX9A 1Q40B 3F7XA 2E2VA 1YJN3 1T2IA 2JDIH
chains in the Genus database with same CATH topology
3CCL3 1VQ53 3FZWA 3GWRA 2E2UA 3I553 3SXXA 2OCTA 4XBYA 4HM2B 4N3VA 1QVG2 3DM8A 2STDA 3T0UA 3HK4A 4KFDA 1JB2A 3EBYA 3PZWA 3CCV3 1E3RA 1WMNA 1AV4A 2XH9A 1Q7Y4 4IIAA 4MJDA 2MC8A 3KZTA 4J9AA 4KVHA 2QGUA 1GY7A 4X2HA 3K0ZA 3I563 2FGTA 4AEQA 2Z76A 1OHSA 4H3UA 1NB3I 1A2KA 3Q2PA 3QK9A 1OCVA 1DMNA 1OF5A 3FH1A 1TFKA 3UL6A 3S28A 2GEXA 3BNBA 3CCJ3 3PGBA 3H51A 4R9KA 3JVCA 3OXAA 1M904 3NUVA 4KFEA 2WOFA 4FMAA 4NREA 4N6UA 1T5YA 5DREA 1O7WB 3CNMA 4KZ1A 5EEOA 3MPHA 1JB5A 8CHOA 1ULIB 2W56A 3I0YA 3N8BA 3EHCA 1G96A 4XM4A 3CCR3 4AKZA 3S5CA 1RKYA 2D42A 4HM4B 2GXFA 1ASKA 3VF1A 1VQM3 2FNQA 2XGLA 3J7Yd 3U97A 1US1A 3LYGA 3VSYA 3OWUA 3RDEA 4WYKA 4JRFA 3KFQC 1N8R4 3UL5A 1IVXA 1LNHA 1YIT3 2R4IA 3FG3A 1LOXA 1IT7A 2QIYA 4G1MB 3CMA3 3B4OA 2C11A 5EVHA 4FMDA 4O2HA 3EBTA 1W01A 4OVMA 4EC6A 1ZO2A 4HZBB 3NM2A 5ELUA 4LEHA 4EBGA 3CXC2 5BXQA 3G713 2GBXB 1FGOA 3V99A 1AVLA 2YX9A 5IEPA 5AYSC 1SQWA 2HMMB 3WODG 1K28A 1QALA 3KSED 3CME3 3BNCA 1GS3A 4HBRA 3G0KA 1FGTA 3IPTA 3FG1A 3SOYA 4HM1B 3NHXA 3OWSA 3UB1A 2GBWB 1HU9A 1HKXA 4HKVB 5I97A 5IG0A 5AEWB 4XB5A 3LTCA 5LC6A 2CWVA 3ROBA 1VQP3 3CC43 3V98A 4LGQA 3CCE3 3LOYA 1BUQA 5DRVA 2INXA 1RRHA 4LMIA 1VQ43 1CYVA 3JUOA 3EN8A 4GL6A 2W9PA 2P05A 2RSXA 3K9MC 3MSOA 1ROAA 1UUWB 3KKGA 4RNYA 2CWTA 2PNCA 4RNZA 4LSOA 3RGAA 4CCVA 3LTAA 4HM0B 1E3VA 1W6YA 4FCJA 4FMCA 3CPW2 1Z1SA 1V74A 1Q864 1D6ZA 4RZMA 3GZRA 1DYUA 2RCDA 1RRLA 2BMQB 5TGNA 1W6CA 5AIIA 4N6OB 2P0XA 4XBXA 4LZIA 3WOEB 3HIGA 3OWYA 1STDA 1JN5A 2IUJA 5IG3A 1U8CB 3N9HA 2V1LA 2M7OA 3NX0A 1YGEA 3X3YA 1K8A4 2OWPA 1IV9A 3Q90A 2BO9B 3NBRA 3FSDA 3EF8A 4K1UA 1S5AA 1IVVA 2HMJB 3G6E3 3LMLA 1CEWI 2GU3A 3AMOB 1EA2A 1IV7A 3BNEA 2P09A 3KIIA 1IVWA 1VQ83 3NV0B 1KSIA 1OUNA 1OHOA 4HM8B 1RN7A 3FGYA 4HM6B 1ROVA 5AYRB 1FA3A 2HMLB 4MEIA 3F7SA 2KCDA 1D6UA 1U5OA 4IPBA 3DUKA 5IG4A 2W03A 1Q40A 1N9JA 3D9RA 3E99A 3GZXB 7STDA 4EXRA 4AKYA 2B24B 2W0QA 4BTWA 2XGNA 4XDVA 3FF0A 2Z7AA 2IA7A 3CCM3 2CKFB 4KFFA 1QVF2 1WMPA 3G8ZA 3MG2A 1Y4KA 4FR9A 3EJVA 4O02B 2ZDJA 1SIHA 1UUVB 1VZZA 4WWUC 2JQ5A 2XRXB 1KC84 3F9SA 3GZBA 1IQ8A 3EQQB 4STDA 5IERA 5JPUA 2IMJA 4BTXA 3GZYB 1W5ZA 3ECFA 4L8OA 3JUQA 1KD14 4HM5B 4HYZA 3IJEB 3LT8A 3X3XA 2O9UX 4U13A 1IQXA 1NWWA 1M1XB 1KWIA 4X2OA 1DVDA 2WOHA 2ML5A 1Q814 1TP6A 5AIHA 1DMMA 1OACA 3SOAA 2PZVA 2XFSA 4Q53A 2Y73A 3NQYA 4NHFA 5STDA 5BVBA 4HZ9B 2CFLA 3H3HA 3HZPA 2HMOB 3VGNA 2CFGA 2BMOB 2CC3A 3D3LA 2YFJB 2OTJ3 1WTHA 3WMDA 3B8LA 3HX8A 3EE1A 3F8XA 3NQZA 4EYCA 2CG1A 3PCRA 1JRQA 3X41A 3CD63 3N54B 4WP5A 1VQN3 1NB5I 4L8PA 3LH4A 3B7CA 5G2GA 1C7HA 2SBLA 4H61A 4ORLA 2CWUA 1E97A 4XBTA 1MOLA 1SPUA 3O8YA 4BTYA 1Q42A 4HVNA 3DGLA 5JBSA 1K41A 4L7KA 5AEUB 3T8NA 1CYUA 1TIJA 1QJGA 4N6MA 3WA3A 1JKGB 1YJ93 3CCS3 1YHQ3 1WQLB 1DMQA 4K61A 1W02A 5IG5A 2K54A 1NJI4 5A0OB 1WNHA 2OTL3 2XSOB 2FXTA 1SIIA 4R9LA 1NDOB 4CDLA 3BLZA 2F86B 1O7PB 3SX1A 4R4KA 6STDA 1O7NB 3U1WA 1NO3A 5CK6A 2QEX3 2B1XB 1GY5A 3CCU3 1F8NA 3EN1B 3DXOA 3CNXA 2XSHB 2OQEA 1AVKA 4FCMA 5HGRA 2CFWA 1AR0A 1EG9B 1YIJ3 4MMXB 1MNLA 1VQO3 4OUQA 4N6LA 2Z6BA 2OOVC 1OPYA 2CG0A 5AIGA 1OGZA 4IT7A 1L5GB 1QAFA 3PCSA 1FUWA 4JF8A 2Z77A 3K5TA 5IEOA 1VQL3 2RFRA 2BMRB 1W7CA 4MMYB 5LC7A 3UNLA 2D1WA 3JUNA 3DMCA 4J8TA 2BT3A 5CF1A 3TDGA 1N5PA 2HMKB 1FGQA 1EKMA 4QWTA 5AI1A 3SVAA 1LVNA 4I4KA 4O8SA 1STFI 5CXOA 4O3VA 2ML6A 3S29A 3S67A 3F14A 3AMOA 3IMAB 3X3ZA 3LTBA 2CW9A 3STDA 2F98A 3CPOA 4HM7B 2O3OA 3NV0A 3JUPA 3F40A 3M8CA 3G16A 1NU3A 3GAXA 1M1K4 2P0MA 4FMBA 1A2VA 2CFDA 3LZAA 3V92A 3WDGB 3MYTA 1TFOA 1OF5B 3MWZA 3SLUA 1YVBI 4K1VA 3X42A 5AIFA 3NBJA 3NM7A 2BNGA 3NBBA 3UJMA 2ZL8A 3F8HA 3EC9A 5D82A 2P38A 3FCSB 1D6YA 2LQVA 3CU3A 3LXUX 1KQS2 1SJWA 4K90B 3DGOA 1IQYA 5ELJA 4R1KA 2W56B 3MG3A 1W2B2 3B4PA 1GYBA 3PYJA 2XF3A 1A90A 3ALAA 4MMZB 3OW22 3OX9A 1UI7A 2KXGA 1GD4A 2K0MA 1IDPA 1YI23 1O7MB 1IU7A 4WYKB 4GB5A 1YJW3 3L0RA 3DY5A 2Q07A 3CCQ3 1OHPA 2E2TA 3RGRA 1IK3A 2LYXA 3LTDA 2WGOA 4R80A 1VQ93 1FGRA 3BNDA 2KRTA 1OH0A 3DGNA 1W6GA 3JUMA 1RJOA 2W04A 3T8UA 1W2ZA 3HIIA 3QRDA 3FLJA 2IUKA 4WHAA 1R4CA 2BHMA 3DGMA 3KSPA 5IENA 2Y74A 3G4S3 1GY6A 2XFTA 2A15A 5IW9A 2C10A 4N6TA 2CIUA 3KN4A 2CK3H 1EQKA 2L4VA 3K63A 4PEJA 4HM3B 1JB4A 1ULJB 5FGOA 4HJLB 1K9M4 3DZLA 3HI7A 1W4NA 2XEPA 3FF2A 3WOFB 1VQK3 3SEDA 2XR8B 2CH9A 5KP1A 4RBNA 3FKAA 3PS8A 5FW5A 1ZX2A 1VQ63 2WO0A 1IVUA 1M9GA 1UI8A 1JNQA 1DVCA 1QMAA 5EQLA 3OV4A 1Q824 1OGXA 4EV5A 2F99A 3KE7A 3BB9A 1JKGA 3K7CA 1PU4A 1J2BA 1PFPA 1VQ73 5CF2A 3CC23 5KP4A 2W2CA 4WFOA 2MF7A 1WMOA 4XDWA 3GRDA 1TU5A 2YFIB 1IT8A 2W9QA 2UX0A 4N6V0 5KP3A 2CFKA 1S723 5JPPA 1O7HB 4FCZA 1GD3A 2GEYA 2GU1A 3NXJA 3CC73 2YFLB 5D81A 1JN5B 3MHEA 5IF6A 1A67A 3WA2X 4N6NB 4OK0A 3FG4A 3MG1A 4EV2A 1LXEA 1K734 1W00A 3PXMA 1UW1A 2HMNB 2OQEC 2QA43 1TUHA 1JJ22 1QAKA 3ER7A 1JV2B 3EB8A 2OOVA 1N9EA 1CQSA 2I9WA 2CHCA 3S27A 5CLKA 4ZM8A 3X40A 1N5HA 5D83A 3Q1CA 1O7GB 1ISKA 3A76A 1N8QA 2W6JH 1FGMA 2WGQA 3LT9A 4TX4A 2RGQA 3MKIA 1YJN3 3EX9A 1Q40B 3F7XA 2E2VA 2JDIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH4 A;  2KXG A;  1GD4 A;  1MOL A;  2OCT A;  4N6O B;  3L0R A;  1CYU A;  1TIJ A;  4LZI A;  4N6M A;  3NX0 A;  5A0O B;  3QRD A;  1NB3 I;  1IV9 A;  3Q2P A;  1R4C A;  1WNH A;  2BO9 B;  3UL6 A;  1CEW I;  4N6T A;  1IV7 A;  1EQK A;  4N6U A;  1RN7 A;  1FA3 A;  1G96 A;  2CH9 A;  1N9J A;  3PS8 A;  1MNL A;  4N6L A;  1M9G A;  3KFQ C;  1DVC A;  4IT7 A;  3UL5 A;  1FUW A;  5EQL A;  5LC7 A;  1PFP A;  1N5P A;  3SVA A;  2W9Q A;  5ELU A;  4N6V 0;  1STF I;  3S67 A;  1GD3 A;  2O9U X;  3IMA B;  3KSE D;  1KWI A;  1DVD A;  1A67 A;  4N6N B;  3GAX A;  1LXE A;  3PXM A;  3MWZ A;  1YVB I;  5LC6 A;  1CYV A;  4EYC A;  4ZM8 A;  2W9P A;  3K9M C;  1N5H A;  5ELJ A;  1ROA A;  4CCV A;  4TX4 A;  1NB5 I;  3PYJ A;  1A90 A; 
#chains in the Genus database with same CATH topology
 8RNT A;  3CCL 3;  1RMS A;  1BU4 A;  4J5G A;  1VQ5 3;  3FZW A;  3GWR A;  2E2U A;  1Q7H A;  3I55 3;  3SXX A;  2OCT A;  4XBY A;  4HM2 B;  1BOX A;  4N3V A;  1QVG 2;  3DM8 A;  2STD A;  3T0U A;  3A5E A;  3HK4 A;  4KFD A;  1JB2 A;  3EBY A;  3PZW A;  3CCV 3;  1E3R A;  1GMP A;  1WMN A;  1I0X A;  1AV4 A;  2XH9 A;  1Q7Y 4;  4IIA A;  4MJD A;  2RNT A;  3KZT A;  4J9A A;  4KVH A;  2QGU A;  2MC8 A;  1GY7 A;  4X2H A;  3K0Z A;  3I56 3;  1MGR A;  2FGT A;  4AEQ A;  2Z76 A;  1OHS A;  4H3U A;  1NB3 I;  1BRN L;  1A2K A;  3Q2P A;  3QK9 A;  1OCV A;  1DMN A;  1OF5 A;  3FH1 A;  1TFK A;  3UL6 A;  3S28 A;  2GEX A;  3BNB A;  3CCJ 3;  2F4Y A;  3PGB A;  3H51 A;  4R9K A;  3JVC A;  3OXA A;  1M90 4;  3NUV A;  4KFE A;  1LQM B;  2WOF A;  1RDS A;  1I0V A;  2K3D A;  4FMA A;  4NRE A;  4N6U A;  1LRA A;  1T5Y A;  5DRE A;  1O7W B;  3CNM A;  4KZ1 A;  5EEO A;  3MPH A;  1X1U A;  1JB5 A;  8CHO A;  1ULI B;  2AAE A;  2W56 A;  3I0Y A;  3N8B A;  3AHS A;  4CPK A;  1RN4 A;  3EHC A;  1G96 A;  4XM4 A;  1GOV A;  1RNB A;  2GSP A;  3CCR 3;  4AKZ A;  2UUG C;  3S5C A;  2D42 A;  4HM4 B;  1RKY A;  2GXF A;  1ASK A;  3VF1 A;  3HOH A;  1VQM 3;  2FNQ A;  2XGL A;  3J7Y d;  2IY2 A;  3U97 A;  1US1 A;  3LYG A;  3VSY A;  3OWU A;  1R4Y A;  1G0T A;  3RDE A;  4WYK A;  4JRF A;  3KFQ C;  1N8R 4;  3UL5 A;  1IVX A;  1X1X A;  1LNH A;  2R41 A;  4J5K A;  1YIT 3;  1BRH A;  2R4I A;  1LOX A;  1IT7 A;  2QIY A;  3FG3 A;  4G1M B;  3CMA 3;  3B4O A;  2C11 A;  5EVH A;  4FMD A;  4O2H A;  1BUJ A;  3EBT A;  1W01 A;  4OVM A;  1BSB A;  1ZO2 A;  4HZB B;  4EC6 A;  1BNS A;  1RCL A;  1MWR A;  3NM2 A;  6GSP A;  5ELU A;  4LEH A;  4EBG A;  3CXC 2;  5BXQ A;  3G71 3;  2GBX B;  1FGO A;  3V99 A;  1AVL A;  2YX9 A;  5IEP A;  1JBS A;  5AYS C;  1C54 A;  1SQW A;  2HMM B;  1BNE A;  3WOD G;  1K28 A;  1QAL A;  3KSE D;  1TRQ A;  2KF6 A;  3CME 3;  3BNC A;  1GS3 A;  9RNT A;  4HBR A;  1I70 A;  3G0K A;  1FGT A;  3IPT A;  3AHW A;  3FG1 A;  3SOY A;  4HM1 B;  1BNF A;  1I8V A;  3NHX A;  3OWS A;  3UB1 A;  2GBW B;  1YNV X;  3WHO A;  1HU9 A;  1HKX A;  4HKV B;  5I97 A;  5IG0 A;  1BSC A;  1SAR A;  4XB5 A;  5AEW B;  3LTC A;  5LC6 A;  2CWV A;  3ROB A;  1VQP 3;  3CC4 3;  2UGI A;  3V98 A;  2RBI A;  4LGQ A;  3CCE 3;  3LOY A;  4NPB A;  1BUQ A;  5DRV A;  2INX A;  1RRH A;  4LMI A;  1VQ4 3;  1CYV A;  3JUO A;  3EN8 A;  4GL6 A;  2W9P A;  1RNT A;  2P05 A;  2RSX A;  3K9M C;  3MSO A;  4BL2 A;  1ROA A;  1UUW B;  3KKG A;  4RNY A;  2CWT A;  2PNC A;  4RNZ A;  4LSO A;  3RGA A;  4CCV A;  3LTA A;  1UCI A;  4HM0 B;  4RNT A;  1E3V A;  1W6Y A;  4FCJ A;  4FMC A;  3CPW 2;  1Z1S A;  1V74 A;  1Q86 4;  1D6Z A;  3GSP A;  4RZM A;  3GZR A;  1DYU A;  2RCD A;  1RRL A;  2BMQ B;  5TGN A;  1W6C A;  5AII A;  1BVI A;  4N6O B;  2P0X A;  4XBX A;  4LZI A;  3WOE B;  3HIG A;  3OWY A;  1STD A;  1JN5 A;  2IUJ A;  5IG3 A;  3D5I A;  1U8C B;  3N9H A;  2V1L A;  2M7O A;  3NX0 A;  1YGE A;  3X3Y A;  1K8A 4;  3AGO A;  2F56 A;  2OWP A;  1IV9 A;  3Q90 A;  2BO9 B;  3NBR A;  3FSD A;  1JZD A;  3EF8 A;  4K1U A;  1S5A A;  1IVV A;  3BU4 A;  2HMJ B;  3G6E 3;  3LML A;  1CEW I;  2GU3 A;  3AMO B;  1EA2 A;  1IV7 A;  2AAD A;  3BNE A;  2P09 A;  3KII A;  1IVW A;  1LOV A;  1VQ8 3;  3NV0 B;  1KSI A;  1OUN A;  1OHO A;  4HM8 B;  1RN7 A;  3FGY A;  4HM6 B;  1ROV A;  5AYR B;  1FA3 A;  2HML B;  1B2S A;  4MEI A;  1T2H A;  3F7S A;  2KCD A;  1JBT A;  1D6U A;  1U5O A;  4IPB A;  2HOH A;  3DUK A;  1RN1 A;  5IG4 A;  5BU4 A;  2W03 A;  5RNT A;  1Q40 A;  1N9J A;  3D9R A;  3E99 A;  3GZX B;  1HZ1 A;  4EXR A;  4AKY A;  7STD A;  2B24 B;  2BIR A;  1GMR A;  2W0Q A;  4BTW A;  2ZA4 A;  2XGN A;  4XDV A;  3FF0 A;  2Z7A A;  2IA7 A;  3CCM 3;  2CKF B;  1LQG C;  4KFF A;  1WMP A;  3G8Z A;  3MG2 A;  1QVF 2;  1I2E A;  1Y4K A;  4FR9 A;  3EJV A;  4O02 B;  2ZDJ A;  1SIH A;  1UUV B;  1RSN A;  1VZZ A;  4WWU C;  2JQ5 A;  2XRX B;  1YVS A;  1KC8 4;  1UGI A;  3F9S A;  1BRG A;  1IQ8 A;  3EQQ B;  3GZB A;  4STD A;  5IER A;  5JPU A;  2KAA A;  2IMJ A;  1RGL A;  4BTX A;  3GZY B;  1W5Z A;  1BNJ A;  3ECF A;  4L8O A;  3JUQ A;  1GOU A;  1KD1 4;  3RNT A;  1GOY A;  1V57 A;  4HM5 B;  4HYZ A;  3IJE B;  3LT8 A;  3X3X A;  2O9U X;  4U13 A;  1IQX A;  1NWW A;  1M1X B;  2C4B A;  1KWI A;  1FUS A;  4X2O A;  1DVD A;  2WOH A;  2ML5 A;  1Q81 4;  1G02 A;  1TP6 A;  5AIH A;  1DMM A;  1OAC A;  3SOA A;  3SYU A;  2PZV A;  2XFS A;  1BAO A;  4Q53 A;  2Y73 A;  3NQY A;  4NHF A;  5STD A;  5BVB A;  4HZ9 B;  2CFL A;  5M18 A;  1UUG B;  3H3H A;  3HZP A;  1I3I A;  2HMO B;  3VGN A;  2CFG A;  1JZO A;  1T3B A;  2BMO B;  2CC3 A;  3D3L A;  2YFJ B;  5M19 A;  2OTJ 3;  1WTH A;  1RGA A;  3WMD A;  5G1K A;  3B8L A;  5BIR A;  3HX8 A;  3EE1 A;  3F8X A;  3NQZ A;  1X1Y A;  4EYC A;  5HOH A;  4ILF A;  2BU4 A;  2CG1 A;  3PCR A;  1JRQ A;  3X41 A;  3CD6 3;  3N54 B;  2CX0 A;  1A2P A;  4WP5 A;  1VQN 3;  4LYL B;  1FYS A;  4TX4 A;  5G1L A;  1RTU A;  1NB5 I;  1BNG A;  1GSP A;  1DET A;  2J8X B;  1UCK A;  4L8P A;  3WR2 A;  3ZFZ A;  1DE3 A;  3LH4 A;  3B7C A;  1UGH I;  1C7H A;  2SBL A;  4H61 A;  4ORL A;  2CWU A;  1E97 A;  4XBT A;  5G2G A;  1MOL A;  1SPU A;  3O8Y A;  4BTY A;  1Q42 A;  4HVN A;  3DGL A;  5JBS A;  1AQZ A;  1K41 A;  4L7K A;  5AEU B;  3T8N A;  1PY3 A;  1CYU A;  1TIJ A;  1QJG A;  4N6M A;  3WA3 A;  1JKG B;  1YJ9 3;  3CCS 3;  1YHQ 3;  1I2G A;  1X1W A;  4EW5 A;  1WQL B;  1DMQ A;  4K61 A;  1RLS A;  1W02 A;  1NNV A;  2K54 A;  1UCL A;  5IG5 A;  5A0O B;  3DH2 A;  1NJI 4;  1IYY A;  1WNH A;  2OTL 3;  2XSO B;  3DGY A;  2FXT A;  1SII A;  2F5M A;  4R9L A;  1NDO B;  4CDL A;  1I2F A;  4CJN A;  3BLZ A;  2F86 B;  5M1A A;  1O7P B;  3D5G A;  3SX1 A;  4R4K A;  1LOY A;  6STD A;  1O7N B;  3U1W A;  1B2M A;  1NO3 A;  5CK6 A;  2QEX 3;  2B1X B;  1GY5 A;  1HYF A;  3CCU 3;  1F8N A;  1FUT A;  3EN1 B;  3DXO A;  3CNX A;  2XSH B;  2OQE A;  3D4A A;  1MWT A;  1AVK A;  4FCM A;  1RGH A;  5HGR A;  2CFW A;  1AR0 A;  1EG9 B;  1YIJ 3;  4MMX B;  1MNL A;  1VQO 3;  4OUQ A;  4N6L A;  2Z6B A;  2OOV C;  1OPY A;  2CG0 A;  5AIG A;  1OGZ A;  4IT7 A;  1L5G B;  1QAF A;  1TTO A;  3PCS A;  4JF8 A;  1FUW A;  1LOW A;  2Z77 A;  3K5T A;  5IEO A;  1VQL 3;  2RFR A;  2BMR B;  1W7C A;  4I5Q A;  4MMY B;  5LC7 A;  3UNL A;  1RGK A;  2D1W A;  4DKI A;  1JBR A;  3JUN A;  1MGW A;  3DMC A;  4GHO A;  4J8T A;  2BT3 A;  1BIR A;  1BNR A;  5CF1 A;  3TDG A;  1N5P A;  2HMK B;  1FGQ A;  1EKM A;  2KF4 A;  4QWT A;  5AI1 A;  3SVA A;  1LVN A;  4I4K A;  4O8S A;  1STF I;  3D79 A;  2H0I A;  4O3V A;  5CXO A;  1Q9E A;  6RNT A;  1V58 A;  1B27 A;  2ML6 A;  3S29 A;  3S67 A;  3F14 A;  1FZU A;  3AMO A;  3IMA B;  3X3Z A;  3LTB A;  2CW9 A;  3STD A;  2F98 A;  3CPO A;  1PYL A;  4HM7 B;  2H0H A;  2O3O A;  3NV0 A;  3JUP A;  3F40 A;  3M8C A;  3G16 A;  3URP A;  1NU3 A;  3GAX A;  1M1K 4;  2P0M A;  4FMB A;  1A2V A;  2CFD A;  1CH0 A;  3LZA A;  1BRK A;  3V92 A;  3WDG B;  3MYT A;  1TFO A;  1OF5 B;  3MWZ A;  3SLU A;  1YVB I;  4K1V A;  3X42 A;  5AIF A;  3NBJ A;  3NM7 A;  1B2U A;  1YGW A;  2BNG A;  3NBB A;  2ZL8 A;  5GSP A;  3UJM A;  3F8H A;  3EC9 A;  5D82 A;  1BAN A;  2P38 A;  1EUI C;  3FCS B;  1D6Y A;  2LQV A;  3CU3 A;  3LXU X;  1KQS 2;  1SJW A;  4K90 B;  3DGO A;  4KT3 B;  2CX1 A;  1IQY A;  5ELJ A;  3ZG5 A;  4R1K A;  2W56 B;  3MG3 A;  1W2B 2;  3B4P A;  1GYB A;  3PYJ A;  2XF3 A;  1A90 A;  3ALA A;  4MMZ B;  3OW2 2;  3OX9 A;  1UI7 A;  1VQQ A;  2KXG A;  1GD4 A;  1BRI A;  1ZS7 A;  2K0M A;  1IDP A;  1YI2 3;  1LNI A;  1O7M B;  1IU7 A;  2SAR A;  4GB5 A;  4WYK B;  1YJW 3;  3L0R A;  2ZHX B;  3DY5 A;  2Q07 A;  3CCQ 3;  1OHP A;  2E2T A;  3RGR A;  1IK3 A;  2LYX A;  3LTD A;  2WGO A;  4R80 A;  1BNI A;  1VQ9 3;  1FGR A;  3BND A;  2KRT A;  1OH0 A;  3DGN A;  1W6G A;  1BSA A;  1RJO A;  2W04 A;  3JUM A;  1W2Z A;  3HII A;  3QRD A;  3T8U A;  1B20 A;  3FLJ A;  1RGG A;  1MWS A;  2IUK A;  1B2X A;  1R4C A;  4WHA A;  2BHM A;  3DGM A;  3KSP A;  2KF5 A;  5IEN A;  2Y74 A;  3G4S 3;  1GY6 A;  1BSE A;  2A15 A;  2XFT A;  5IW9 A;  2C10 A;  4N6T A;  1B21 A;  2CIU A;  3KN4 A;  2CK3 H;  1EQK A;  2L4V A;  1AY7 A;  3BIR A;  1TJD A;  3K63 A;  4PEJ A;  4HM3 B;  1JB4 A;  1ULJ B;  5FGO A;  4HJL B;  1K9M 4;  3DZL A;  3HI7 A;  1B3S A;  1RGE A;  1W4N A;  2XEP A;  1RGC A;  3FF2 A;  3WOF B;  3SED A;  3ZG0 A;  1VQK 3;  2XR8 B;  1EEJ A;  2CH9 A;  1UCJ A;  5KP1 A;  3AGN A;  4RBN A;  1ZGX A;  3FKA A;  3PS8 A;  4GSP A;  5FW5 A;  1ZX2 A;  1VQ6 3;  2WO0 A;  1IVU A;  1M9G A;  1UI8 A;  1JNQ A;  4BIR A;  1DVC A;  1QMA A;  5EQL A;  3OV4 A;  1Q82 4;  1OGX A;  4EV5 A;  2F99 A;  3KE7 A;  3BB9 A;  1JKG A;  3K7C A;  1PU4 A;  1FW7 A;  1J2B A;  1PFP A;  1VQ7 3;  2H0G A;  5CF2 A;  4BU4 A;  5KP4 A;  2W2C A;  3CC2 3;  2F5W A;  3KCH A;  1BGS A;  2MF7 A;  4WFO A;  1RHL A;  1WMO A;  4XDW A;  4BL3 A;  3GRD A;  1TU5 A;  2YFI B;  1IT8 A;  2W9Q A;  2UX0 A;  1BRJ A;  4HAA A;  4N6V 0;  4HOH A;  2CFK A;  5KP3 A;  1S72 3;  5JPP A;  1O7H B;  4FCZ A;  1GD3 A;  1RGF A;  2GEY A;  2GU1 A;  3NXJ A;  3CC7 3;  2YFL B;  5D81 A;  1JN5 B;  7RNT A;  3MHE A;  2IYJ A;  5IF6 A;  1A67 A;  1TRP A;  1RCK A;  3WA2 X;  4N6N B;  1GMQ A;  4OK0 A;  3FG4 A;  3MG1 A;  4EV2 A;  1LXE A;  1K73 4;  1W00 A;  3PXM A;  1UW1 A;  2HMN B;  2OQE C;  2QA4 3;  1TUH A;  1JJ2 2;  1I3F A;  1QAK A;  3ER7 A;  1JV2 B;  3EB8 A;  3Q3F A;  2OOV A;  1N9E A;  1CQS A;  2I9W A;  7GSP A;  2CHC A;  3S27 A;  5CLK A;  4ZM8 A;  3X40 A;  1N5H A;  1B2Z A;  5D83 A;  1BSD A;  3Q1C A;  1BRS A;  1O7G B;  2L1S A;  1ISK A;  3A76 A;  1N8Q A;  2W6J H;  1FGM A;  1MWU A;  2WGQ A;  2KF3 A;  2RGQ A;  3LT9 A;  1UDI I;  3MKI A;  3EX9 A;  1Q40 B;  3F7X A;  2E2V A;  1YJN 3;  1T2I A;  2JDI H; 
#chains in the Genus database with same CATH homology
 3CCL 3;  1VQ5 3;  3FZW A;  3GWR A;  2E2U A;  3I55 3;  3SXX A;  2OCT A;  4XBY A;  4HM2 B;  4N3V A;  1QVG 2;  3DM8 A;  2STD A;  3T0U A;  3HK4 A;  4KFD A;  1JB2 A;  3EBY A;  3PZW A;  3CCV 3;  1E3R A;  1WMN A;  1AV4 A;  2XH9 A;  1Q7Y 4;  4IIA A;  4MJD A;  2MC8 A;  3KZT A;  4J9A A;  4KVH A;  2QGU A;  1GY7 A;  4X2H A;  3K0Z A;  3I56 3;  2FGT A;  4AEQ A;  2Z76 A;  1OHS A;  4H3U A;  1NB3 I;  1A2K A;  3Q2P A;  3QK9 A;  1OCV A;  1DMN A;  1OF5 A;  3FH1 A;  1TFK A;  3UL6 A;  3S28 A;  2GEX A;  3BNB A;  3CCJ 3;  3PGB A;  3H51 A;  4R9K A;  3JVC A;  3OXA A;  1M90 4;  3NUV A;  4KFE A;  2WOF A;  4FMA A;  4NRE A;  4N6U A;  1T5Y A;  5DRE A;  1O7W B;  3CNM A;  4KZ1 A;  5EEO A;  3MPH A;  1JB5 A;  8CHO A;  1ULI B;  2W56 A;  3I0Y A;  3N8B A;  3EHC A;  1G96 A;  4XM4 A;  3CCR 3;  4AKZ A;  3S5C A;  1RKY A;  2D42 A;  4HM4 B;  2GXF A;  1ASK A;  3VF1 A;  1VQM 3;  2FNQ A;  2XGL A;  3J7Y d;  3U97 A;  1US1 A;  3LYG A;  3VSY A;  3OWU A;  3RDE A;  4WYK A;  4JRF A;  3KFQ C;  1N8R 4;  3UL5 A;  1IVX A;  1LNH A;  1YIT 3;  2R4I A;  3FG3 A;  1LOX A;  1IT7 A;  2QIY A;  4G1M B;  3CMA 3;  3B4O A;  2C11 A;  5EVH A;  4FMD A;  4O2H A;  3EBT A;  1W01 A;  4OVM A;  4EC6 A;  1ZO2 A;  4HZB B;  3NM2 A;  5ELU A;  4LEH A;  4EBG A;  3CXC 2;  5BXQ A;  3G71 3;  2GBX B;  1FGO A;  3V99 A;  1AVL A;  2YX9 A;  5IEP A;  5AYS C;  1SQW A;  2HMM B;  3WOD G;  1K28 A;  1QAL A;  3KSE D;  3CME 3;  3BNC A;  1GS3 A;  4HBR A;  3G0K A;  1FGT A;  3IPT A;  3FG1 A;  3SOY A;  4HM1 B;  3NHX A;  3OWS A;  3UB1 A;  2GBW B;  1HU9 A;  1HKX A;  4HKV B;  5I97 A;  5IG0 A;  5AEW B;  4XB5 A;  3LTC A;  5LC6 A;  2CWV A;  3ROB A;  1VQP 3;  3CC4 3;  3V98 A;  4LGQ A;  3CCE 3;  3LOY A;  1BUQ A;  5DRV A;  2INX A;  1RRH A;  4LMI A;  1VQ4 3;  1CYV A;  3JUO A;  3EN8 A;  4GL6 A;  2W9P A;  2P05 A;  2RSX A;  3K9M C;  3MSO A;  1ROA A;  1UUW B;  3KKG A;  4RNY A;  2CWT A;  2PNC A;  4RNZ A;  4LSO A;  3RGA A;  4CCV A;  3LTA A;  4HM0 B;  1E3V A;  1W6Y A;  4FCJ A;  4FMC A;  3CPW 2;  1Z1S A;  1V74 A;  1Q86 4;  1D6Z A;  4RZM A;  3GZR A;  1DYU A;  2RCD A;  1RRL A;  2BMQ B;  5TGN A;  1W6C A;  5AII A;  4N6O B;  2P0X A;  4XBX A;  4LZI A;  3WOE B;  3HIG A;  3OWY A;  1STD A;  1JN5 A;  2IUJ A;  5IG3 A;  1U8C B;  3N9H A;  2V1L A;  2M7O A;  3NX0 A;  1YGE A;  3X3Y A;  1K8A 4;  2OWP A;  1IV9 A;  3Q90 A;  2BO9 B;  3NBR A;  3FSD A;  3EF8 A;  4K1U A;  1S5A A;  1IVV A;  2HMJ B;  3G6E 3;  3LML A;  1CEW I;  2GU3 A;  3AMO B;  1EA2 A;  1IV7 A;  3BNE A;  2P09 A;  3KII A;  1IVW A;  1VQ8 3;  3NV0 B;  1KSI A;  1OUN A;  1OHO A;  4HM8 B;  1RN7 A;  3FGY A;  4HM6 B;  1ROV A;  5AYR B;  1FA3 A;  2HML B;  4MEI A;  3F7S A;  2KCD A;  1D6U A;  1U5O A;  4IPB A;  3DUK A;  5IG4 A;  2W03 A;  1Q40 A;  1N9J A;  3D9R A;  3E99 A;  3GZX B;  7STD A;  4EXR A;  4AKY A;  2B24 B;  2W0Q A;  4BTW A;  2XGN A;  4XDV A;  3FF0 A;  2Z7A A;  2IA7 A;  3CCM 3;  2CKF B;  4KFF A;  1QVF 2;  1WMP A;  3G8Z A;  3MG2 A;  1Y4K A;  4FR9 A;  3EJV A;  4O02 B;  2ZDJ A;  1SIH A;  1UUV B;  1VZZ A;  4WWU C;  2JQ5 A;  2XRX B;  1KC8 4;  3F9S A;  3GZB A;  1IQ8 A;  3EQQ B;  4STD A;  5IER A;  5JPU A;  2IMJ A;  4BTX A;  3GZY B;  1W5Z A;  3ECF A;  4L8O A;  3JUQ A;  1KD1 4;  4HM5 B;  4HYZ A;  3IJE B;  3LT8 A;  3X3X A;  2O9U X;  4U13 A;  1IQX A;  1NWW A;  1M1X B;  1KWI A;  4X2O A;  1DVD A;  2WOH A;  2ML5 A;  1Q81 4;  1TP6 A;  5AIH A;  1DMM A;  1OAC A;  3SOA A;  2PZV A;  2XFS A;  4Q53 A;  2Y73 A;  3NQY A;  4NHF A;  5STD A;  5BVB A;  4HZ9 B;  2CFL A;  3H3H A;  3HZP A;  2HMO B;  3VGN A;  2CFG A;  2BMO B;  2CC3 A;  3D3L A;  2YFJ B;  2OTJ 3;  1WTH A;  3WMD A;  3B8L A;  3HX8 A;  3EE1 A;  3F8X A;  3NQZ A;  4EYC A;  2CG1 A;  3PCR A;  1JRQ A;  3X41 A;  3CD6 3;  3N54 B;  4WP5 A;  1VQN 3;  1NB5 I;  4L8P A;  3LH4 A;  3B7C A;  5G2G A;  1C7H A;  2SBL A;  4H61 A;  4ORL A;  2CWU A;  1E97 A;  4XBT A;  1MOL A;  1SPU A;  3O8Y A;  4BTY A;  1Q42 A;  4HVN A;  3DGL A;  5JBS A;  1K41 A;  4L7K A;  5AEU B;  3T8N A;  1CYU A;  1TIJ A;  1QJG A;  4N6M A;  3WA3 A;  1JKG B;  1YJ9 3;  3CCS 3;  1YHQ 3;  1WQL B;  1DMQ A;  4K61 A;  1W02 A;  5IG5 A;  2K54 A;  1NJI 4;  5A0O B;  1WNH A;  2OTL 3;  2XSO B;  2FXT A;  1SII A;  4R9L A;  1NDO B;  4CDL A;  3BLZ A;  2F86 B;  1O7P B;  3SX1 A;  4R4K A;  6STD A;  1O7N B;  3U1W A;  1NO3 A;  5CK6 A;  2QEX 3;  2B1X B;  1GY5 A;  3CCU 3;  1F8N A;  3EN1 B;  3DXO A;  3CNX A;  2XSH B;  2OQE A;  1AVK A;  4FCM A;  5HGR A;  2CFW A;  1AR0 A;  1EG9 B;  1YIJ 3;  4MMX B;  1MNL A;  1VQO 3;  4OUQ A;  4N6L A;  2Z6B A;  2OOV C;  1OPY A;  2CG0 A;  5AIG A;  1OGZ A;  4IT7 A;  1L5G B;  1QAF A;  3PCS A;  1FUW A;  4JF8 A;  2Z77 A;  3K5T A;  5IEO A;  1VQL 3;  2RFR A;  2BMR B;  1W7C A;  4MMY B;  5LC7 A;  3UNL A;  2D1W A;  3JUN A;  3DMC A;  4J8T A;  2BT3 A;  5CF1 A;  3TDG A;  1N5P A;  2HMK B;  1FGQ A;  1EKM A;  4QWT A;  5AI1 A;  3SVA A;  1LVN A;  4I4K A;  4O8S A;  1STF I;  5CXO A;  4O3V A;  2ML6 A;  3S29 A;  3S67 A;  3F14 A;  3AMO A;  3IMA B;  3X3Z A;  3LTB A;  2CW9 A;  3STD A;  2F98 A;  3CPO A;  4HM7 B;  2O3O A;  3NV0 A;  3JUP A;  3F40 A;  3M8C A;  3G16 A;  1NU3 A;  3GAX A;  1M1K 4;  2P0M A;  4FMB A;  1A2V A;  2CFD A;  3LZA A;  3V92 A;  3WDG B;  3MYT A;  1TFO A;  1OF5 B;  3MWZ A;  3SLU A;  1YVB I;  4K1V A;  3X42 A;  5AIF A;  3NBJ A;  3NM7 A;  2BNG A;  3NBB A;  3UJM A;  2ZL8 A;  3F8H A;  3EC9 A;  5D82 A;  2P38 A;  3FCS B;  1D6Y A;  2LQV A;  3CU3 A;  3LXU X;  1KQS 2;  1SJW A;  4K90 B;  3DGO A;  1IQY A;  5ELJ A;  4R1K A;  2W56 B;  3MG3 A;  1W2B 2;  3B4P A;  1GYB A;  3PYJ A;  2XF3 A;  1A90 A;  3ALA A;  4MMZ B;  3OW2 2;  3OX9 A;  1UI7 A;  2KXG A;  1GD4 A;  2K0M A;  1IDP A;  1YI2 3;  1O7M B;  1IU7 A;  4WYK B;  4GB5 A;  1YJW 3;  3L0R A;  3DY5 A;  2Q07 A;  3CCQ 3;  1OHP A;  2E2T A;  3RGR A;  1IK3 A;  2LYX A;  3LTD A;  2WGO A;  4R80 A;  1VQ9 3;  1FGR A;  3BND A;  2KRT A;  1OH0 A;  3DGN A;  1W6G A;  3JUM A;  1RJO A;  2W04 A;  3T8U A;  1W2Z A;  3HII A;  3QRD A;  3FLJ A;  2IUK A;  4WHA A;  1R4C A;  2BHM A;  3DGM A;  3KSP A;  5IEN A;  2Y74 A;  3G4S 3;  1GY6 A;  2XFT A;  2A15 A;  5IW9 A;  2C10 A;  4N6T A;  2CIU A;  3KN4 A;  2CK3 H;  1EQK A;  2L4V A;  3K63 A;  4PEJ A;  4HM3 B;  1JB4 A;  1ULJ B;  5FGO A;  4HJL B;  1K9M 4;  3DZL A;  3HI7 A;  1W4N A;  2XEP A;  3FF2 A;  3WOF B;  1VQK 3;  3SED A;  2XR8 B;  2CH9 A;  5KP1 A;  4RBN A;  3FKA A;  3PS8 A;  5FW5 A;  1ZX2 A;  1VQ6 3;  2WO0 A;  1IVU A;  1M9G A;  1UI8 A;  1JNQ A;  1DVC A;  1QMA A;  5EQL A;  3OV4 A;  1Q82 4;  1OGX A;  4EV5 A;  2F99 A;  3KE7 A;  3BB9 A;  1JKG A;  3K7C A;  1PU4 A;  1J2B A;  1PFP A;  1VQ7 3;  5CF2 A;  3CC2 3;  5KP4 A;  2W2C A;  4WFO A;  2MF7 A;  1WMO A;  4XDW A;  3GRD A;  1TU5 A;  2YFI B;  1IT8 A;  2W9Q A;  2UX0 A;  4N6V 0;  5KP3 A;  2CFK A;  1S72 3;  5JPP A;  1O7H B;  4FCZ A;  1GD3 A;  2GEY A;  2GU1 A;  3NXJ A;  3CC7 3;  2YFL B;  5D81 A;  1JN5 B;  3MHE A;  5IF6 A;  1A67 A;  3WA2 X;  4N6N B;  4OK0 A;  3FG4 A;  3MG1 A;  4EV2 A;  1LXE A;  1K73 4;  1W00 A;  3PXM A;  1UW1 A;  2HMN B;  2OQE C;  2QA4 3;  1TUH A;  1JJ2 2;  1QAK A;  3ER7 A;  1JV2 B;  3EB8 A;  2OOV A;  1N9E A;  1CQS A;  2I9W A;  2CHC A;  3S27 A;  5CLK A;  4ZM8 A;  3X40 A;  1N5H A;  5D83 A;  3Q1C A;  1O7G B;  1ISK A;  3A76 A;  1N8Q A;  2W6J H;  1FGM A;  2WGQ A;  3LT9 A;  4TX4 A;  2RGQ A;  3MKI A;  1YJN 3;  3EX9 A;  1Q40 B;  3F7X A;  2E2V A;  2JDI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...