3KE7A

Crystal structure of putative ketosteroid isomerase (yp_001303366.1) from parabacteroides distasonis atcc 8503 at 1.45 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
b'QKNMENKTLNENIPEMIISLEKEALASTDPMAFVELSDTDVIYFDPSLETKIEGLEQLRTYYKGMQLPPADHFDMIRPVVQVAQNIAVLTFNLDSYLSDKVIKWNCTEVYRRNPDNQWKIIQTHWSYVKPLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ketosteroid isomerase
publication title Crystal structure of putative ketosteroid isomerase (YP_001303366.1) from Parabacteroides distasonis ATCC 8503 at 1.45 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Isomerase
total genus 36
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ke7A00
3B4PA 5D83A 1GYBA 3ROBA 2JQ5A 2F86B 2XSHB 3MG2A 4HKVB 3GZRA 4FCJA 1W02A 1Z1SA 1E97A 3T8NA 1DMNA 3GWRA 3S5CA 3FZWA 1DMMA 5CF2A 1SJWA 3DM8A 4XDVA 3G0KA 3JUPA 8CHOA 5DREA 4PEJA 3JUOA 4FCMA 3VSYA 4J8TA 1WQLB 3ER7A 4HJLB 4K1UA 3DXOA 1NDOB 2XRXB 4HM2B 3MG3A 3MYTA 3KKGA 2HMOB 3UNLA 1TP6A 3DUKA 1E3RA 3WMDA 3UJMA 2CHCA 1ISKA 3HX8A 3EBYA 3VGNA 1GY7A 3T8UA 1ULJB 5JPPA 2BMOB 5IG5A 5CXOA 1Q42A 4XBTA 5IEOA 5FW5A 1OF5A 1DMQA 4OUQA 1GS3A 1W6YA 4K1VA 5IENA 1STDA 3MSOA 4HM4B 5KP1A 4R9KA 1O7PB 1C7HA 4WWUC 1U5OA 1CQSA 3H3HA 5AIIA 4XDWA 4IIAA 3KE7A 5IG0A 3OWYA 1ZX2A 3F9SA 5HGRA 1BUQA 1O7GB 3FKAA 2R4IA 4HVNA 5TGNA 3GZYB 5G2GA 2HMLB 1O7NB 2GEXA 1OF5B 3OWSA 4HZ9B 3NM2A 5AIGA 1NWWA 3KZTA 4LGQA 1UUWB 3NBRA 4GB5A 3I0YA 3F7XA 5IG4A 3F8HA 4J9AA 1QJGA 4OVMA 4HM7B 2RCDA 3CU3A 2UX0A 2F98A 3SOYA 3K7CA 2GEYA 5IG3A 2BMRB 4N3VA 2RFRA 3Q90A 1OHPA 5AI1A 2IMJA 6STDA 2B24B 3BB9A 2Z76A 3SOAA 3RGAA 3G16A 1O7MB 2HMMB 3B8LA 5CK6A 5KP4A 2Z7AA 3EHCA 2W2CA 5IF6A 5IERA 1EG9B 3EN8A 3FGYA 2CKFB 3CPOA 5AIHA 3F40A 5D82A 4HM3B 3NXJA 4X2OA 4U13A 3LZAA 3SEDA 2F99A 1TUHA 4HZBB 3OX9A 4HM8B 2STDA 3FSDA 5BXQA 2GBXB 4HM6B 3EC9A 5CLKA 2INXA 4CDLA 2YFLB 1IDPA 1OUNA 2QGUA 3CNXA 5CF1A 3JUNA 1ZO2A 3G8ZA 3OV4A 4R1KA 3ECFA 5D81A 2B1XB 2I9WA 3H51A 2RGQA 4XB5A 4L8OA 4LEHA 1UUVB 1EA2A 1OH0A 1S5AA 4XM4A 3RGRA 2GBWB 2GXFA 3JUMA 4HM0B 3GZXB 5AIFA 3F7SA 4L8PA 3OXAA 3FH1A 4HM1B 5EVHA 1VZZA 4Q53A 4ORLA 4WP5A 5STDA 3GZBA 1Q40A 3FLJA 3GRDA 3DZLA 3EX9A 1O7HB 1ULIB 3FF2A 1JKGA 3EQQB 4LMIA 1OGXA 3OWUA 7STDA 1JN5A 2HMKB 3NV0A 1K41A 4H3UA 1W00A 1ASKA 1JB2A 3NUVA 1AR0A 2HMNB 1GY5A 1A2KA 3EN1B 3HK4A 2YFJB 3B4OA 5IEPA 2BNGA 3M8CA 1Q40B 3MG1A 4STDA 5JPUA 4L7KA 3STDA 1JKGB 4WYKA 3EBTA 1JN5B 4R9LA 1O7WB 3F14A 3NV0B 1W01A 1E3VA 2HMJB 2OWPA 4XBYA 1NU3A 3NHXA 3EJVA 1JB5A 2XSOB 3CNMA 2PZVA 4HM5B 3JUQA 1OPYA 1HKXA 2K54A 2Z77A 4KVHA 3BLZA 2BMQB 3DMCA 3EF8A 1OGZA 3E99A 5BVBA 3K0ZA 1OCVA 4X2HA 3A76A 1OHSA 5DRVA 2YFIB 4WYKB 3MHEA 5AEUB 3D9RA 3B7CA 3LYGA 1JB4A 2A15A 4XBXA 1OHOA 2XR8B 3FF0A 3KSPA 5AEWB 2QIYA 1GY6A 3F8XA 3MKIA 3IPTA 4MJDA 5KP3A 4RZMA 1QMAA 4I4KA 3HZPA
chains in the Genus database with same CATH superfamily
2O9UX 3B4PA 5A0OB 1PFPA 5D83A 3G4S3 1ZS7A 3LMLA 3CCL3 1GYBA 1UDII 3ROBA 2JQ5A 1MWUA 2F86B 1JBSA 2W0QA 1IQYA 2XSHB 3WOFB 3LOYA 3MG2A 6GSPA 1RCKA 4HKVB 2C4BA 1X1XA 2F5MA 3GZRA 4FCJA 3UL6A 1BSDA 1W02A 2UGIA 3PCRA 5AYRB 1IK3A 1GOYA 3KFQC 2AAEA 2CWVA 1Q9EA 1VQ93 4H61A 1Z1SA 3BNDA 1RGGA 1E97A 3DH2A 1Q824 2GSPA 3SX1A 2P05A 2OQEC 3V98A 1FYSA 3T8NA 3AMOA 1DMNA 1UW1A 3GWRA 3S5CA 1Q7Y4 3FZWA 4EYCA 1DETA 3D3LA 3DGNA 1YIT3 2RNTA 1SQWA 1UCLA 1DMMA 1B2SA 1RGLA 1LRAA 5CF2A 1RDSA 1SJWA 3CCS3 3DM8A 3NM7A 2WGOA 4FR9A 4RBNA 3G0KA 4FMDA 4XDVA 3JUPA 4HBRA 8CHOA 5DREA 7RNTA 4PEJA 3JUOA 2IY2A 1I0XA 4FCMA 3G6E3 4KFFA 2KF3A 4J8TA 3NQYA 1W5ZA 3VSYA 3WOEB 1WQLB 3ER7A 3CCE3 4R80A 4MMYB 4HJLB 1UCKA 4K1UA 3DXOA 4LZIA 4N6OB 5LC7A 3A5EA 1N8R4 1NDOB 2BIRA 2OOVC 1VQ43 5ELUA 3LTBA 1LXEA 1FZUA 2XRXB 1NJI4 4HM2B 4N6LA 3MG3A 4BL2A 2E2VA 4MMZB 4OK0A 1VQO3 3MYTA 3LH4A 4MEIA 3KKGA 1RGEA 3U97A 2HMOB 3N54B 3UNLA 1TP6A 2L1SA 1HYFA 3AGOA 3MWZA 3CC73 3DUKA 1AY7A 3LT8A 1E3RA 1RN4A 3WMDA 3UJMA 3AGNA 1IV9A 2BHMA 3OW22 3AMOB 2XH9A 2CHCA 3CXC2 1ISKA 4WFOA 1T2HA 1TRPA 3NQZA 3X42A 1SARA 1V57A 1BRSA 1BRGA 1BSEA 3N9HA 3HX8A 3EBYA 4N6TA 3VGNA 2XEPA 1GY7A 4N6UA 1Q814 1M904 1YGEA 2GU1A 3T8UA 6RNTA 1J2BA 2CK3H 3HIGA 1EQKA 1ULJB 4CJNA 1FGQA 1D6UA 5AYSC 5JPPA 2BMOB 1FUSA 4HYZA 1BNSA 5IG5A 4O3VA 1K9M4 3S28A 3WR2A 1N9EA 1W4NA 1RRHA 1Q42A 5CXOA 4XBTA 2CWUA 5IEOA 1IV7A 1T2IA 2BU4A 3Q3FA 5FW5A 4HAAA 1OF5A 4FMCA 1DMQA 4OUQA 2IUKA 2C10A 1NNVA 3QK9A 1GS3A 2OCTA 1RNBA 1YHQ3 3X41A 3CD63 3UB1A 1W6YA 2L4VA 4K1VA 5IENA 3D5GA 1STDA 1MNLA 3GSPA 3MSOA 4HM4B 1VQ83 4KZ1A 5FGOA 1BUJA 5KP1A 2CFGA 1O7PB 4R9KA 2P09A 1YJ93 1B2MA 3CC43 1C7HA 2GU3A 3LTAA 4WWUC 1U5OA 4AEQA 3LTDA 1CQSA 3H3HA 3MPHA 5AIIA 4XDWA 2ZA4A 4IIAA 2KRTA 4N6MA 1YI23 3KE7A 5IG0A 3OWYA 1YVSA 1ZX2A 1MGWA 3F9SA 3KSED 4NREA 5HGRA 4EXRA 1BUQA 3URPA 1O7GB 2CX1A 1RNTA 2R4IA 3FKAA 3X3XA 4HVNA 4AKYA 2WO0A 1X1YA 2D1WA 4O2HA 5IW9A 1UCJA 1YIJ3 1IVWA 1TFOA 1RJOA 2Q07A 1B3SA 2R41A 3GZYB 5G2GA 5TGNA 1JZOA 1GOVA 1SPUA 1PU4A 2WGQA 4DKIA 1HZ1A 2E2TA 2CG1A 2HMLB 1GMRA 1VQM3 1UI7A 3BU4A 1KSIA 2Y74A 1MWRA 1O7NB 2GEXA 1OF5B 4O02B 1BNRA 3OWSA 2W6JH 4HZ9B 4IT7A 1CH0A 2P0XA 1BAOA 3DGYA 2Y73A 3NM2A 4GSPA 3UL5A 5AIGA 3FG4A 1BOXA 1NWWA 1N8QA 3KZTA 4LGQA 1UUWB 3NBRA 1BNGA 1N9JA 1OACA 1ZGXA 3F7XA 3I0YA 4GB5A 5IG4A 1MOLA 1X1UA 3AHWA 1YJW3 3BNBA 3F8HA 4J9AA 1QJGA 1AVLA 4OVMA 1BANA 4HM7B 5HOHA 3CCR3 3CCU3 1A2PA 2P0MA 2RCDA 1I8VA 4NPBA 4RNYA 3Q1CA 3CU3A 3CPW2 2UX0A 3HIIA 2F98A 1YJN3 3SOYA 2KF5A 3K7CA 3BIRA 1W6CA 2ZDJA 2GEYA 5IG3A 2BMRB 4RNZA 3D4AA 1KD14 4N3VA 1KWIA 4LYLB 2RFRA 3Q90A 2BT3A 4JRFA 4BU4A 1OHPA 5AI1A 2IMJA 3AHSA 6STDA 1B2XA 1EEJA 2B24B 5EQLA 3BB9A 2Z76A 1IQ8A 3SOAA 3QRDA 3RGAA 2ZL8A 3HOHA 1AV4A 3G16A 3J7Yd 1RMSA 1O7MB 2FXTA 1MWSA 1RGCA 2HMMB 1N5HA 1T5YA 1R4CA 1W6GA 3B8LA 5CK6A 2CFKA 1D6ZA 3SLUA 2WOFA 5KP4A 2Z7AA 3EHCA 1B2UA 2W2CA 1GOUA 5IF6A 5IERA 1ROAA 1EG9B 3D79A 3EN8A 3LTCA 1RHLA 1QVG2 1N5PA 1A2VA 2ZHXB 3FGYA 1BSAA 1TRQA 1X1WA 2CKFB 2CH9A 2P38A 2SBLA 3CPOA 5AIHA 3F40A 4LSOA 5D82A 4WHAA 1BRNL 1I2EA 2YX9A 4HM3B 3NXJA 1AVKA 4X2OA 4U13A 4K61A 3LZAA 1AQZA 1RTUA 2F99A 3SEDA 4BIRA 1TIJA 1TUHA 4HZBB 4EC6A 1RGFA 1FA3A 3OX9A 1DE3A 4HM8B 3JVCA 4IPBA 1WMNA 3K63A 2STDA 1LQMB 1NB3I 3FSDA 1LOVA 3RNTA 1A90A 5BXQA 3KN4A 4I5QA 4N6NB 2GBXB 2OQEA 1LQGC 4HM6B 2H0HA 3EC9A 5CLKA 3CCV3 2INXA 3ZFZA 1BVIA 2W9QA 4CDLA 3G713 2YFLB 1L5GB 1FGOA 4FMBA 4J5KA 5M18A 1IDPA 1QAFA 5EEOA 2H0IA 1OUNA 1JNQA 2XF3A 1K8A4 2QGUA 3RDEA 2PNCA 2XGLA 4R4KA 3SVAA 1FUWA 3CNXA 5CF1A 4CCVA 4NHFA 1Q864 2UUGC 3PYJA 4BTYA 3FG1A 1QAKA 1WMOA 2K3DA 3JUNA 1ZO2A 3CME3 3G8ZA 3OV4A 4R1KA 2OOVA 3ECFA 5D81A 1CEWI 2B1XB 3V99A 4RNTA 2J8XB 1VQ53 3I553 2I9WA 1TFKA 3HI7A 3H51A 3FCSB 1I0VA 4GL6A 2RGQA 3WA3A 4XB5A 2HOHA 1LOWA 3PZWA 1FUTA 1K734 1FW7A 2KCDA 2IA7A 2CIUA 1IVXA 4GHOA 1V74A 1VQL3 1MGRA 1GMQA 1PYLA 2CX0A 3N8BA 2BO9B 2KXGA 2IYJA 4L8OA 3ZG0A 1BNEA 2V1LA 3L0RA 1I3FA 1JJ22 1A67A 8RNTA 3FG3A 3DY5A 1RN7A 4LEHA 1UUVB 3DGOA 3GAXA 1EA2A 1OH0A 1S5AA 4XM4A 3VF1A 3RGRA 2GBWB 2GXFA 3JUMA 4HM0B 4O8SA 3GZXB 1YNVX 5AIFA 5M1AA 3F7SA 3CMA3 4JF8A 1TTOA 4L8PA 1WNHA 3OXAA 3FH1A 4FMAA 2XGNA 4HM1B 1BNFA 1Q7HA 2CFDA 2LYXA 5EVHA 1YVBI 2IUJA 1W7CA 4FCZA 1IT7A 1B21A 1VZZA 2W9PA 1VQN3 4Q53A 1M1K4 2D42A 4ORLA 3U1WA 4WP5A 1WTHA 5JBSA 4HOHA 2K0MA 3S67A 5STDA 3CCQ3 1BRIA 4K90B 3GZBA 1CYVA 1Q40A 1GMPA 3SYUA 1UCIA 3O8YA 3FLJA 1IU7A 2F56A 2H0GA 2RBIA 3DZLA 1EUIC 3GRDA 3CCM3 1IT8A 2OTJ3 1LOYA 3EX9A 1O7HB 4EV2A 4ILFA 1M9GA 1ULIB 1DYUA 2FNQA 1K28A 3FF2A 3KIIA 1BU4A 1PY3A 2W56A 3IJEB 1JKGA 3EQQB 4LMIA 1OGXA 5GSPA 2KF4A 1STFI 3OWUA 2CG0A 3PCSA 1BNJA 7STDA 4BTWA 1JZDA 4EV5A 1JN5A 2XFTA 2O3OA 2HMKB 3K5TA 1K41A 3KCHA 2KAAA 3NV0A 4H3UA 3PS8A 1R4YA 4QWTA 1JBRA 1GD4A 1G0TA 2ML6A 2XFSA 3CC23 1W00A 1BSBA 1ASKA 4AKZA 1JB2A 1C54A 2SARA 3NUVA 2E2UA 1AR0A 4BTXA 2CC3A 1RLSA 1LNIA 2CW9A 2HMNB 3WA2X 1VQK3 1RCLA 3NX0A 1GY5A 1A2KA 1RRLA 2CFWA 3EN1B 1I2FA 3HK4A 2YFJB 1VQQA 3B4OA 1RGHA 2MC8A 7GSPA 3V92A 3T0UA 5IEPA 4G1MB 1RSNA 2BNGA 1BNIA 2LQVA 3M8CA 4KT3B 2FGTA 1B2ZA 3DGMA 1Q40B 3MG1A 4STDA 1WMPA 1RKYA 9RNTA 3CCJ3 5JPUA 4L7KA 1CYUA 1VQP3 2AADA 2W56B 2F5WA 3STDA 1JKGB 1RGAA 4WYKA 2ML5A 1BRKA 1BIRA 2JDIH 1UGHI 5G1KA 5I97A 3EBTA 2QA43 2M7OA 1IVVA 1LOXA 3ALAA 1JBTA 1JN5B 4R9LA 1O7WB 3F14A 5BU4A 1SIIA 1BRHA 1UGIA 1W01A 3NV0B 3S27A 1JV2B 2F4YA 1E3VA 2HMJB 3NBJA 4J5GA 2OWPA 3WODG 3D5IA 4XBYA 3EB8A 1VQ73 1V58A 1NU3A 3NHXA 1JRQA 3EJVA 1IQXA 1JB5A 5M19A 3PGBA 4TX4A 2W03A 3X3ZA 2XSOB 4KFDA 3NBBA 3CNMA 1QVF2 2PZVA 2RSXA 2CWTA 3JUQA 1DVCA 1OPYA 1B20A 1HKXA 1YGWA 4HM5B 5ELJA 4BL3A 4EW5A 1KC84 1G96A 1I2GA 1MWTA 3WDGB 1RGKA 5RNTA 2K54A 1I3IA 1UI8A 4N6V0 2Z77A 3LXUX 3X3YA 4KVHA 1NB5I 3WHOA 1VQ63 3BLZA 2BMQB 1U8CB 4CPKA 4ZM8A 1GD3A 2W04A 3DMCA 3EF8A 3SXXA 1OGZA 3E99A 5BVBA 1B27A 2OTL3 3EE1A 3K0ZA 1TJDA 1OCVA 3X40A 1BSCA 3BNEA 1I70A 4X2HA 2CFLA 3A76A 1FGMA 1D6YA 1FGTA 1OHSA 1UUGB 5DRVA 1BRJA 2YFIB 4WYKB 4EBGA 3MHEA 1HU9A 5AEUB 3D9RA 1T3BA 3B7CA 3LYGA 3S29A 1JB4A 2A15A 4XBXA 3PXMA 1Y4KA 1IYYA 1SIHA 5G1LA 1OHOA 2KF6A 2XR8B 3K9MC 3FF0A 1F8NA 3KSPA 1KQS2 5AEWB 2Z6BA 5LC6A 3TDGA 5BIRA 1RN1A 2QIYA 1LNHA 1GY6A 1ROVA 3IMAB 3I563 1GSPA 3LT9A 1QALA 1LVNA 3F8XA 3MKIA 1US1A 3IPTA 4MJDA 4MMXB 1W2B2 1DVDA 2QEX3 1NO3A 2C11A 3DGLA 1G02A 1S723 1M1XB 5KP3A 3ZG5A 2MF7A 1BGSA 4RZMA 1QMAA 1EKMA 1FGRA 2WOHA 3BNCA 4I4KA 1IVUA 3HZPA 4KFEA 1W2ZA 3Q2PA 1TU5A
chains in the Genus database with same CATH topology
2O9UX 3B4PA 5A0OB 1PFPA 5D83A 3G4S3 3CCL3 3LMLA 1GYBA 3ROBA 2JQ5A 2F86B 2W0QA 1IQYA 2XSHB 3WOFB 3LOYA 3MG2A 4HKVB 3GZRA 4FCJA 3UL6A 1W02A 3PCRA 5AYRB 1IK3A 3KFQC 2CWVA 1VQ93 4H61A 1Z1SA 3BNDA 1Q824 1E97A 3SX1A 2P05A 2OQEC 3V98A 3T8NA 3AMOA 1DMNA 1UW1A 3GWRA 3S5CA 1Q7Y4 3FZWA 4EYCA 3D3LA 3DGNA 1YIT3 1SQWA 3CCS3 1DMMA 5CF2A 1SJWA 3DM8A 3NM7A 2WGOA 4FR9A 4RBNA 3G0KA 4FMDA 4XDVA 3JUPA 4HBRA 8CHOA 5DREA 4PEJA 3JUOA 4FCMA 3G6E3 4KFFA 3VSYA 4J8TA 3NQYA 1W5ZA 3WOEB 3CCE3 1WQLB 3ER7A 4R80A 4MMYB 4HJLB 4K1UA 4LZIA 3DXOA 4N6OB 5LC7A 1N8R4 1NDOB 2OOVC 1VQ43 5ELUA 3LTBA 1LXEA 2XRXB 1NJI4 4HM2B 4N6LA 3MG3A 2E2VA 4MMZB 4OK0A 1VQO3 3MYTA 3LH4A 4MEIA 3KKGA 3U97A 2HMOB 3N54B 3UNLA 1TP6A 3MWZA 3CC73 3DUKA 3LT8A 1E3RA 3WMDA 3UJMA 1IV9A 2BHMA 3OW22 3AMOB 2XH9A 2CHCA 3CXC2 1ISKA 4WFOA 3NQZA 3X42A 4N6TA 3N9HA 3HX8A 3EBYA 1M904 3VGNA 2XEPA 1GY7A 4N6UA 1Q814 1YGEA 2GU1A 3T8UA 1J2BA 2CK3H 3HIGA 1EQKA 1ULJB 1FGQA 1D6UA 5AYSC 5JPPA 2BMOB 5IG5A 4HYZA 4O3VA 1K9M4 3S28A 1N9EA 1W4NA 1RRHA 1Q42A 5CXOA 4XBTA 2CWUA 5IEOA 1IV7A 5FW5A 1OF5A 4FMCA 1DMQA 4OUQA 2IUKA 2C10A 3QK9A 1GS3A 2OCTA 1YHQ3 3X41A 3CD63 3UB1A 1W6YA 2L4VA 4K1VA 5IENA 1STDA 1MNLA 3MSOA 4HM4B 1VQ83 4KZ1A 5FGOA 5KP1A 2CFGA 1O7PB 4R9KA 2P09A 1YJ93 3CC43 1C7HA 2GU3A 3LTAA 4WWUC 1U5OA 4AEQA 3LTDA 1CQSA 3H3HA 3MPHA 5AIIA 4XDWA 4IIAA 4N6MA 2KRTA 1YI23 3KE7A 5IG0A 3OWYA 1ZX2A 3F9SA 3KSED 4NREA 5HGRA 4EXRA 1BUQA 1O7GB 3FKAA 2R4IA 3X3XA 4HVNA 4AKYA 2WO0A 2D1WA 4O2HA 5IW9A 1YIJ3 1IVWA 1TFOA 1RJOA 2Q07A 3GZYB 5G2GA 5TGNA 1SPUA 1PU4A 2WGQA 1VQM3 2E2TA 2CG1A 2HMLB 1UI7A 1KSIA 2Y74A 1O7NB 2GEXA 1OF5B 4O02B 3OWSA 2W6JH 4HZ9B 4IT7A 2P0XA 2Y73A 3NM2A 3UL5A 5AIGA 3FG4A 1NWWA 1N8QA 3KZTA 4LGQA 1UUWB 3NBRA 1N9JA 1OACA 3I0YA 3F7XA 4GB5A 5IG4A 1MOLA 1YJW3 3BNBA 3F8HA 4J9AA 1QJGA 1AVLA 4OVMA 4HM7B 3CCR3 3CCU3 2P0MA 2RCDA 4RNYA 3Q1CA 3CU3A 3CPW2 2UX0A 3HIIA 2F98A 1YJN3 3SOYA 3K7CA 1W6CA 2ZDJA 2GEYA 5IG3A 2BMRB 4RNZA 1KD14 4N3VA 1KWIA 2RFRA 3Q90A 2BT3A 4JRFA 1OHPA 5AI1A 2IMJA 6STDA 2B24B 5EQLA 3BB9A 2Z76A 1IQ8A 3SOAA 3QRDA 3RGAA 2ZL8A 1AV4A 3G16A 3J7Yd 2FXTA 1O7MB 2HMMB 1N5HA 1T5YA 1R4CA 1W6GA 3B8LA 5CK6A 2CFKA 1D6ZA 3SLUA 2WOFA 5KP4A 2Z7AA 3EHCA 2W2CA 5IF6A 5IERA 1ROAA 1EG9B 3EN8A 3LTCA 1QVG2 1N5PA 1A2VA 3FGYA 2CKFB 2P38A 3CPOA 2SBLA 2CH9A 5AIHA 3F40A 4LSOA 5D82A 4WHAA 2YX9A 4HM3B 3NXJA 1AVKA 4X2OA 4U13A 4K61A 3LZAA 3SEDA 2F99A 1TIJA 1TUHA 4HZBB 4EC6A 1FA3A 3OX9A 4HM8B 3JVCA 4IPBA 1WMNA 3K63A 2STDA 1NB3I 3FSDA 1A90A 5BXQA 3KN4A 4N6NB 2GBXB 2OQEA 4HM6B 3EC9A 5CLKA 3CCV3 2INXA 2W9QA 4CDLA 3G713 2YFLB 1L5GB 1FGOA 4FMBA 1IDPA 1QAFA 5EEOA 1OUNA 1JNQA 2XF3A 1K8A4 2QGUA 3RDEA 2PNCA 2XGLA 4R4KA 3SVAA 1FUWA 3CNXA 5CF1A 4CCVA 4NHFA 1Q864 4BTYA 3PYJA 3FG1A 1QAKA 1WMOA 3JUNA 1ZO2A 3CME3 3G8ZA 3OV4A 4R1KA 2OOVA 3ECFA 5D81A 1CEWI 2B1XB 3V99A 1VQ53 3I553 2I9WA 1TFKA 3HI7A 3H51A 3FCSB 4GL6A 2RGQA 3WA3A 4XB5A 3PZWA 1K734 2KCDA 2IA7A 2CIUA 1IVXA 1V74A 1VQL3 3N8BA 2BO9B 2KXGA 4L8OA 2V1LA 3L0RA 1JJ22 1A67A 3FG3A 3DY5A 1RN7A 4LEHA 1UUVB 3DGOA 3GAXA 1EA2A 1OH0A 1S5AA 4XM4A 3VF1A 3RGRA 2GBWB 2GXFA 3JUMA 4HM0B 4O8SA 3GZXB 5AIFA 3F7SA 3CMA3 4JF8A 4L8PA 1WNHA 3OXAA 3FH1A 4FMAA 2XGNA 4HM1B 2CFDA 2LYXA 5EVHA 1YVBI 2IUJA 1W7CA 4FCZA 1IT7A 1VZZA 2W9PA 1VQN3 4Q53A 1M1K4 2D42A 4ORLA 3U1WA 4WP5A 1WTHA 5JBSA 2K0MA 3S67A 5STDA 3CCQ3 4K90B 3GZBA 1CYVA 1Q40A 3O8YA 3FLJA 1IU7A 3GRDA 3CCM3 3DZLA 1IT8A 2OTJ3 3EX9A 1O7HB 4EV2A 1M9GA 1ULIB 1DYUA 2FNQA 1K28A 3FF2A 3KIIA 2W56A 3IJEB 1JKGA 3EQQB 4LMIA 1OGXA 1STFI 3OWUA 2CG0A 3PCSA 7STDA 4BTWA 4EV5A 1JN5A 2XFTA 2O3OA 2HMKB 3K5TA 1K41A 3NV0A 4H3UA 3PS8A 4QWTA 1GD4A 2ML6A 2XFSA 3CC23 1W00A 1ASKA 4AKZA 1JB2A 3NUVA 2E2UA 1AR0A 4BTXA 2CC3A 3WA2X 2CW9A 2HMNB 1VQK3 3NX0A 1GY5A 1A2KA 1RRLA 2CFWA 3EN1B 3HK4A 2YFJB 3B4OA 2MC8A 3V92A 3T0UA 5IEPA 4G1MB 2BNGA 2LQVA 3M8CA 2FGTA 3DGMA 1Q40B 3MG1A 4STDA 1WMPA 1RKYA 3CCJ3 5JPUA 4L7KA 1CYUA 1VQP3 2W56B 3STDA 1JKGB 4WYKA 2ML5A 2JDIH 5I97A 3EBTA 2QA43 2M7OA 1IVVA 1LOXA 3ALAA 1JN5B 4R9LA 1O7WB 3F14A 1SIIA 3S27A 3NV0B 1W01A 1JV2B 1E3VA 2HMJB 3NBJA 2OWPA 3WODG 1VQ73 4XBYA 3EB8A 1NU3A 3NHXA 1JRQA 3EJVA 1IQXA 1JB5A 3PGBA 4TX4A 2W03A 3X3ZA 2XSOB 4KFDA 3NBBA 3CNMA 1QVF2 2PZVA 2RSXA 2CWTA 3JUQA 1DVCA 1OPYA 1HKXA 4HM5B 5ELJA 1KC84 1G96A 3WDGB 2K54A 1UI8A 4N6V0 2Z77A 3LXUX 3X3YA 4KVHA 1NB5I 1VQ63 3BLZA 2BMQB 1U8CB 4ZM8A 1GD3A 2W04A 3DMCA 3EF8A 3SXXA 1OGZA 3E99A 5BVBA 2OTL3 3EE1A 3K0ZA 1OCVA 3X40A 4X2HA 3BNEA 2CFLA 3A76A 1FGMA 1D6YA 1FGTA 1OHSA 5DRVA 2YFIB 4WYKB 4EBGA 3MHEA 1HU9A 5AEUB 3D9RA 3B7CA 3LYGA 3S29A 1JB4A 2A15A 4XBXA 3PXMA 1Y4KA 1SIHA 1OHOA 2XR8B 3K9MC 3FF0A 1F8NA 3KSPA 1KQS2 5AEWB 2Z6BA 5LC6A 3TDGA 2QIYA 1LNHA 1GY6A 1ROVA 3IMAB 3I563 3LT9A 1QALA 1LVNA 3F8XA 3MKIA 1US1A 3IPTA 4MJDA 4MMXB 1W2B2 1DVDA 2QEX3 1NO3A 2C11A 3DGLA 1S723 1M1XB 5KP3A 2MF7A 4RZMA 1QMAA 1EKMA 2WOHA 1FGRA 3BNCA 4I4KA 1IVUA 3HZPA 4KFEA 1W2ZA 3Q2PA 1TU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4P A;  5D83 A;  1GYB A;  3ROB A;  2JQ5 A;  2F86 B;  2XSH B;  3MG2 A;  4HKV B;  3GZR A;  4FCJ A;  1W02 A;  1Z1S A;  1E97 A;  3T8N A;  1DMN A;  3GWR A;  3S5C A;  3FZW A;  1DMM A;  5CF2 A;  1SJW A;  3DM8 A;  4XDV A;  3G0K A;  3JUP A;  8CHO A;  5DRE A;  4PEJ A;  3JUO A;  4FCM A;  3VSY A;  4J8T A;  1WQL B;  3ER7 A;  4HJL B;  4K1U A;  3DXO A;  1NDO B;  2XRX B;  4HM2 B;  3MG3 A;  3MYT A;  3KKG A;  2HMO B;  3UNL A;  1TP6 A;  3DUK A;  1E3R A;  3WMD A;  3UJM A;  2CHC A;  1ISK A;  3HX8 A;  3EBY A;  3VGN A;  1GY7 A;  3T8U A;  1ULJ B;  5JPP A;  2BMO B;  5IG5 A;  5CXO A;  1Q42 A;  4XBT A;  5IEO A;  5FW5 A;  1OF5 A;  1DMQ A;  4OUQ A;  1GS3 A;  1W6Y A;  4K1V A;  5IEN A;  1STD A;  3MSO A;  4HM4 B;  5KP1 A;  4R9K A;  1O7P B;  1C7H A;  4WWU C;  1U5O A;  1CQS A;  3H3H A;  5AII A;  4XDW A;  4IIA A;  3KE7 A;  5IG0 A;  3OWY A;  1ZX2 A;  3F9S A;  5HGR A;  1BUQ A;  1O7G B;  3FKA A;  2R4I A;  4HVN A;  5TGN A;  3GZY B;  5G2G A;  2HML B;  1O7N B;  2GEX A;  1OF5 B;  3OWS A;  4HZ9 B;  3NM2 A;  5AIG A;  1NWW A;  3KZT A;  4LGQ A;  1UUW B;  3NBR A;  4GB5 A;  3I0Y A;  3F7X A;  5IG4 A;  3F8H A;  4J9A A;  1QJG A;  4OVM A;  4HM7 B;  2RCD A;  3CU3 A;  2UX0 A;  2F98 A;  3SOY A;  3K7C A;  2GEY A;  5IG3 A;  2BMR B;  4N3V A;  2RFR A;  3Q90 A;  1OHP A;  5AI1 A;  2IMJ A;  6STD A;  2B24 B;  3BB9 A;  2Z76 A;  3SOA A;  3RGA A;  3G16 A;  1O7M B;  2HMM B;  3B8L A;  5CK6 A;  5KP4 A;  2Z7A A;  3EHC A;  2W2C A;  5IF6 A;  5IER A;  1EG9 B;  3EN8 A;  3FGY A;  2CKF B;  3CPO A;  5AIH A;  3F40 A;  5D82 A;  4HM3 B;  3NXJ A;  4X2O A;  4U13 A;  3LZA A;  3SED A;  2F99 A;  1TUH A;  4HZB B;  3OX9 A;  4HM8 B;  2STD A;  3FSD A;  5BXQ A;  2GBX B;  4HM6 B;  3EC9 A;  5CLK A;  2INX A;  4CDL A;  2YFL B;  1IDP A;  1OUN A;  2QGU A;  3CNX A;  5CF1 A;  3JUN A;  1ZO2 A;  3G8Z A;  3OV4 A;  4R1K A;  3ECF A;  5D81 A;  2B1X B;  2I9W A;  3H51 A;  2RGQ A;  4XB5 A;  4L8O A;  4LEH A;  1UUV B;  1EA2 A;  1OH0 A;  1S5A A;  4XM4 A;  3RGR A;  2GBW B;  2GXF A;  3JUM A;  4HM0 B;  3GZX B;  5AIF A;  3F7S A;  4L8P A;  3OXA A;  3FH1 A;  4HM1 B;  5EVH A;  1VZZ A;  4Q53 A;  4ORL A;  4WP5 A;  5STD A;  3GZB A;  1Q40 A;  3FLJ A;  3GRD A;  3DZL A;  3EX9 A;  1O7H B;  1ULI B;  3FF2 A;  1JKG A;  3EQQ B;  4LMI A;  1OGX A;  3OWU A;  7STD A;  1JN5 A;  2HMK B;  3NV0 A;  1K41 A;  4H3U A;  1W00 A;  1ASK A;  1JB2 A;  3NUV A;  1AR0 A;  2HMN B;  1GY5 A;  1A2K A;  3EN1 B;  3HK4 A;  2YFJ B;  3B4O A;  5IEP A;  2BNG A;  3M8C A;  1Q40 B;  3MG1 A;  4STD A;  5JPU A;  4L7K A;  3STD A;  1JKG B;  4WYK A;  3EBT A;  1JN5 B;  4R9L A;  1O7W B;  3F14 A;  3NV0 B;  1W01 A;  1E3V A;  2HMJ B;  2OWP A;  4XBY A;  1NU3 A;  3NHX A;  3EJV A;  1JB5 A;  2XSO B;  3CNM A;  2PZV A;  4HM5 B;  3JUQ A;  1OPY A;  1HKX A;  2K54 A;  2Z77 A;  4KVH A;  3BLZ A;  2BMQ B;  3DMC A;  3EF8 A;  1OGZ A;  3E99 A;  5BVB A;  3K0Z A;  1OCV A;  4X2H A;  3A76 A;  1OHS A;  5DRV A;  2YFI B;  4WYK B;  3MHE A;  5AEU B;  3D9R A;  3B7C A;  3LYG A;  1JB4 A;  2A15 A;  4XBX A;  1OHO A;  2XR8 B;  3FF0 A;  3KSP A;  5AEW B;  2QIY A;  1GY6 A;  3F8X A;  3MKI A;  3IPT A;  4MJD A;  5KP3 A;  4RZM A;  1QMA A;  4I4K A;  3HZP A; 
#chains in the Genus database with same CATH topology
 2O9U X;  3B4P A;  5A0O B;  1PFP A;  5D83 A;  3G4S 3;  1ZS7 A;  3LML A;  3CCL 3;  1GYB A;  1UDI I;  3ROB A;  2JQ5 A;  1MWU A;  2F86 B;  1JBS A;  2W0Q A;  1IQY A;  2XSH B;  3WOF B;  3LOY A;  3MG2 A;  6GSP A;  1RCK A;  4HKV B;  2C4B A;  1X1X A;  2F5M A;  3GZR A;  4FCJ A;  3UL6 A;  1BSD A;  1W02 A;  2UGI A;  3PCR A;  5AYR B;  1IK3 A;  1GOY A;  3KFQ C;  2AAE A;  2CWV A;  1Q9E A;  1VQ9 3;  4H61 A;  1Z1S A;  3BND A;  1RGG A;  1E97 A;  3DH2 A;  1Q82 4;  2GSP A;  3SX1 A;  2P05 A;  2OQE C;  3V98 A;  1FYS A;  3T8N A;  3AMO A;  1DMN A;  1UW1 A;  3GWR A;  3S5C A;  1Q7Y 4;  3FZW A;  4EYC A;  1DET A;  3D3L A;  3DGN A;  1YIT 3;  2RNT A;  1SQW A;  1UCL A;  1DMM A;  1B2S A;  1RGL A;  1LRA A;  5CF2 A;  1RDS A;  1SJW A;  3CCS 3;  3DM8 A;  3NM7 A;  2WGO A;  4FR9 A;  4RBN A;  3G0K A;  4FMD A;  4XDV A;  3JUP A;  4HBR A;  8CHO A;  5DRE A;  7RNT A;  4PEJ A;  3JUO A;  2IY2 A;  1I0X A;  4FCM A;  3G6E 3;  4KFF A;  2KF3 A;  4J8T A;  3NQY A;  1W5Z A;  3VSY A;  3WOE B;  1WQL B;  3ER7 A;  3CCE 3;  4R80 A;  4MMY B;  4HJL B;  1UCK A;  4K1U A;  3DXO A;  4LZI A;  4N6O B;  5LC7 A;  3A5E A;  1N8R 4;  1NDO B;  2BIR A;  2OOV C;  1VQ4 3;  5ELU A;  3LTB A;  1LXE A;  1FZU A;  2XRX B;  1NJI 4;  4HM2 B;  4N6L A;  3MG3 A;  4BL2 A;  2E2V A;  4MMZ B;  4OK0 A;  1VQO 3;  3MYT A;  3LH4 A;  4MEI A;  3KKG A;  1RGE A;  3U97 A;  2HMO B;  3N54 B;  3UNL A;  1TP6 A;  2L1S A;  1HYF A;  3AGO A;  3MWZ A;  3CC7 3;  3DUK A;  1AY7 A;  3LT8 A;  1E3R A;  1RN4 A;  3WMD A;  3UJM A;  3AGN A;  1IV9 A;  2BHM A;  3OW2 2;  3AMO B;  2XH9 A;  2CHC A;  3CXC 2;  1ISK A;  4WFO A;  1T2H A;  1TRP A;  3NQZ A;  3X42 A;  1SAR A;  1V57 A;  1BRS A;  1BRG A;  1BSE A;  3N9H A;  3HX8 A;  3EBY A;  4N6T A;  3VGN A;  2XEP A;  1GY7 A;  4N6U A;  1Q81 4;  1M90 4;  1YGE A;  2GU1 A;  3T8U A;  6RNT A;  1J2B A;  2CK3 H;  3HIG A;  1EQK A;  1ULJ B;  4CJN A;  1FGQ A;  1D6U A;  5AYS C;  5JPP A;  2BMO B;  1FUS A;  4HYZ A;  1BNS A;  5IG5 A;  4O3V A;  1K9M 4;  3S28 A;  3WR2 A;  1N9E A;  1W4N A;  1RRH A;  1Q42 A;  5CXO A;  4XBT A;  2CWU A;  5IEO A;  1IV7 A;  1T2I A;  2BU4 A;  3Q3F A;  5FW5 A;  4HAA A;  1OF5 A;  4FMC A;  1DMQ A;  4OUQ A;  2IUK A;  2C10 A;  1NNV A;  3QK9 A;  1GS3 A;  2OCT A;  1RNB A;  1YHQ 3;  3X41 A;  3CD6 3;  3UB1 A;  1W6Y A;  2L4V A;  4K1V A;  5IEN A;  3D5G A;  1STD A;  1MNL A;  3GSP A;  3MSO A;  4HM4 B;  1VQ8 3;  4KZ1 A;  5FGO A;  1BUJ A;  5KP1 A;  2CFG A;  1O7P B;  4R9K A;  2P09 A;  1YJ9 3;  1B2M A;  3CC4 3;  1C7H A;  2GU3 A;  3LTA A;  4WWU C;  1U5O A;  4AEQ A;  3LTD A;  1CQS A;  3H3H A;  3MPH A;  5AII A;  4XDW A;  2ZA4 A;  4IIA A;  2KRT A;  4N6M A;  1YI2 3;  3KE7 A;  5IG0 A;  3OWY A;  1YVS A;  1ZX2 A;  1MGW A;  3F9S A;  3KSE D;  4NRE A;  5HGR A;  4EXR A;  1BUQ A;  3URP A;  1O7G B;  2CX1 A;  1RNT A;  2R4I A;  3FKA A;  3X3X A;  4HVN A;  4AKY A;  2WO0 A;  1X1Y A;  2D1W A;  4O2H A;  5IW9 A;  1UCJ A;  1YIJ 3;  1IVW A;  1TFO A;  1RJO A;  2Q07 A;  1B3S A;  2R41 A;  3GZY B;  5G2G A;  5TGN A;  1JZO A;  1GOV A;  1SPU A;  1PU4 A;  2WGQ A;  4DKI A;  1HZ1 A;  2E2T A;  2CG1 A;  2HML B;  1GMR A;  1VQM 3;  1UI7 A;  3BU4 A;  1KSI A;  2Y74 A;  1MWR A;  1O7N B;  2GEX A;  1OF5 B;  4O02 B;  1BNR A;  3OWS A;  2W6J H;  4HZ9 B;  4IT7 A;  1CH0 A;  2P0X A;  1BAO A;  3DGY A;  2Y73 A;  3NM2 A;  4GSP A;  3UL5 A;  5AIG A;  3FG4 A;  1BOX A;  1NWW A;  1N8Q A;  3KZT A;  4LGQ A;  1UUW B;  3NBR A;  1BNG A;  1N9J A;  1OAC A;  1ZGX A;  3F7X A;  3I0Y A;  4GB5 A;  5IG4 A;  1MOL A;  1X1U A;  3AHW A;  1YJW 3;  3BNB A;  3F8H A;  4J9A A;  1QJG A;  1AVL A;  4OVM A;  1BAN A;  4HM7 B;  5HOH A;  3CCR 3;  3CCU 3;  1A2P A;  2P0M A;  2RCD A;  1I8V A;  4NPB A;  4RNY A;  3Q1C A;  3CU3 A;  3CPW 2;  2UX0 A;  3HII A;  2F98 A;  1YJN 3;  3SOY A;  2KF5 A;  3K7C A;  3BIR A;  1W6C A;  2ZDJ A;  2GEY A;  5IG3 A;  2BMR B;  4RNZ A;  3D4A A;  1KD1 4;  4N3V A;  1KWI A;  4LYL B;  2RFR A;  3Q90 A;  2BT3 A;  4JRF A;  4BU4 A;  1OHP A;  5AI1 A;  2IMJ A;  3AHS A;  6STD A;  1B2X A;  1EEJ A;  2B24 B;  5EQL A;  3BB9 A;  2Z76 A;  1IQ8 A;  3SOA A;  3QRD A;  3RGA A;  2ZL8 A;  3HOH A;  1AV4 A;  3G16 A;  3J7Y d;  1RMS A;  1O7M B;  2FXT A;  1MWS A;  1RGC A;  2HMM B;  1N5H A;  1T5Y A;  1R4C A;  1W6G A;  3B8L A;  5CK6 A;  2CFK A;  1D6Z A;  3SLU A;  2WOF A;  5KP4 A;  2Z7A A;  3EHC A;  1B2U A;  2W2C A;  1GOU A;  5IF6 A;  5IER A;  1ROA A;  1EG9 B;  3D79 A;  3EN8 A;  3LTC A;  1RHL A;  1QVG 2;  1N5P A;  1A2V A;  2ZHX B;  3FGY A;  1BSA A;  1TRQ A;  1X1W A;  2CKF B;  2CH9 A;  2P38 A;  2SBL A;  3CPO A;  5AIH A;  3F40 A;  4LSO A;  5D82 A;  4WHA A;  1BRN L;  1I2E A;  2YX9 A;  4HM3 B;  3NXJ A;  1AVK A;  4X2O A;  4U13 A;  4K61 A;  3LZA A;  1AQZ A;  1RTU A;  2F99 A;  3SED A;  4BIR A;  1TIJ A;  1TUH A;  4HZB B;  4EC6 A;  1RGF A;  1FA3 A;  3OX9 A;  1DE3 A;  4HM8 B;  3JVC A;  4IPB A;  1WMN A;  3K63 A;  2STD A;  1LQM B;  1NB3 I;  3FSD A;  1LOV A;  3RNT A;  1A90 A;  5BXQ A;  3KN4 A;  4I5Q A;  4N6N B;  2GBX B;  2OQE A;  1LQG C;  4HM6 B;  2H0H A;  3EC9 A;  5CLK A;  3CCV 3;  2INX A;  3ZFZ A;  1BVI A;  2W9Q A;  4CDL A;  3G71 3;  2YFL B;  1L5G B;  1FGO A;  4FMB A;  4J5K A;  5M18 A;  1IDP A;  1QAF A;  5EEO A;  2H0I A;  1OUN A;  1JNQ A;  2XF3 A;  1K8A 4;  2QGU A;  3RDE A;  2PNC A;  2XGL A;  4R4K A;  3SVA A;  1FUW A;  3CNX A;  5CF1 A;  4CCV A;  4NHF A;  1Q86 4;  2UUG C;  3PYJ A;  4BTY A;  3FG1 A;  1QAK A;  1WMO A;  2K3D A;  3JUN A;  1ZO2 A;  3CME 3;  3G8Z A;  3OV4 A;  4R1K A;  2OOV A;  3ECF A;  5D81 A;  1CEW I;  2B1X B;  3V99 A;  4RNT A;  2J8X B;  1VQ5 3;  3I55 3;  2I9W A;  1TFK A;  3HI7 A;  3H51 A;  3FCS B;  1I0V A;  4GL6 A;  2RGQ A;  3WA3 A;  4XB5 A;  2HOH A;  1LOW A;  3PZW A;  1FUT A;  1K73 4;  1FW7 A;  2KCD A;  2IA7 A;  2CIU A;  1IVX A;  4GHO A;  1V74 A;  1VQL 3;  1MGR A;  1GMQ A;  1PYL A;  2CX0 A;  3N8B A;  2BO9 B;  2KXG A;  2IYJ A;  4L8O A;  3ZG0 A;  1BNE A;  2V1L A;  3L0R A;  1I3F A;  1JJ2 2;  1A67 A;  8RNT A;  3FG3 A;  3DY5 A;  1RN7 A;  4LEH A;  1UUV B;  3DGO A;  3GAX A;  1EA2 A;  1OH0 A;  1S5A A;  4XM4 A;  3VF1 A;  3RGR A;  2GBW B;  2GXF A;  3JUM A;  4HM0 B;  4O8S A;  3GZX B;  1YNV X;  5AIF A;  5M1A A;  3F7S A;  3CMA 3;  4JF8 A;  1TTO A;  4L8P A;  1WNH A;  3OXA A;  3FH1 A;  4FMA A;  2XGN A;  4HM1 B;  1BNF A;  1Q7H A;  2CFD A;  2LYX A;  5EVH A;  1YVB I;  2IUJ A;  1W7C A;  4FCZ A;  1IT7 A;  1B21 A;  1VZZ A;  2W9P A;  1VQN 3;  4Q53 A;  1M1K 4;  2D42 A;  4ORL A;  3U1W A;  4WP5 A;  1WTH A;  5JBS A;  4HOH A;  2K0M A;  3S67 A;  5STD A;  3CCQ 3;  1BRI A;  4K90 B;  3GZB A;  1CYV A;  1Q40 A;  1GMP A;  3SYU A;  1UCI A;  3O8Y A;  3FLJ A;  1IU7 A;  2F56 A;  2H0G A;  2RBI A;  3DZL A;  1EUI C;  3GRD A;  3CCM 3;  1IT8 A;  2OTJ 3;  1LOY A;  3EX9 A;  1O7H B;  4EV2 A;  4ILF A;  1M9G A;  1ULI B;  1DYU A;  2FNQ A;  1K28 A;  3FF2 A;  3KII A;  1BU4 A;  1PY3 A;  2W56 A;  3IJE B;  1JKG A;  3EQQ B;  4LMI A;  1OGX A;  5GSP A;  2KF4 A;  1STF I;  3OWU A;  2CG0 A;  3PCS A;  1BNJ A;  7STD A;  4BTW A;  1JZD A;  4EV5 A;  1JN5 A;  2XFT A;  2O3O A;  2HMK B;  3K5T A;  1K41 A;  3KCH A;  2KAA A;  3NV0 A;  4H3U A;  3PS8 A;  1R4Y A;  4QWT A;  1JBR A;  1GD4 A;  1G0T A;  2ML6 A;  2XFS A;  3CC2 3;  1W00 A;  1BSB A;  1ASK A;  4AKZ A;  1JB2 A;  1C54 A;  2SAR A;  3NUV A;  2E2U A;  1AR0 A;  4BTX A;  2CC3 A;  1RLS A;  1LNI A;  2CW9 A;  2HMN B;  3WA2 X;  1VQK 3;  1RCL A;  3NX0 A;  1GY5 A;  1A2K A;  1RRL A;  2CFW A;  3EN1 B;  1I2F A;  3HK4 A;  2YFJ B;  1VQQ A;  3B4O A;  1RGH A;  2MC8 A;  7GSP A;  3V92 A;  3T0U A;  5IEP A;  4G1M B;  1RSN A;  2BNG A;  1BNI A;  2LQV A;  3M8C A;  4KT3 B;  2FGT A;  1B2Z A;  3DGM A;  1Q40 B;  3MG1 A;  4STD A;  1WMP A;  1RKY A;  9RNT A;  3CCJ 3;  5JPU A;  4L7K A;  1CYU A;  1VQP 3;  2AAD A;  2W56 B;  2F5W A;  3STD A;  1JKG B;  1RGA A;  4WYK A;  2ML5 A;  1BRK A;  1BIR A;  2JDI H;  1UGH I;  5G1K A;  5I97 A;  3EBT A;  2QA4 3;  2M7O A;  1IVV A;  1LOX A;  3ALA A;  1JBT A;  1JN5 B;  4R9L A;  1O7W B;  3F14 A;  5BU4 A;  1SII A;  1BRH A;  1UGI A;  1W01 A;  3NV0 B;  3S27 A;  1JV2 B;  2F4Y A;  1E3V A;  2HMJ B;  3NBJ A;  4J5G A;  2OWP A;  3WOD G;  3D5I A;  4XBY A;  3EB8 A;  1VQ7 3;  1V58 A;  1NU3 A;  3NHX A;  1JRQ A;  3EJV A;  1IQX A;  1JB5 A;  5M19 A;  3PGB A;  4TX4 A;  2W03 A;  3X3Z A;  2XSO B;  4KFD A;  3NBB A;  3CNM A;  1QVF 2;  2PZV A;  2RSX A;  2CWT A;  3JUQ A;  1DVC A;  1OPY A;  1B20 A;  1HKX A;  1YGW A;  4HM5 B;  5ELJ A;  4BL3 A;  4EW5 A;  1KC8 4;  1G96 A;  1I2G A;  1MWT A;  3WDG B;  1RGK A;  5RNT A;  2K54 A;  1I3I A;  1UI8 A;  4N6V 0;  2Z77 A;  3LXU X;  3X3Y A;  4KVH A;  1NB5 I;  3WHO A;  1VQ6 3;  3BLZ A;  2BMQ B;  1U8C B;  4CPK A;  4ZM8 A;  1GD3 A;  2W04 A;  3DMC A;  3EF8 A;  3SXX A;  1OGZ A;  3E99 A;  5BVB A;  1B27 A;  2OTL 3;  3EE1 A;  3K0Z A;  1TJD A;  1OCV A;  3X40 A;  1BSC A;  3BNE A;  1I70 A;  4X2H A;  2CFL A;  3A76 A;  1FGM A;  1D6Y A;  1FGT A;  1OHS A;  1UUG B;  5DRV A;  1BRJ A;  2YFI B;  4WYK B;  4EBG A;  3MHE A;  1HU9 A;  5AEU B;  3D9R A;  1T3B A;  3B7C A;  3LYG A;  3S29 A;  1JB4 A;  2A15 A;  4XBX A;  3PXM A;  1Y4K A;  1IYY A;  1SIH A;  5G1L A;  1OHO A;  2KF6 A;  2XR8 B;  3K9M C;  3FF0 A;  1F8N A;  3KSP A;  1KQS 2;  5AEW B;  2Z6B A;  5LC6 A;  3TDG A;  5BIR A;  1RN1 A;  2QIY A;  1LNH A;  1GY6 A;  1ROV A;  3IMA B;  3I56 3;  1GSP A;  3LT9 A;  1QAL A;  1LVN A;  3F8X A;  3MKI A;  1US1 A;  3IPT A;  4MJD A;  4MMX B;  1W2B 2;  1DVD A;  2QEX 3;  1NO3 A;  2C11 A;  3DGL A;  1G02 A;  1S72 3;  1M1X B;  5KP3 A;  3ZG5 A;  2MF7 A;  1BGS A;  4RZM A;  1QMA A;  1EKM A;  1FGR A;  2WOH A;  3BNC A;  4I4K A;  1IVU A;  3HZP A;  4KFE A;  1W2Z A;  3Q2P A;  1TU5 A; 
#chains in the Genus database with same CATH homology
 2O9U X;  3B4P A;  5A0O B;  1PFP A;  5D83 A;  3G4S 3;  3CCL 3;  3LML A;  1GYB A;  3ROB A;  2JQ5 A;  2F86 B;  2W0Q A;  1IQY A;  2XSH B;  3WOF B;  3LOY A;  3MG2 A;  4HKV B;  3GZR A;  4FCJ A;  3UL6 A;  1W02 A;  3PCR A;  5AYR B;  1IK3 A;  3KFQ C;  2CWV A;  1VQ9 3;  4H61 A;  1Z1S A;  3BND A;  1Q82 4;  1E97 A;  3SX1 A;  2P05 A;  2OQE C;  3V98 A;  3T8N A;  3AMO A;  1DMN A;  1UW1 A;  3GWR A;  3S5C A;  1Q7Y 4;  3FZW A;  4EYC A;  3D3L A;  3DGN A;  1YIT 3;  1SQW A;  3CCS 3;  1DMM A;  5CF2 A;  1SJW A;  3DM8 A;  3NM7 A;  2WGO A;  4FR9 A;  4RBN A;  3G0K A;  4FMD A;  4XDV A;  3JUP A;  4HBR A;  8CHO A;  5DRE A;  4PEJ A;  3JUO A;  4FCM A;  3G6E 3;  4KFF A;  3VSY A;  4J8T A;  3NQY A;  1W5Z A;  3WOE B;  3CCE 3;  1WQL B;  3ER7 A;  4R80 A;  4MMY B;  4HJL B;  4K1U A;  4LZI A;  3DXO A;  4N6O B;  5LC7 A;  1N8R 4;  1NDO B;  2OOV C;  1VQ4 3;  5ELU A;  3LTB A;  1LXE A;  2XRX B;  1NJI 4;  4HM2 B;  4N6L A;  3MG3 A;  2E2V A;  4MMZ B;  4OK0 A;  1VQO 3;  3MYT A;  3LH4 A;  4MEI A;  3KKG A;  3U97 A;  2HMO B;  3N54 B;  3UNL A;  1TP6 A;  3MWZ A;  3CC7 3;  3DUK A;  3LT8 A;  1E3R A;  3WMD A;  3UJM A;  1IV9 A;  2BHM A;  3OW2 2;  3AMO B;  2XH9 A;  2CHC A;  3CXC 2;  1ISK A;  4WFO A;  3NQZ A;  3X42 A;  4N6T A;  3N9H A;  3HX8 A;  3EBY A;  1M90 4;  3VGN A;  2XEP A;  1GY7 A;  4N6U A;  1Q81 4;  1YGE A;  2GU1 A;  3T8U A;  1J2B A;  2CK3 H;  3HIG A;  1EQK A;  1ULJ B;  1FGQ A;  1D6U A;  5AYS C;  5JPP A;  2BMO B;  5IG5 A;  4HYZ A;  4O3V A;  1K9M 4;  3S28 A;  1N9E A;  1W4N A;  1RRH A;  1Q42 A;  5CXO A;  4XBT A;  2CWU A;  5IEO A;  1IV7 A;  5FW5 A;  1OF5 A;  4FMC A;  1DMQ A;  4OUQ A;  2IUK A;  2C10 A;  3QK9 A;  1GS3 A;  2OCT A;  1YHQ 3;  3X41 A;  3CD6 3;  3UB1 A;  1W6Y A;  2L4V A;  4K1V A;  5IEN A;  1STD A;  1MNL A;  3MSO A;  4HM4 B;  1VQ8 3;  4KZ1 A;  5FGO A;  5KP1 A;  2CFG A;  1O7P B;  4R9K A;  2P09 A;  1YJ9 3;  3CC4 3;  1C7H A;  2GU3 A;  3LTA A;  4WWU C;  1U5O A;  4AEQ A;  3LTD A;  1CQS A;  3H3H A;  3MPH A;  5AII A;  4XDW A;  4IIA A;  4N6M A;  2KRT A;  1YI2 3;  3KE7 A;  5IG0 A;  3OWY A;  1ZX2 A;  3F9S A;  3KSE D;  4NRE A;  5HGR A;  4EXR A;  1BUQ A;  1O7G B;  3FKA A;  2R4I A;  3X3X A;  4HVN A;  4AKY A;  2WO0 A;  2D1W A;  4O2H A;  5IW9 A;  1YIJ 3;  1IVW A;  1TFO A;  1RJO A;  2Q07 A;  3GZY B;  5G2G A;  5TGN A;  1SPU A;  1PU4 A;  2WGQ A;  1VQM 3;  2E2T A;  2CG1 A;  2HML B;  1UI7 A;  1KSI A;  2Y74 A;  1O7N B;  2GEX A;  1OF5 B;  4O02 B;  3OWS A;  2W6J H;  4HZ9 B;  4IT7 A;  2P0X A;  2Y73 A;  3NM2 A;  3UL5 A;  5AIG A;  3FG4 A;  1NWW A;  1N8Q A;  3KZT A;  4LGQ A;  1UUW B;  3NBR A;  1N9J A;  1OAC A;  3I0Y A;  3F7X A;  4GB5 A;  5IG4 A;  1MOL A;  1YJW 3;  3BNB A;  3F8H A;  4J9A A;  1QJG A;  1AVL A;  4OVM A;  4HM7 B;  3CCR 3;  3CCU 3;  2P0M A;  2RCD A;  4RNY A;  3Q1C A;  3CU3 A;  3CPW 2;  2UX0 A;  3HII A;  2F98 A;  1YJN 3;  3SOY A;  3K7C A;  1W6C A;  2ZDJ A;  2GEY A;  5IG3 A;  2BMR B;  4RNZ A;  1KD1 4;  4N3V A;  1KWI A;  2RFR A;  3Q90 A;  2BT3 A;  4JRF A;  1OHP A;  5AI1 A;  2IMJ A;  6STD A;  2B24 B;  5EQL A;  3BB9 A;  2Z76 A;  1IQ8 A;  3SOA A;  3QRD A;  3RGA A;  2ZL8 A;  1AV4 A;  3G16 A;  3J7Y d;  2FXT A;  1O7M B;  2HMM B;  1N5H A;  1T5Y A;  1R4C A;  1W6G A;  3B8L A;  5CK6 A;  2CFK A;  1D6Z A;  3SLU A;  2WOF A;  5KP4 A;  2Z7A A;  3EHC A;  2W2C A;  5IF6 A;  5IER A;  1ROA A;  1EG9 B;  3EN8 A;  3LTC A;  1QVG 2;  1N5P A;  1A2V A;  3FGY A;  2CKF B;  2P38 A;  3CPO A;  2SBL A;  2CH9 A;  5AIH A;  3F40 A;  4LSO A;  5D82 A;  4WHA A;  2YX9 A;  4HM3 B;  3NXJ A;  1AVK A;  4X2O A;  4U13 A;  4K61 A;  3LZA A;  3SED A;  2F99 A;  1TIJ A;  1TUH A;  4HZB B;  4EC6 A;  1FA3 A;  3OX9 A;  4HM8 B;  3JVC A;  4IPB A;  1WMN A;  3K63 A;  2STD A;  1NB3 I;  3FSD A;  1A90 A;  5BXQ A;  3KN4 A;  4N6N B;  2GBX B;  2OQE A;  4HM6 B;  3EC9 A;  5CLK A;  3CCV 3;  2INX A;  2W9Q A;  4CDL A;  3G71 3;  2YFL B;  1L5G B;  1FGO A;  4FMB A;  1IDP A;  1QAF A;  5EEO A;  1OUN A;  1JNQ A;  2XF3 A;  1K8A 4;  2QGU A;  3RDE A;  2PNC A;  2XGL A;  4R4K A;  3SVA A;  1FUW A;  3CNX A;  5CF1 A;  4CCV A;  4NHF A;  1Q86 4;  4BTY A;  3PYJ A;  3FG1 A;  1QAK A;  1WMO A;  3JUN A;  1ZO2 A;  3CME 3;  3G8Z A;  3OV4 A;  4R1K A;  2OOV A;  3ECF A;  5D81 A;  1CEW I;  2B1X B;  3V99 A;  1VQ5 3;  3I55 3;  2I9W A;  1TFK A;  3HI7 A;  3H51 A;  3FCS B;  4GL6 A;  2RGQ A;  3WA3 A;  4XB5 A;  3PZW A;  1K73 4;  2KCD A;  2IA7 A;  2CIU A;  1IVX A;  1V74 A;  1VQL 3;  3N8B A;  2BO9 B;  2KXG A;  4L8O A;  2V1L A;  3L0R A;  1JJ2 2;  1A67 A;  3FG3 A;  3DY5 A;  1RN7 A;  4LEH A;  1UUV B;  3DGO A;  3GAX A;  1EA2 A;  1OH0 A;  1S5A A;  4XM4 A;  3VF1 A;  3RGR A;  2GBW B;  2GXF A;  3JUM A;  4HM0 B;  4O8S A;  3GZX B;  5AIF A;  3F7S A;  3CMA 3;  4JF8 A;  4L8P A;  1WNH A;  3OXA A;  3FH1 A;  4FMA A;  2XGN A;  4HM1 B;  2CFD A;  2LYX A;  5EVH A;  1YVB I;  2IUJ A;  1W7C A;  4FCZ A;  1IT7 A;  1VZZ A;  2W9P A;  1VQN 3;  4Q53 A;  1M1K 4;  2D42 A;  4ORL A;  3U1W A;  4WP5 A;  1WTH A;  5JBS A;  2K0M A;  3S67 A;  5STD A;  3CCQ 3;  4K90 B;  3GZB A;  1CYV A;  1Q40 A;  3O8Y A;  3FLJ A;  1IU7 A;  3GRD A;  3CCM 3;  3DZL A;  1IT8 A;  2OTJ 3;  3EX9 A;  1O7H B;  4EV2 A;  1M9G A;  1ULI B;  1DYU A;  2FNQ A;  1K28 A;  3FF2 A;  3KII A;  2W56 A;  3IJE B;  1JKG A;  3EQQ B;  4LMI A;  1OGX A;  1STF I;  3OWU A;  2CG0 A;  3PCS A;  7STD A;  4BTW A;  4EV5 A;  1JN5 A;  2XFT A;  2O3O A;  2HMK B;  3K5T A;  1K41 A;  3NV0 A;  4H3U A;  3PS8 A;  4QWT A;  1GD4 A;  2ML6 A;  2XFS A;  3CC2 3;  1W00 A;  1ASK A;  4AKZ A;  1JB2 A;  3NUV A;  2E2U A;  1AR0 A;  4BTX A;  2CC3 A;  3WA2 X;  2CW9 A;  2HMN B;  1VQK 3;  3NX0 A;  1GY5 A;  1A2K A;  1RRL A;  2CFW A;  3EN1 B;  3HK4 A;  2YFJ B;  3B4O A;  2MC8 A;  3V92 A;  3T0U A;  5IEP A;  4G1M B;  2BNG A;  2LQV A;  3M8C A;  2FGT A;  3DGM A;  1Q40 B;  3MG1 A;  4STD A;  1WMP A;  1RKY A;  3CCJ 3;  5JPU A;  4L7K A;  1CYU A;  1VQP 3;  2W56 B;  3STD A;  1JKG B;  4WYK A;  2ML5 A;  2JDI H;  5I97 A;  3EBT A;  2QA4 3;  2M7O A;  1IVV A;  1LOX A;  3ALA A;  1JN5 B;  4R9L A;  1O7W B;  3F14 A;  1SII A;  3S27 A;  3NV0 B;  1W01 A;  1JV2 B;  1E3V A;  2HMJ B;  3NBJ A;  2OWP A;  3WOD G;  1VQ7 3;  4XBY A;  3EB8 A;  1NU3 A;  3NHX A;  1JRQ A;  3EJV A;  1IQX A;  1JB5 A;  3PGB A;  4TX4 A;  2W03 A;  3X3Z A;  2XSO B;  4KFD A;  3NBB A;  3CNM A;  1QVF 2;  2PZV A;  2RSX A;  2CWT A;  3JUQ A;  1DVC A;  1OPY A;  1HKX A;  4HM5 B;  5ELJ A;  1KC8 4;  1G96 A;  3WDG B;  2K54 A;  1UI8 A;  4N6V 0;  2Z77 A;  3LXU X;  3X3Y A;  4KVH A;  1NB5 I;  1VQ6 3;  3BLZ A;  2BMQ B;  1U8C B;  4ZM8 A;  1GD3 A;  2W04 A;  3DMC A;  3EF8 A;  3SXX A;  1OGZ A;  3E99 A;  5BVB A;  2OTL 3;  3EE1 A;  3K0Z A;  1OCV A;  3X40 A;  4X2H A;  3BNE A;  2CFL A;  3A76 A;  1FGM A;  1D6Y A;  1FGT A;  1OHS A;  5DRV A;  2YFI B;  4WYK B;  4EBG A;  3MHE A;  1HU9 A;  5AEU B;  3D9R A;  3B7C A;  3LYG A;  3S29 A;  1JB4 A;  2A15 A;  4XBX A;  3PXM A;  1Y4K A;  1SIH A;  1OHO A;  2XR8 B;  3K9M C;  3FF0 A;  1F8N A;  3KSP A;  1KQS 2;  5AEW B;  2Z6B A;  5LC6 A;  3TDG A;  2QIY A;  1LNH A;  1GY6 A;  1ROV A;  3IMA B;  3I56 3;  3LT9 A;  1QAL A;  1LVN A;  3F8X A;  3MKI A;  1US1 A;  3IPT A;  4MJD A;  4MMX B;  1W2B 2;  1DVD A;  2QEX 3;  1NO3 A;  2C11 A;  3DGL A;  1S72 3;  1M1X B;  5KP3 A;  2MF7 A;  4RZM A;  1QMA A;  1EKM A;  2WOH A;  1FGR A;  3BNC A;  4I4K A;  1IVU A;  3HZP A;  4KFE A;  1W2Z A;  3Q2P A;  1TU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...