3KE7A

Crystal structure of putative ketosteroid isomerase (yp_001303366.1) from parabacteroides distasonis atcc 8503 at 1.45 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
b'QKNMENKTLNENIPEMIISLEKEALASTDPMAFVELSDTDVIYFDPSLETKIEGLEQLRTYYKGMQLPPADHFDMIRPVVQVAQNIAVLTFNLDSYLSDKVIKWNCTEVYRRNPDNQWKIIQTHWSYVKPLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ketosteroid isomerase
publication title Crystal structure of putative ketosteroid isomerase (YP_001303366.1) from Parabacteroides distasonis ATCC 8503 at 1.45 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Isomerase
total genus 36
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ke7A00
3NV0B 3B7CA 3WMDA 3DZLA 3GZXB 3MG2A 2BNGA 3MYTA 1O7WB 4LEHA 3E99A 1BUQA 1IDPA 1JKGB 1OPYA 5CK6A 1TP6A 2QGUA 5BXQA 3UNLA 1E3VA 5TGNA 4OVMA 4R1KA 5FW5A 5IERA 2GEYA 2OWPA 1UUVB 3FH1A 3CPOA 3IPTA 2YFIB 3EX9A 2CKFB 5HGRA 3STDA 4HJLB 1ULJB 3ROBA 7STDA 2XSHB 3S5CA 4HM2B 3LZAA 1C7HA 3DXOA 3F8HA 4WYKB 3OWYA 3GZYB 5AEWB 1NDOB 1W01A 3HZPA 2HMNB 1E97A 3NXJA 3H51A 3K0ZA 4XBXA 2I9WA 1GS3A 2RFRA 1O7HB 2PZVA 4R9KA 1Q40A 3M8CA 2JQ5A 4IIAA 4FCMA 2B1XB 2UX0A 4GB5A 1GY7A 1OGZA 3F7SA 1ASKA 2F98A 3EQQB 5D82A 4CDLA 3MKIA 1W6YA 5D83A 4HVNA 3EF8A 3A76A 4WWUC 2BMRB 2GBWB 2BMOB 2A15A 3F9SA 1S5AA 1OCVA 4XDWA 1O7GB 3KE7A 2YFLB 3FF2A 3NBRA 1OF5B 3CU3A 5AIFA 2QIYA 3KSPA 4OUQA 3FLJA 5EVHA 2HMKB 2RGQA 3B4OA 4HM0B 1JB5A 1W02A 1STDA 5IG0A 3JUQA 5AEUB 3RGAA 3FF0A 4HM7B 5AIHA 1JN5B 1GY5A 4LMIA 3B4PA 3F8XA 1O7MB 5BVBA 2B24B 1SJWA 5IF6A 4K1VA 5CF2A 3EN1B 4HM4B 3T8NA 5STDA 2F86B 3NUVA 4J9AA 3F40A 1HKXA 5IEOA 3VSYA 4ORLA 4J8TA 5AIGA 3EN8A 4HM5B 3UJMA 2HMJB 3FGYA 1OHSA 4L8OA 4KVHA 3BB9A 3ECFA 4R9LA 1WQLB 1OGXA 3OWUA 5G2GA 1NWWA 3MG1A 3LYGA 1DMQA 1O7NB 3K7CA 1CQSA 2HMOB 4XB5A 1O7PB 3MSOA 3EHCA 1EG9B 3EBYA 3NHXA 2Z7AA 1OHPA 4U13A 4XM4A 2IMJA 5KP3A 2XRXB 1TUHA 1EA2A 3OX9A 3DUKA 3Q90A 2GBXB 3EC9A 4RZMA 3CNXA 4XBYA 4X2HA 3DMCA 3NV0A 1OF5A 5CF1A 2Z76A 1OH0A 1UUWB 3G16A 3OV4A 3BLZA 4K1UA 3RGRA 1U5OA 1JKGA 1Z1SA 3GZRA 3SOAA 4FCJA 5CXOA 5IG3A 2R4IA 1JN5A 1Q40B 3JUMA 1QJGA 1GY6A 1K41A 1NU3A 2YFJB 2CHCA 3F14A 3JUOA 4I4KA 3FZWA 4HKVB 5IG4A 4N3VA 2W2CA 5JPUA 4HZ9B 3EBTA 1DMNA 5CLKA 5JPPA 4PEJA 2GEXA 4HM8B 4WYKA 3JUNA 3FKAA 5DREA 5DRVA 1AR0A 2GXFA 1VZZA 3H3HA 4H3UA 4STDA 4HM6B 1JB4A 3JUPA 1A2KA 4HZBB 4L8PA 5IG5A 5IENA 3EJVA 5D81A 3NM2A 2HMLB 4MJDA 3G0KA 1Q42A 4HM1B 2Z77A 4XDVA 3HK4A 3DM8A 2HMMB 1DMMA 6STDA 1OHOA 1JB2A 1ISKA 2RCDA 5KP1A 5AIIA 5AI1A 3SOYA 4XBTA 3KZTA 3GZBA 4Q53A 3GRDA 1QMAA 4L7KA 1ULIB 3VGNA 3MHEA 3OXAA 2XR8B 3GWRA 5KP4A 3G8ZA 3CNMA 1OUNA 3ER7A 3B8LA 1GYBA 1ZX2A 4X2OA 2STDA 3MG3A 2XSOB 3HX8A 3F7XA 2F99A 2BMQB 1W00A 2INXA 2K54A 4WP5A 4LGQA 1E3RA 3T8UA 3D9RA 4HM3B 3I0YA 5IEPA 3OWSA 3SEDA 1ZO2A 3KKGA 8CHOA 3FSDA
chains in the Genus database with same CATH superfamily
5RNTA 2P09A 1YVBI 1YI23 3CCV3 4O2HA 1SPUA 4TX4A 6GSPA 2KF4A 4KFEA 5G1KA 2RNTA 1WMOA 3NV0B 3B7CA 2L1SA 3S27A 1OACA 3WMDA 1Q824 2W9QA 1RSNA 3DZLA 1K28A 1YGWA 3GZXB 3MG2A 1GD4A 1JV2B 2BNGA 3MYTA 1O7WB 4LEHA 3WOFB 2E2VA 1TTOA 1DETA 3E99A 1K734 1I2GA 1BUQA 3DGNA 1IDPA 3BNBA 1BRKA 3RNTA 1FGRA 1W4NA 2W6JH 1JKGB 1OPYA 2CFGA 2RSXA 2ZL8A 1TP6A 5CK6A 2QGUA 3PXMA 2P38A 2LQVA 3J7Yd 5BXQA 3CXC2 1M1K4 3UNLA 2C4BA 2W9PA 3NBBA 1E3VA 5TGNA 1LXEA 4OVMA 2OCTA 1X1XA 2W56B 1B2ZA 4R1KA 5FW5A 1RKYA 3JVCA 5IERA 3G6E3 3K9MC 1U8CB 2XFTA 4GHOA 2GEYA 5ELUA 1FUWA 2OWPA 1I8VA 1UUVB 1B21A 3CCS3 1LOXA 1BRJA 2CWVA 4FMAA 3CD63 5AYRB 5HOHA 1N8R4 1NJI4 3BU4A 3FH1A 3CPOA 3IPTA 4IT7A 3KCHA 4FR9A 1BRHA 1RRLA 4EXRA 2YFIB 3A5EA 3EX9A 3LOYA 1G96A 1RNBA 3SVAA 1RCLA 2CKFB 4FCZA 1G0TA 5HGRA 1ZS7A 1FZUA 2CG1A 3STDA 1B27A 4HJLB 5M19A 1TIJA 1ULJB 3ROBA 7STDA 2XEPA 2XSHB 1V74A 3S5CA 2C10A 1UDII 4HM2B 1MWTA 3WOEB 1EUIC 1IU7A 2BT3A 1S723 4J5KA 1UCKA 2OQEC 3LZAA 4BTYA 1KQS2 4IPBA 4K90B 1C7HA 1HZ1A 1BNSA 1LQMB 2BU4A 2BHMA 3DXOA 3UL6A 5IW9A 2ML5A 1QVG2 4GSPA 3S67A 1JZDA 4NHFA 3F8HA 2F5WA 3ALAA 4WYKB 2KF5A 1LOYA 1BRGA 1FUTA 1HYFA 2CG0A 3OWYA 1VQ73 1K8A4 3CPW2 1TJDA 1CYVA 1YVSA 2E2UA 1YJ93 3GZYB 2W0QA 5AEWB 1NDOB 1W01A 3HZPA 1VQ93 1FGMA 1A67A 2HMNB 2Q07A 3NBJA 3WODG 4CPKA 1HU9A 4NPBA 3WA2X 1E97A 3NXJA 3KIIA 1SIIA 3H51A 3K0ZA 4XBXA 4EV5A 4OK0A 1BRSA 1LVNA 2LYXA 1NB3I 1BNJA 2I9WA 1GS3A 2E2TA 1B2MA 1YIT3 2RFRA 1O7HB 2PZVA 2SARA 3T0UA 2H0HA 4R9KA 1Q40A 1RMSA 3HOHA 3VF1A 1PU4A 4BU4A 1BNFA 3M8CA 1EQKA 2JQ5A 1FUSA 1RGKA 3BNCA 4IIAA 4FCMA 1IYYA 1I2FA 1B2SA 1KC84 1WMNA 3K5TA 1RGGA 4N6TA 2B1XB 1C54A 2UX0A 4FMCA 4GB5A 1GY7A 1W5ZA 4JRFA 5BIRA 3FG4A 1OGZA 3F7SA 1ASKA 1YJN3 2KF3A 2W04A 2F98A 2WOFA 3EQQB 4N6UA 1CYUA 4LSOA 5D82A 4CDLA 3X42A 3MKIA 1BGSA 1B3SA 1LOWA 1W6YA 1TRQA 3SXXA 1JNQA 2OQEA 1QAFA 5D83A 3DGYA 1Q9EA 4HVNA 3CCU3 1DYUA 1Q814 3EF8A 1W6GA 3A76A 4RNZA 4WWUC 2OTL3 3DGMA 2BMRB 3K63A 2GBWB 4CJNA 2AADA 2BMOB 3N8BA 3ZG5A 1AQZA 1D6ZA 2A15A 3F9SA 2ZA4A 3LTBA 4FMDA 1S5AA 3O8YA 1OCVA 1KSIA 1N8QA 3MWZA 9RNTA 1YJW3 1J2BA 1FGOA 1WTHA 4XDWA 1O7GB 5GSPA 7GSPA 3KE7A 2Y74A 2YFLB 1BSCA 3FF2A 3LXUX 3NBRA 1OF5B 1X1YA 3CU3A 4EBGA 5AIFA 1LNIA 2QIYA 3V98A 1RGFA 4DKIA 2IA7A 1RLSA 3KSPA 4OUQA 1IQ8A 1KD14 2O9UX 3FLJA 5EVHA 2SBLA 3S29A 2IYJA 3DY5A 4KZ1A 5G1LA 1JZOA 2K0MA 4HYZA 2HMKB 4AEQA 1GD3A 1RN1A 4MMZB 1VQ53 1PY3A 2RGQA 3U97A 3CCJ3 2GU3A 3B4OA 1N5HA 1B2UA 1ROVA 4HM0B 1ROAA 4I5QA 4HBRA 3X41A 1JB5A 3CMA3 1WNHA 3D3LA 1W02A 1STDA 1T3BA 1A2PA 1YGEA 5IG0A 1VQM3 3JUQA 1RN4A 5AEUB 4R80A 3RGAA 3EB8A 2IUJA 3FF0A 1N9JA 2XH9A 4HM7B 1JN5B 1GY5A 4LMIA 5AIHA 3B4PA 3X40A 3F8XA 1QALA 1RJOA 1O7MB 1UCIA 5BVBA 2B24B 1BSDA 3Q1CA 1SJWA 2CWTA 5IF6A 4K1VA 1RCKA 8RNTA 1IT7A 1GMQA 2IY2A 5CF2A 1A2VA 2GU1A 3EN1B 2F4YA 4HM4B 1QVF2 4O02B 3T8NA 1T5YA 3LTCA 2OOVC 3MPHA 4N6OB 2XF3A 5ELJA 5STDA 1PFPA 1IV7A 2F86B 4RNTA 3UB1A 3CCQ3 3NUVA 4J9AA 2KRTA 3F40A 1UGHI 1HKXA 5IEOA 3NQZA 3VSYA 2O3OA 4ORLA 4J8TA 5AIGA 1MWRA 1NNVA 1CEWI 2XGNA 3EN8A 1LQGC 2FNQA 4HM5B 3G4S3 3PCRA 3UJMA 2HMJB 3RDEA 3PZWA 3FGYA 4JF8A 2KXGA 2WOHA 1JBSA 1OHSA 2UUGC 4L8OA 4KVHA 1FA3A 3BB9A 1I2EA 2CH9A 2D1WA 1GOUA 2L4VA 3ECFA 4R9LA 1AY7A 1AVLA 1WQLB 3IJEB 2FXTA 1BUJA 1UW1A 1OGXA 3OWUA 5G2GA 1NWWA 1T2IA 3MG1A 1DMQA 3LYGA 3GSPA 1RGEA 4KFDA 1O7NB 1RGCA 1RGLA 2D42A 3K7CA 1B2XA 4BL3A 1CQSA 1M9GA 2HMOB 4XB5A 5LC6A 1MWSA 1BANA 3KFQC 1W7CA 1RTUA 4J5GA 1O7PB 3MSOA 3X3XA 2J8XB 1W6CA 2CWUA 2Y73A 3EHCA 5EQLA 1EG9B 3EBYA 2QA43 1A90A 3NM7A 1FYSA 1IVVA 3SYUA 4NREA 3NHXA 2Z7AA 1BSBA 2HOHA 1F8NA 1FW7A 1DE3A 4K61A 1OHPA 4U13A 1AV4A 4XM4A 2C11A 2IMJA 3V92A 3I563 3CC23 1YIJ3 5BU4A 5KP3A 4BL2A 2BIRA 2CK3H 1RRHA 2XRXB 1T2HA 4LZIA 3WA3A 1N5PA 3QK9A 4R4KA 1IQXA 2MF7A 1TUHA 1G02A 1R4YA 1QAKA 4G1MB 1EA2A 3OX9A 1GMPA 2OOVA 3DUKA 1VQQA 2CFKA 3Q90A 1Y4KA 1LNHA 2GBXB 1V57A 3EC9A 4WFOA 4RZMA 3CNXA 4X2HA 4XBYA 1SQWA 2CFDA 2F5MA 2UGIA 3U1WA 3DMCA 3NV0A 1OF5A 2P0XA 4BIRA 1NB5I 4MMYB 3LH4A 5CF1A 2Z76A 3D5GA 3S28A 1OH0A 2CX1A 3BIRA 1RGAA 1DVDA 1UUWB 2V1LA 3G16A 3BNDA 3D5IA 3OV4A 3BLZA 3LT8A 4K1UA 1US1A 2FGTA 3RGRA 3EE1A 3CC73 1TRPA 2KAAA 3AHSA 3WHOA 3ZG0A 1X1UA 1GSPA 1U5OA 4AKZA 1JKGA 2YX9A 4GL6A 5LC7A 1SIHA 1JBTA 3AMOB 1JBRA 1Z1SA 3GZRA 3SOAA 3OW22 1TFOA 5A0OB 4N6V0 4FCJA 2RBIA 3FG1A 5CXOA 5IG3A 2CC3A 2R4IA 3PGBA 2K3DA 1BNEA 2W56A 1IV9A 1JN5A 1Q40B 3JUMA 1QJGA 1GY6A 3PYJA 1RGHA 1K41A 1BVIA 1NU3A 1Q7HA 4CCVA 2YFJB 2CHCA 3TDGA 1N9EA 1VQN3 3F14A 3URPA 3JUOA 1BSAA 4I4KA 3ZFZA 1R4CA 3D79A 3I553 3FZWA 4HKVB 2GSPA 2Z6BA 1CH0A 4ZM8A 5IG4A 3G713 1LOVA 1PYLA 3LTDA 2WGOA 2KCDA 1FGTA 5EEOA 1VQL3 1VQ63 3D4AA 3GAXA 5I97A 2M7OA 3SLUA 4N3VA 1SARA 1BNRA 4EYCA 4WHAA 1I3FA 1UUGB 2PNCA 2W2CA 5JPUA 4HZ9B 1M1XB 3EBTA 1DMNA 1BU4A 3DGLA 1BNGA 5CLKA 5JPPA 4PEJA 4EC6A 7RNTA 1TU5A 1ZGXA 2GEXA 3CCM3 3KSED 2R41A 3SX1A 6RNTA 4O3VA 2QEX3 1W2B2 3Q2PA 4HM8B 4WYKA 1I0XA 3JUNA 1BRNL 2WGQA 3PCSA 3CCE3 1Q864 3FKAA 5DREA 1M904 2CFLA 5DRVA 1AR0A 1UGIA 1VZZA 2GXFA 3PS8A 1VQK3 1BAOA 4MEIA 1DVCA 1YHQ3 4BTWA 3H3HA 4H3UA 4STDA 3BNEA 4HM6B 2ML6A 3LTAA 1JB4A 3WR2A 3JUPA 1A2KA 1B20A 5JBSA 4HZBB 1MNLA 1RN7A 4L8PA 1MGRA 2H0GA 5IG5A 1RDSA 2F56A 4EW5A 5IENA 3CME3 2IUKA 1BRIA 3KN4A 1FGQA 3EJVA 5D81A 3CCR3 1GOVA 3NM2A 1VQO3 1VQ43 5M18A 1X1WA 2CW9A 1L5GB 1I70A 3FCSB 2MC8A 3WDGB 2HMLB 3FG3A 4MJDA 3G0KA 3L0RA 1Q42A 4HM1B 4MMXB 5FGOA 2Z77A 4QWTA 2ZDJA 4XDVA 3HK4A 3LMLA 3DM8A 4BTXA 2BO9B 2HMMB 1DMMA 2CFWA 3V99A 6STDA 1VQP3 1OHOA 1JB2A 3CC43 1UCJA 1BNIA 2H0IA 1ISKA 3N54B 2RCDA 3DH2A 5KP1A 1IVXA 3CCL3 1TFKA 2P0MA 4HAAA 1Q7Y4 4KFFA 2CIUA 4FMBA 1GOYA 2OTJ3 5AIIA 5AI1A 2XFSA 3SOYA 4N6MA 4O8SA 2CX0A 1I3IA 1MGWA 1K9M4 1IVWA 4XBTA 3KZTA 3GZBA 4AKYA 3IMAB 4Q53A 3GRDA 3AMOA 1QMAA 1STFI 1V58A 3QRDA 4L7KA 1ULIB 3VGNA 1IVUA 4N6LA 3HI7A 1JRQA 1NO3A 3MHEA 1LRAA 3Q3FA 3OXAA 3NQYA 1I0VA 2XR8B 3GWRA 5KP4A 1AVKA 2KF6A 3G8ZA 2XGLA 4EV2A 3CNMA 1OUNA 3ER7A 1EKMA 3B8LA 1GYBA 1EEJA 1ZX2A 4KT3B 4X2OA 2STDA 3MG3A 1RNTA 2XSOB 1D6UA 3HX8A 4H61A 3F7XA 1WMPA 3AHWA 1W2ZA 1YNVX 3AGOA 3DGOA 1UI8A 3NX0A 1BIRA 2F99A 2BMQB 1W00A 2INXA 2K54A 4N6NB 4RNYA 4RBNA 1UCLA 4WP5A 1IK3A 2P05A 3AGNA 1UI7A 4HOHA 4LGQA 1E3RA 1MOLA 2W03A 3T8UA 3D9RA 4HM3B 2AAEA 3HIIA 1GMRA 1BOXA 3I0YA 3X3YA 5IEPA 1IQYA 2WO0A 1KWIA 1RHLA 1VQ83 3LT9A 1IT8A 2JDIH 5AYSC 4ILFA 1MWUA 3X3ZA 2ZHXB 3HIGA 3OWSA 1JJ22 3SEDA 1ZO2A 3KKGA 5M1AA 1D6YA 3N9HA 3UL5A 8CHOA 4LYLB 1BSEA 3FSDA
chains in the Genus database with same CATH topology
2P09A 1YVBI 1YI23 3CCV3 4O2HA 1SPUA 4TX4A 4KFEA 1WMOA 3NV0B 3B7CA 3S27A 1OACA 3WMDA 1Q824 2W9QA 3DZLA 3GZXB 1K28A 3MG2A 1GD4A 1JV2B 2BNGA 3MYTA 1O7WB 4LEHA 3WOFB 2E2VA 3E99A 1K734 1BUQA 3DGNA 1IDPA 3BNBA 1FGRA 1W4NA 2W6JH 1JKGB 1OPYA 2CFGA 2RSXA 2ZL8A 1TP6A 5CK6A 2QGUA 3PXMA 2P38A 2LQVA 3J7Yd 5BXQA 3CXC2 1M1K4 3UNLA 2W9PA 3NBBA 1E3VA 5TGNA 1LXEA 4OVMA 2OCTA 2W56B 4R1KA 5FW5A 1RKYA 3JVCA 5IERA 3G6E3 3K9MC 1U8CB 2XFTA 2GEYA 5ELUA 1FUWA 2OWPA 1UUVB 3CCS3 3CD63 1LOXA 2CWVA 4FMAA 5AYRB 1N8R4 1NJI4 3FH1A 3CPOA 3IPTA 4IT7A 4FR9A 1RRLA 4EXRA 2YFIB 3EX9A 3LOYA 1G96A 1J2BA 2CKFB 4FCZA 5HGRA 2CG1A 3STDA 4HJLB 1TIJA 1ULJB 3ROBA 7STDA 2XEPA 2XSHB 1V74A 3S5CA 2C10A 4HM2B 3WOEB 1IU7A 2BT3A 1S723 2OQEC 3LZAA 4BTYA 1KQS2 4IPBA 4K90B 1C7HA 3DXOA 2BHMA 3UL6A 5IW9A 2ML5A 1QVG2 3S67A 4NHFA 3F8HA 3ALAA 4WYKB 2CG0A 3OWYA 1K8A4 1VQ73 3CPW2 1CYVA 2E2UA 1YJ93 3GZYB 2W0QA 5AEWB 1NDOB 1W01A 3HZPA 1VQ93 1FGMA 1A67A 2HMNB 2Q07A 3NBJA 3WODG 1HU9A 3WA2X 1E97A 3NXJA 3KIIA 1SIIA 3H51A 3K0ZA 4XBXA 4EV5A 4OK0A 1LVNA 2LYXA 1NB3I 2I9WA 1GS3A 2E2TA 1YIT3 2RFRA 1O7HB 2PZVA 3T0UA 4R9KA 1Q40A 3VF1A 1PU4A 3M8CA 1EQKA 2JQ5A 3BNCA 4IIAA 4FCMA 1KC84 1WMNA 3K5TA 4N6TA 2B1XB 2UX0A 4FMCA 4GB5A 1GY7A 1W5ZA 4JRFA 3FG4A 1OGZA 3F7SA 1ASKA 1YJN3 2WOFA 2W04A 2F98A 3EQQB 4N6UA 1CYUA 4LSOA 5D82A 4CDLA 3X42A 3MKIA 1W6YA 3SXXA 1JNQA 2OQEA 1QAFA 5D83A 3CCU3 4HVNA 1DYUA 1Q814 3EF8A 1W6GA 3A76A 4RNZA 4WWUC 2OTL3 3DGMA 2BMRB 3K63A 2GBWB 2BMOB 3N8BA 1D6ZA 2A15A 3F9SA 3LTBA 4FMDA 1S5AA 3O8YA 1OCVA 1KSIA 1N8QA 3MWZA 1YJW3 1FGOA 1WTHA 4XDWA 1O7GB 3KE7A 2Y74A 2YFLB 3FF2A 3LXUX 3NBRA 1OF5B 3CU3A 4EBGA 5AIFA 2QIYA 3V98A 2IA7A 3KSPA 4OUQA 1IQ8A 1KD14 2O9UX 3FLJA 5EVHA 2SBLA 3S29A 3DY5A 4KZ1A 2K0MA 4HYZA 2HMKB 4AEQA 1GD3A 4MMZB 1VQ53 2RGQA 3U97A 3CCJ3 2GU3A 3B4OA 1N5HA 1ROVA 4HM0B 1ROAA 4HBRA 3X41A 1JB5A 3CMA3 1WNHA 3D3LA 1W02A 1STDA 1YGEA 5IG0A 1VQM3 3JUQA 5AEUB 4R80A 3RGAA 3EB8A 2IUJA 3FF0A 1N9JA 2XH9A 4HM7B 1JN5B 1GY5A 4LMIA 5AIHA 3B4PA 3X40A 3F8XA 1QALA 1RJOA 1O7MB 5BVBA 2B24B 3Q1CA 1SJWA 2CWTA 5IF6A 4K1VA 1IT7A 5CF2A 1A2VA 2GU1A 3EN1B 4HM4B 1QVF2 4O02B 3T8NA 1T5YA 3LTCA 2OOVC 3MPHA 4N6OB 2XF3A 5ELJA 5STDA 1PFPA 1IV7A 2F86B 3UB1A 3CCQ3 3NUVA 4J9AA 2KRTA 3F40A 1HKXA 5IEOA 3NQZA 3VSYA 2O3OA 4ORLA 4J8TA 5AIGA 1CEWI 2XGNA 3EN8A 2FNQA 4HM5B 3G4S3 3PCRA 3UJMA 2HMJB 3RDEA 3PZWA 3FGYA 4JF8A 2KXGA 2WOHA 1OHSA 4L8OA 4KVHA 1FA3A 3BB9A 2CH9A 2D1WA 2L4VA 3ECFA 1W2B2 4R9LA 3IJEB 1AVLA 1WQLB 2FXTA 1UW1A 1OGXA 3OWUA 5G2GA 1NWWA 3MG1A 1DMQA 3LYGA 4KFDA 1O7NB 2D42A 3K7CA 1CQSA 1M9GA 2HMOB 4XB5A 5LC6A 3KFQC 1W7CA 1O7PB 3MSOA 3X3XA 2QA43 1W6CA 2CWUA 2Y73A 3EHCA 5EQLA 1EG9B 3EBYA 1A90A 3NM7A 1IVVA 4NREA 3NHXA 2Z7AA 1F8NA 4K61A 1OHPA 4U13A 1AV4A 4XM4A 2C11A 2IMJA 3V92A 3I563 3CC23 1YIJ3 5KP3A 2CK3H 1RRHA 2XRXB 4LZIA 3WA3A 1N5PA 3QK9A 4R4KA 1IQXA 2MF7A 1TUHA 1QAKA 4G1MB 1EA2A 3OX9A 2OOVA 3DUKA 2CFKA 3Q90A 1Y4KA 1LNHA 2GBXB 3EC9A 4WFOA 4RZMA 3CNXA 4X2HA 4XBYA 1SQWA 2CFDA 3U1WA 3DMCA 3NV0A 1OF5A 2P0XA 1NB5I 4MMYB 3LH4A 5CF1A 2Z76A 3S28A 1OH0A 1DVDA 1UUWB 2V1LA 3G16A 3BNDA 3OV4A 3BLZA 3LT8A 4K1UA 1US1A 2FGTA 3RGRA 3EE1A 3CC73 1U5OA 4AKZA 1JKGA 2YX9A 4GL6A 5LC7A 1SIHA 3AMOB 1Z1SA 3GZRA 3SOAA 3OW22 1TFOA 5A0OB 4N6V0 4FCJA 3FG1A 5CXOA 5IG3A 2CC3A 2R4IA 3PGBA 2W56A 1IV9A 1JN5A 1Q40B 3JUMA 1QJGA 1GY6A 3PYJA 1K41A 1NU3A 4CCVA 2YFJB 2CHCA 3TDGA 1N9EA 1VQN3 3F14A 3JUOA 4I4KA 1R4CA 3I553 3FZWA 4HKVB 2Z6BA 4ZM8A 5IG4A 3G713 3LTDA 2WGOA 2KCDA 1FGTA 5EEOA 1VQL3 1VQ63 3GAXA 5I97A 2M7OA 3SLUA 4N3VA 4EYCA 4WHAA 2PNCA 2W2CA 5JPUA 4HZ9B 1M1XB 3EBTA 1DMNA 3DGLA 5CLKA 5JPPA 4PEJA 4EC6A 1TU5A 2GEXA 3CCM3 3KSED 3SX1A 4O3VA 2QEX3 3Q2PA 4HM8B 4WYKA 3JUNA 2WGQA 3PCSA 3CCE3 1Q864 3FKAA 5DREA 1M904 2CFLA 5DRVA 1AR0A 2GXFA 1VZZA 3PS8A 1VQK3 4MEIA 1DVCA 1YHQ3 4BTWA 3H3HA 4H3UA 4STDA 3BNEA 4HM6B 2ML6A 3LTAA 1JB4A 3JUPA 1A2KA 5JBSA 4HZBB 1MNLA 1RN7A 4L8PA 5IG5A 5IENA 3CME3 2IUKA 3CCR3 3KN4A 1FGQA 3EJVA 5D81A 1VQO3 3NM2A 1VQ43 2CW9A 1L5GB 3FCSB 2MC8A 3WDGB 2HMLB 3FG3A 4MJDA 3G0KA 3L0RA 1Q42A 4HM1B 4MMXB 5FGOA 2Z77A 4QWTA 2ZDJA 4XDVA 3HK4A 3LMLA 3DM8A 4BTXA 2BO9B 2HMMB 1DMMA 2CFWA 3V99A 6STDA 1VQP3 1OHOA 1JB2A 3CC43 1ISKA 3N54B 2RCDA 5KP1A 1IVXA 3CCL3 1TFKA 2P0MA 1Q7Y4 4KFFA 2CIUA 4FMBA 2OTJ3 5AIIA 5AI1A 2XFSA 3SOYA 4N6MA 4O8SA 1K9M4 1IVWA 4XBTA 3KZTA 3GZBA 4AKYA 3IMAB 4Q53A 3GRDA 3AMOA 1QMAA 1STFI 3QRDA 4L7KA 1ULIB 3VGNA 1IVUA 4N6LA 3HI7A 1JRQA 1NO3A 3MHEA 3OXAA 3NQYA 2XR8B 3GWRA 5KP4A 1AVKA 3G8ZA 2XGLA 4EV2A 3CNMA 1OUNA 3ER7A 1EKMA 3B8LA 1GYBA 1ZX2A 4X2OA 2STDA 3MG3A 2XSOB 1D6UA 3HX8A 4H61A 3F7XA 1WMPA 1W2ZA 3DGOA 3NX0A 1UI8A 4N6NB 2F99A 2BMQB 1W00A 2INXA 2K54A 4WP5A 4RNYA 4RBNA 3SVAA 1IK3A 2P05A 4LGQA 1UI7A 1E3RA 1MOLA 2W03A 3T8UA 3D9RA 4HM3B 3HIIA 3I0YA 5IEPA 3X3YA 1IQYA 2WO0A 1KWIA 1VQ83 3LT9A 1IT8A 2JDIH 5AYSC 3X3ZA 3HIGA 3OWSA 1JJ22 3SEDA 1ZO2A 3KKGA 1D6YA 3N9HA 3UL5A 8CHOA 3FSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NV0 B;  3B7C A;  3WMD A;  3DZL A;  3GZX B;  3MG2 A;  2BNG A;  3MYT A;  1O7W B;  4LEH A;  3E99 A;  1BUQ A;  1IDP A;  1JKG B;  1OPY A;  5CK6 A;  1TP6 A;  2QGU A;  5BXQ A;  3UNL A;  1E3V A;  5TGN A;  4OVM A;  4R1K A;  5FW5 A;  5IER A;  2GEY A;  2OWP A;  1UUV B;  3FH1 A;  3CPO A;  3IPT A;  2YFI B;  3EX9 A;  2CKF B;  5HGR A;  3STD A;  4HJL B;  1ULJ B;  3ROB A;  7STD A;  2XSH B;  3S5C A;  4HM2 B;  3LZA A;  1C7H A;  3DXO A;  3F8H A;  4WYK B;  3OWY A;  3GZY B;  5AEW B;  1NDO B;  1W01 A;  3HZP A;  2HMN B;  1E97 A;  3NXJ A;  3H51 A;  3K0Z A;  4XBX A;  2I9W A;  1GS3 A;  2RFR A;  1O7H B;  2PZV A;  4R9K A;  1Q40 A;  3M8C A;  2JQ5 A;  4IIA A;  4FCM A;  2B1X B;  2UX0 A;  4GB5 A;  1GY7 A;  1OGZ A;  3F7S A;  1ASK A;  2F98 A;  3EQQ B;  5D82 A;  4CDL A;  3MKI A;  1W6Y A;  5D83 A;  4HVN A;  3EF8 A;  3A76 A;  4WWU C;  2BMR B;  2GBW B;  2BMO B;  2A15 A;  3F9S A;  1S5A A;  1OCV A;  4XDW A;  1O7G B;  3KE7 A;  2YFL B;  3FF2 A;  3NBR A;  1OF5 B;  3CU3 A;  5AIF A;  2QIY A;  3KSP A;  4OUQ A;  3FLJ A;  5EVH A;  2HMK B;  2RGQ A;  3B4O A;  4HM0 B;  1JB5 A;  1W02 A;  1STD A;  5IG0 A;  3JUQ A;  5AEU B;  3RGA A;  3FF0 A;  4HM7 B;  5AIH A;  1JN5 B;  1GY5 A;  4LMI A;  3B4P A;  3F8X A;  1O7M B;  5BVB A;  2B24 B;  1SJW A;  5IF6 A;  4K1V A;  5CF2 A;  3EN1 B;  4HM4 B;  3T8N A;  5STD A;  2F86 B;  3NUV A;  4J9A A;  3F40 A;  1HKX A;  5IEO A;  3VSY A;  4ORL A;  4J8T A;  5AIG A;  3EN8 A;  4HM5 B;  3UJM A;  2HMJ B;  3FGY A;  1OHS A;  4L8O A;  4KVH A;  3BB9 A;  3ECF A;  4R9L A;  1WQL B;  1OGX A;  3OWU A;  5G2G A;  1NWW A;  3MG1 A;  3LYG A;  1DMQ A;  1O7N B;  3K7C A;  1CQS A;  2HMO B;  4XB5 A;  1O7P B;  3MSO A;  3EHC A;  1EG9 B;  3EBY A;  3NHX A;  2Z7A A;  1OHP A;  4U13 A;  4XM4 A;  2IMJ A;  5KP3 A;  2XRX B;  1TUH A;  1EA2 A;  3OX9 A;  3DUK A;  3Q90 A;  2GBX B;  3EC9 A;  4RZM A;  3CNX A;  4XBY A;  4X2H A;  3DMC A;  3NV0 A;  1OF5 A;  5CF1 A;  2Z76 A;  1OH0 A;  1UUW B;  3G16 A;  3OV4 A;  3BLZ A;  4K1U A;  3RGR A;  1U5O A;  1JKG A;  1Z1S A;  3GZR A;  3SOA A;  4FCJ A;  5CXO A;  5IG3 A;  2R4I A;  1JN5 A;  1Q40 B;  3JUM A;  1QJG A;  1GY6 A;  1K41 A;  1NU3 A;  2YFJ B;  2CHC A;  3F14 A;  3JUO A;  4I4K A;  3FZW A;  4HKV B;  5IG4 A;  4N3V A;  2W2C A;  5JPU A;  4HZ9 B;  3EBT A;  1DMN A;  5CLK A;  5JPP A;  4PEJ A;  2GEX A;  4HM8 B;  4WYK A;  3JUN A;  3FKA A;  5DRE A;  5DRV A;  1AR0 A;  2GXF A;  1VZZ A;  3H3H A;  4H3U A;  4STD A;  4HM6 B;  1JB4 A;  3JUP A;  1A2K A;  4HZB B;  4L8P A;  5IG5 A;  5IEN A;  3EJV A;  5D81 A;  3NM2 A;  2HML B;  4MJD A;  3G0K A;  1Q42 A;  4HM1 B;  2Z77 A;  4XDV A;  3HK4 A;  3DM8 A;  2HMM B;  1DMM A;  6STD A;  1OHO A;  1JB2 A;  1ISK A;  2RCD A;  5KP1 A;  5AII A;  5AI1 A;  3SOY A;  4XBT A;  3KZT A;  3GZB A;  4Q53 A;  3GRD A;  1QMA A;  4L7K A;  1ULI B;  3VGN A;  3MHE A;  3OXA A;  2XR8 B;  3GWR A;  5KP4 A;  3G8Z A;  3CNM A;  1OUN A;  3ER7 A;  3B8L A;  1GYB A;  1ZX2 A;  4X2O A;  2STD A;  3MG3 A;  2XSO B;  3HX8 A;  3F7X A;  2F99 A;  2BMQ B;  1W00 A;  2INX A;  2K54 A;  4WP5 A;  4LGQ A;  1E3R A;  3T8U A;  3D9R A;  4HM3 B;  3I0Y A;  5IEP A;  3OWS A;  3SED A;  1ZO2 A;  3KKG A;  8CHO A;  3FSD A; 
#chains in the Genus database with same CATH topology
 5RNT A;  2P09 A;  1YVB I;  1YI2 3;  3CCV 3;  4O2H A;  1SPU A;  4TX4 A;  6GSP A;  2KF4 A;  4KFE A;  5G1K A;  2RNT A;  1WMO A;  3NV0 B;  3B7C A;  2L1S A;  3S27 A;  1OAC A;  3WMD A;  1Q82 4;  2W9Q A;  1RSN A;  3DZL A;  1K28 A;  1YGW A;  3GZX B;  3MG2 A;  1GD4 A;  1JV2 B;  2BNG A;  3MYT A;  1O7W B;  4LEH A;  3WOF B;  2E2V A;  1TTO A;  1DET A;  3E99 A;  1K73 4;  1I2G A;  1BUQ A;  3DGN A;  1IDP A;  3BNB A;  1BRK A;  3RNT A;  1FGR A;  1W4N A;  2W6J H;  1JKG B;  1OPY A;  2CFG A;  2RSX A;  2ZL8 A;  1TP6 A;  5CK6 A;  2QGU A;  3PXM A;  2P38 A;  2LQV A;  3J7Y d;  5BXQ A;  3CXC 2;  1M1K 4;  3UNL A;  2C4B A;  2W9P A;  3NBB A;  1E3V A;  5TGN A;  1LXE A;  4OVM A;  2OCT A;  1X1X A;  2W56 B;  1B2Z A;  4R1K A;  5FW5 A;  1RKY A;  3JVC A;  5IER A;  3G6E 3;  3K9M C;  1U8C B;  2XFT A;  4GHO A;  2GEY A;  5ELU A;  1FUW A;  2OWP A;  1I8V A;  1UUV B;  1B21 A;  3CCS 3;  1LOX A;  1BRJ A;  2CWV A;  4FMA A;  3CD6 3;  5AYR B;  5HOH A;  1N8R 4;  1NJI 4;  3BU4 A;  3FH1 A;  3CPO A;  3IPT A;  4IT7 A;  3KCH A;  4FR9 A;  1BRH A;  1RRL A;  4EXR A;  2YFI B;  3A5E A;  3EX9 A;  3LOY A;  1G96 A;  1RNB A;  3SVA A;  1RCL A;  2CKF B;  4FCZ A;  1G0T A;  5HGR A;  1ZS7 A;  1FZU A;  2CG1 A;  3STD A;  1B27 A;  4HJL B;  5M19 A;  1TIJ A;  1ULJ B;  3ROB A;  7STD A;  2XEP A;  2XSH B;  1V74 A;  3S5C A;  2C10 A;  1UDI I;  4HM2 B;  1MWT A;  3WOE B;  1EUI C;  1IU7 A;  2BT3 A;  1S72 3;  4J5K A;  1UCK A;  2OQE C;  3LZA A;  4BTY A;  1KQS 2;  4IPB A;  4K90 B;  1C7H A;  1HZ1 A;  1BNS A;  1LQM B;  2BU4 A;  2BHM A;  3DXO A;  3UL6 A;  5IW9 A;  2ML5 A;  1QVG 2;  4GSP A;  3S67 A;  1JZD A;  4NHF A;  3F8H A;  2F5W A;  3ALA A;  4WYK B;  2KF5 A;  1LOY A;  1BRG A;  1FUT A;  1HYF A;  2CG0 A;  3OWY A;  1VQ7 3;  1K8A 4;  3CPW 2;  1TJD A;  1CYV A;  1YVS A;  2E2U A;  1YJ9 3;  3GZY B;  2W0Q A;  5AEW B;  1NDO B;  1W01 A;  3HZP A;  1VQ9 3;  1FGM A;  1A67 A;  2HMN B;  2Q07 A;  3NBJ A;  3WOD G;  4CPK A;  1HU9 A;  4NPB A;  3WA2 X;  1E97 A;  3NXJ A;  3KII A;  1SII A;  3H51 A;  3K0Z A;  4XBX A;  4EV5 A;  4OK0 A;  1BRS A;  1LVN A;  2LYX A;  1NB3 I;  1BNJ A;  2I9W A;  1GS3 A;  2E2T A;  1B2M A;  1YIT 3;  2RFR A;  1O7H B;  2PZV A;  2SAR A;  3T0U A;  2H0H A;  4R9K A;  1Q40 A;  1RMS A;  3HOH A;  3VF1 A;  1PU4 A;  4BU4 A;  1BNF A;  3M8C A;  1EQK A;  2JQ5 A;  1FUS A;  1RGK A;  3BNC A;  4IIA A;  4FCM A;  1IYY A;  1I2F A;  1B2S A;  1KC8 4;  1WMN A;  3K5T A;  1RGG A;  4N6T A;  2B1X B;  1C54 A;  2UX0 A;  4FMC A;  4GB5 A;  1GY7 A;  1W5Z A;  4JRF A;  5BIR A;  3FG4 A;  1OGZ A;  3F7S A;  1ASK A;  1YJN 3;  2KF3 A;  2W04 A;  2F98 A;  2WOF A;  3EQQ B;  4N6U A;  1CYU A;  4LSO A;  5D82 A;  4CDL A;  3X42 A;  3MKI A;  1BGS A;  1B3S A;  1LOW A;  1W6Y A;  1TRQ A;  3SXX A;  1JNQ A;  2OQE A;  1QAF A;  5D83 A;  3DGY A;  1Q9E A;  4HVN A;  3CCU 3;  1DYU A;  1Q81 4;  3EF8 A;  1W6G A;  3A76 A;  4RNZ A;  4WWU C;  2OTL 3;  3DGM A;  2BMR B;  3K63 A;  2GBW B;  4CJN A;  2AAD A;  2BMO B;  3N8B A;  3ZG5 A;  1AQZ A;  1D6Z A;  2A15 A;  3F9S A;  2ZA4 A;  3LTB A;  4FMD A;  1S5A A;  3O8Y A;  1OCV A;  1KSI A;  1N8Q A;  3MWZ A;  9RNT A;  1YJW 3;  1J2B A;  1FGO A;  1WTH A;  4XDW A;  1O7G B;  5GSP A;  7GSP A;  3KE7 A;  2Y74 A;  2YFL B;  1BSC A;  3FF2 A;  3LXU X;  3NBR A;  1OF5 B;  1X1Y A;  3CU3 A;  4EBG A;  5AIF A;  1LNI A;  2QIY A;  3V98 A;  1RGF A;  4DKI A;  2IA7 A;  1RLS A;  3KSP A;  4OUQ A;  1IQ8 A;  1KD1 4;  2O9U X;  3FLJ A;  5EVH A;  2SBL A;  3S29 A;  2IYJ A;  3DY5 A;  4KZ1 A;  5G1L A;  1JZO A;  2K0M A;  4HYZ A;  2HMK B;  4AEQ A;  1GD3 A;  1RN1 A;  4MMZ B;  1VQ5 3;  1PY3 A;  2RGQ A;  3U97 A;  3CCJ 3;  2GU3 A;  3B4O A;  1N5H A;  1B2U A;  1ROV A;  4HM0 B;  1ROA A;  4I5Q A;  4HBR A;  3X41 A;  1JB5 A;  3CMA 3;  1WNH A;  3D3L A;  1W02 A;  1STD A;  1T3B A;  1A2P A;  1YGE A;  5IG0 A;  1VQM 3;  3JUQ A;  1RN4 A;  5AEU B;  4R80 A;  3RGA A;  3EB8 A;  2IUJ A;  3FF0 A;  1N9J A;  2XH9 A;  4HM7 B;  1JN5 B;  1GY5 A;  4LMI A;  5AIH A;  3B4P A;  3X40 A;  3F8X A;  1QAL A;  1RJO A;  1O7M B;  1UCI A;  5BVB A;  2B24 B;  1BSD A;  3Q1C A;  1SJW A;  2CWT A;  5IF6 A;  4K1V A;  1RCK A;  8RNT A;  1IT7 A;  1GMQ A;  2IY2 A;  5CF2 A;  1A2V A;  2GU1 A;  3EN1 B;  2F4Y A;  4HM4 B;  1QVF 2;  4O02 B;  3T8N A;  1T5Y A;  3LTC A;  2OOV C;  3MPH A;  4N6O B;  2XF3 A;  5ELJ A;  5STD A;  1PFP A;  1IV7 A;  2F86 B;  4RNT A;  3UB1 A;  3CCQ 3;  3NUV A;  4J9A A;  2KRT A;  3F40 A;  1UGH I;  1HKX A;  5IEO A;  3NQZ A;  3VSY A;  2O3O A;  4ORL A;  4J8T A;  5AIG A;  1MWR A;  1NNV A;  1CEW I;  2XGN A;  3EN8 A;  1LQG C;  2FNQ A;  4HM5 B;  3G4S 3;  3PCR A;  3UJM A;  2HMJ B;  3RDE A;  3PZW A;  3FGY A;  4JF8 A;  2KXG A;  2WOH A;  1JBS A;  1OHS A;  2UUG C;  4L8O A;  4KVH A;  1FA3 A;  3BB9 A;  1I2E A;  2CH9 A;  2D1W A;  1GOU A;  2L4V A;  3ECF A;  4R9L A;  1AY7 A;  1AVL A;  1WQL B;  3IJE B;  2FXT A;  1BUJ A;  1UW1 A;  1OGX A;  3OWU A;  5G2G A;  1NWW A;  1T2I A;  3MG1 A;  1DMQ A;  3LYG A;  3GSP A;  1RGE A;  4KFD A;  1O7N B;  1RGC A;  1RGL A;  2D42 A;  3K7C A;  1B2X A;  4BL3 A;  1CQS A;  1M9G A;  2HMO B;  4XB5 A;  5LC6 A;  1MWS A;  1BAN A;  3KFQ C;  1W7C A;  1RTU A;  4J5G A;  1O7P B;  3MSO A;  3X3X A;  2J8X B;  1W6C A;  2CWU A;  2Y73 A;  3EHC A;  5EQL A;  1EG9 B;  3EBY A;  2QA4 3;  1A90 A;  3NM7 A;  1FYS A;  1IVV A;  3SYU A;  4NRE A;  3NHX A;  2Z7A A;  1BSB A;  2HOH A;  1F8N A;  1FW7 A;  1DE3 A;  4K61 A;  1OHP A;  4U13 A;  1AV4 A;  4XM4 A;  2C11 A;  2IMJ A;  3V92 A;  3I56 3;  3CC2 3;  1YIJ 3;  5BU4 A;  5KP3 A;  4BL2 A;  2BIR A;  2CK3 H;  1RRH A;  2XRX B;  1T2H A;  4LZI A;  3WA3 A;  1N5P A;  3QK9 A;  4R4K A;  1IQX A;  2MF7 A;  1TUH A;  1G02 A;  1R4Y A;  1QAK A;  4G1M B;  1EA2 A;  3OX9 A;  1GMP A;  2OOV A;  3DUK A;  1VQQ A;  2CFK A;  3Q90 A;  1Y4K A;  1LNH A;  2GBX B;  1V57 A;  3EC9 A;  4WFO A;  4RZM A;  3CNX A;  4X2H A;  4XBY A;  1SQW A;  2CFD A;  2F5M A;  2UGI A;  3U1W A;  3DMC A;  3NV0 A;  1OF5 A;  2P0X A;  4BIR A;  1NB5 I;  4MMY B;  3LH4 A;  5CF1 A;  2Z76 A;  3D5G A;  3S28 A;  1OH0 A;  2CX1 A;  3BIR A;  1RGA A;  1DVD A;  1UUW B;  2V1L A;  3G16 A;  3BND A;  3D5I A;  3OV4 A;  3BLZ A;  3LT8 A;  4K1U A;  1US1 A;  2FGT A;  3RGR A;  3EE1 A;  3CC7 3;  1TRP A;  2KAA A;  3AHS A;  3WHO A;  3ZG0 A;  1X1U A;  1GSP A;  1U5O A;  4AKZ A;  1JKG A;  2YX9 A;  4GL6 A;  5LC7 A;  1SIH A;  1JBT A;  3AMO B;  1JBR A;  1Z1S A;  3GZR A;  3SOA A;  3OW2 2;  1TFO A;  5A0O B;  4N6V 0;  4FCJ A;  2RBI A;  3FG1 A;  5CXO A;  5IG3 A;  2CC3 A;  2R4I A;  3PGB A;  2K3D A;  1BNE A;  2W56 A;  1IV9 A;  1JN5 A;  1Q40 B;  3JUM A;  1QJG A;  1GY6 A;  3PYJ A;  1RGH A;  1K41 A;  1BVI A;  1NU3 A;  1Q7H A;  4CCV A;  2YFJ B;  2CHC A;  3TDG A;  1N9E A;  1VQN 3;  3F14 A;  3URP A;  3JUO A;  1BSA A;  4I4K A;  3ZFZ A;  1R4C A;  3D79 A;  3I55 3;  3FZW A;  4HKV B;  2GSP A;  2Z6B A;  1CH0 A;  4ZM8 A;  5IG4 A;  3G71 3;  1LOV A;  1PYL A;  3LTD A;  2WGO A;  2KCD A;  1FGT A;  5EEO A;  1VQL 3;  1VQ6 3;  3D4A A;  3GAX A;  5I97 A;  2M7O A;  3SLU A;  4N3V A;  1SAR A;  1BNR A;  4EYC A;  4WHA A;  1I3F A;  1UUG B;  2PNC A;  2W2C A;  5JPU A;  4HZ9 B;  1M1X B;  3EBT A;  1DMN A;  1BU4 A;  3DGL A;  1BNG A;  5CLK A;  5JPP A;  4PEJ A;  4EC6 A;  7RNT A;  1TU5 A;  1ZGX A;  2GEX A;  3CCM 3;  3KSE D;  2R41 A;  3SX1 A;  6RNT A;  4O3V A;  2QEX 3;  1W2B 2;  3Q2P A;  4HM8 B;  4WYK A;  1I0X A;  3JUN A;  1BRN L;  2WGQ A;  3PCS A;  3CCE 3;  1Q86 4;  3FKA A;  5DRE A;  1M90 4;  2CFL A;  5DRV A;  1AR0 A;  1UGI A;  1VZZ A;  2GXF A;  3PS8 A;  1VQK 3;  1BAO A;  4MEI A;  1DVC A;  1YHQ 3;  4BTW A;  3H3H A;  4H3U A;  4STD A;  3BNE A;  4HM6 B;  2ML6 A;  3LTA A;  1JB4 A;  3WR2 A;  3JUP A;  1A2K A;  1B20 A;  5JBS A;  4HZB B;  1MNL A;  1RN7 A;  4L8P A;  1MGR A;  2H0G A;  5IG5 A;  1RDS A;  2F56 A;  4EW5 A;  5IEN A;  3CME 3;  2IUK A;  1BRI A;  3KN4 A;  1FGQ A;  3EJV A;  5D81 A;  3CCR 3;  1GOV A;  3NM2 A;  1VQO 3;  1VQ4 3;  5M18 A;  1X1W A;  2CW9 A;  1L5G B;  1I70 A;  3FCS B;  2MC8 A;  3WDG B;  2HML B;  3FG3 A;  4MJD A;  3G0K A;  3L0R A;  1Q42 A;  4HM1 B;  4MMX B;  5FGO A;  2Z77 A;  4QWT A;  2ZDJ A;  4XDV A;  3HK4 A;  3LML A;  3DM8 A;  4BTX A;  2BO9 B;  2HMM B;  1DMM A;  2CFW A;  3V99 A;  6STD A;  1VQP 3;  1OHO A;  1JB2 A;  3CC4 3;  1UCJ A;  1BNI A;  2H0I A;  1ISK A;  3N54 B;  2RCD A;  3DH2 A;  5KP1 A;  1IVX A;  3CCL 3;  1TFK A;  2P0M A;  4HAA A;  1Q7Y 4;  4KFF A;  2CIU A;  4FMB A;  1GOY A;  2OTJ 3;  5AII A;  5AI1 A;  2XFS A;  3SOY A;  4N6M A;  4O8S A;  2CX0 A;  1I3I A;  1MGW A;  1K9M 4;  1IVW A;  4XBT A;  3KZT A;  3GZB A;  4AKY A;  3IMA B;  4Q53 A;  3GRD A;  3AMO A;  1QMA A;  1STF I;  1V58 A;  3QRD A;  4L7K A;  1ULI B;  3VGN A;  1IVU A;  4N6L A;  3HI7 A;  1JRQ A;  1NO3 A;  3MHE A;  1LRA A;  3Q3F A;  3OXA A;  3NQY A;  1I0V A;  2XR8 B;  3GWR A;  5KP4 A;  1AVK A;  2KF6 A;  3G8Z A;  2XGL A;  4EV2 A;  3CNM A;  1OUN A;  3ER7 A;  1EKM A;  3B8L A;  1GYB A;  1EEJ A;  1ZX2 A;  4KT3 B;  4X2O A;  2STD A;  3MG3 A;  1RNT A;  2XSO B;  1D6U A;  3HX8 A;  4H61 A;  3F7X A;  1WMP A;  3AHW A;  1W2Z A;  1YNV X;  3AGO A;  3DGO A;  1UI8 A;  3NX0 A;  1BIR A;  2F99 A;  2BMQ B;  1W00 A;  2INX A;  2K54 A;  4N6N B;  4RNY A;  4RBN A;  1UCL A;  4WP5 A;  1IK3 A;  2P05 A;  3AGN A;  1UI7 A;  4HOH A;  4LGQ A;  1E3R A;  1MOL A;  2W03 A;  3T8U A;  3D9R A;  4HM3 B;  2AAE A;  3HII A;  1GMR A;  1BOX A;  3I0Y A;  3X3Y A;  5IEP A;  1IQY A;  2WO0 A;  1KWI A;  1RHL A;  1VQ8 3;  3LT9 A;  1IT8 A;  2JDI H;  5AYS C;  4ILF A;  1MWU A;  3X3Z A;  2ZHX B;  3HIG A;  3OWS A;  1JJ2 2;  3SED A;  1ZO2 A;  3KKG A;  5M1A A;  1D6Y A;  3N9H A;  3UL5 A;  8CHO A;  4LYL B;  1BSE A;  3FSD A; 
#chains in the Genus database with same CATH homology
 2P09 A;  1YVB I;  1YI2 3;  3CCV 3;  4O2H A;  1SPU A;  4TX4 A;  4KFE A;  1WMO A;  3NV0 B;  3B7C A;  3S27 A;  1OAC A;  3WMD A;  1Q82 4;  2W9Q A;  3DZL A;  3GZX B;  1K28 A;  3MG2 A;  1GD4 A;  1JV2 B;  2BNG A;  3MYT A;  1O7W B;  4LEH A;  3WOF B;  2E2V A;  3E99 A;  1K73 4;  1BUQ A;  3DGN A;  1IDP A;  3BNB A;  1FGR A;  1W4N A;  2W6J H;  1JKG B;  1OPY A;  2CFG A;  2RSX A;  2ZL8 A;  1TP6 A;  5CK6 A;  2QGU A;  3PXM A;  2P38 A;  2LQV A;  3J7Y d;  5BXQ A;  3CXC 2;  1M1K 4;  3UNL A;  2W9P A;  3NBB A;  1E3V A;  5TGN A;  1LXE A;  4OVM A;  2OCT A;  2W56 B;  4R1K A;  5FW5 A;  1RKY A;  3JVC A;  5IER A;  3G6E 3;  3K9M C;  1U8C B;  2XFT A;  2GEY A;  5ELU A;  1FUW A;  2OWP A;  1UUV B;  3CCS 3;  3CD6 3;  1LOX A;  2CWV A;  4FMA A;  5AYR B;  1N8R 4;  1NJI 4;  3FH1 A;  3CPO A;  3IPT A;  4IT7 A;  4FR9 A;  1RRL A;  4EXR A;  2YFI B;  3EX9 A;  3LOY A;  1G96 A;  1J2B A;  2CKF B;  4FCZ A;  5HGR A;  2CG1 A;  3STD A;  4HJL B;  1TIJ A;  1ULJ B;  3ROB A;  7STD A;  2XEP A;  2XSH B;  1V74 A;  3S5C A;  2C10 A;  4HM2 B;  3WOE B;  1IU7 A;  2BT3 A;  1S72 3;  2OQE C;  3LZA A;  4BTY A;  1KQS 2;  4IPB A;  4K90 B;  1C7H A;  3DXO A;  2BHM A;  3UL6 A;  5IW9 A;  2ML5 A;  1QVG 2;  3S67 A;  4NHF A;  3F8H A;  3ALA A;  4WYK B;  2CG0 A;  3OWY A;  1K8A 4;  1VQ7 3;  3CPW 2;  1CYV A;  2E2U A;  1YJ9 3;  3GZY B;  2W0Q A;  5AEW B;  1NDO B;  1W01 A;  3HZP A;  1VQ9 3;  1FGM A;  1A67 A;  2HMN B;  2Q07 A;  3NBJ A;  3WOD G;  1HU9 A;  3WA2 X;  1E97 A;  3NXJ A;  3KII A;  1SII A;  3H51 A;  3K0Z A;  4XBX A;  4EV5 A;  4OK0 A;  1LVN A;  2LYX A;  1NB3 I;  2I9W A;  1GS3 A;  2E2T A;  1YIT 3;  2RFR A;  1O7H B;  2PZV A;  3T0U A;  4R9K A;  1Q40 A;  3VF1 A;  1PU4 A;  3M8C A;  1EQK A;  2JQ5 A;  3BNC A;  4IIA A;  4FCM A;  1KC8 4;  1WMN A;  3K5T A;  4N6T A;  2B1X B;  2UX0 A;  4FMC A;  4GB5 A;  1GY7 A;  1W5Z A;  4JRF A;  3FG4 A;  1OGZ A;  3F7S A;  1ASK A;  1YJN 3;  2WOF A;  2W04 A;  2F98 A;  3EQQ B;  4N6U A;  1CYU A;  4LSO A;  5D82 A;  4CDL A;  3X42 A;  3MKI A;  1W6Y A;  3SXX A;  1JNQ A;  2OQE A;  1QAF A;  5D83 A;  3CCU 3;  4HVN A;  1DYU A;  1Q81 4;  3EF8 A;  1W6G A;  3A76 A;  4RNZ A;  4WWU C;  2OTL 3;  3DGM A;  2BMR B;  3K63 A;  2GBW B;  2BMO B;  3N8B A;  1D6Z A;  2A15 A;  3F9S A;  3LTB A;  4FMD A;  1S5A A;  3O8Y A;  1OCV A;  1KSI A;  1N8Q A;  3MWZ A;  1YJW 3;  1FGO A;  1WTH A;  4XDW A;  1O7G B;  3KE7 A;  2Y74 A;  2YFL B;  3FF2 A;  3LXU X;  3NBR A;  1OF5 B;  3CU3 A;  4EBG A;  5AIF A;  2QIY A;  3V98 A;  2IA7 A;  3KSP A;  4OUQ A;  1IQ8 A;  1KD1 4;  2O9U X;  3FLJ A;  5EVH A;  2SBL A;  3S29 A;  3DY5 A;  4KZ1 A;  2K0M A;  4HYZ A;  2HMK B;  4AEQ A;  1GD3 A;  4MMZ B;  1VQ5 3;  2RGQ A;  3U97 A;  3CCJ 3;  2GU3 A;  3B4O A;  1N5H A;  1ROV A;  4HM0 B;  1ROA A;  4HBR A;  3X41 A;  1JB5 A;  3CMA 3;  1WNH A;  3D3L A;  1W02 A;  1STD A;  1YGE A;  5IG0 A;  1VQM 3;  3JUQ A;  5AEU B;  4R80 A;  3RGA A;  3EB8 A;  2IUJ A;  3FF0 A;  1N9J A;  2XH9 A;  4HM7 B;  1JN5 B;  1GY5 A;  4LMI A;  5AIH A;  3B4P A;  3X40 A;  3F8X A;  1QAL A;  1RJO A;  1O7M B;  5BVB A;  2B24 B;  3Q1C A;  1SJW A;  2CWT A;  5IF6 A;  4K1V A;  1IT7 A;  5CF2 A;  1A2V A;  2GU1 A;  3EN1 B;  4HM4 B;  1QVF 2;  4O02 B;  3T8N A;  1T5Y A;  3LTC A;  2OOV C;  3MPH A;  4N6O B;  2XF3 A;  5ELJ A;  5STD A;  1PFP A;  1IV7 A;  2F86 B;  3UB1 A;  3CCQ 3;  3NUV A;  4J9A A;  2KRT A;  3F40 A;  1HKX A;  5IEO A;  3NQZ A;  3VSY A;  2O3O A;  4ORL A;  4J8T A;  5AIG A;  1CEW I;  2XGN A;  3EN8 A;  2FNQ A;  4HM5 B;  3G4S 3;  3PCR A;  3UJM A;  2HMJ B;  3RDE A;  3PZW A;  3FGY A;  4JF8 A;  2KXG A;  2WOH A;  1OHS A;  4L8O A;  4KVH A;  1FA3 A;  3BB9 A;  2CH9 A;  2D1W A;  2L4V A;  3ECF A;  1W2B 2;  4R9L A;  3IJE B;  1AVL A;  1WQL B;  2FXT A;  1UW1 A;  1OGX A;  3OWU A;  5G2G A;  1NWW A;  3MG1 A;  1DMQ A;  3LYG A;  4KFD A;  1O7N B;  2D42 A;  3K7C A;  1CQS A;  1M9G A;  2HMO B;  4XB5 A;  5LC6 A;  3KFQ C;  1W7C A;  1O7P B;  3MSO A;  3X3X A;  2QA4 3;  1W6C A;  2CWU A;  2Y73 A;  3EHC A;  5EQL A;  1EG9 B;  3EBY A;  1A90 A;  3NM7 A;  1IVV A;  4NRE A;  3NHX A;  2Z7A A;  1F8N A;  4K61 A;  1OHP A;  4U13 A;  1AV4 A;  4XM4 A;  2C11 A;  2IMJ A;  3V92 A;  3I56 3;  3CC2 3;  1YIJ 3;  5KP3 A;  2CK3 H;  1RRH A;  2XRX B;  4LZI A;  3WA3 A;  1N5P A;  3QK9 A;  4R4K A;  1IQX A;  2MF7 A;  1TUH A;  1QAK A;  4G1M B;  1EA2 A;  3OX9 A;  2OOV A;  3DUK A;  2CFK A;  3Q90 A;  1Y4K A;  1LNH A;  2GBX B;  3EC9 A;  4WFO A;  4RZM A;  3CNX A;  4X2H A;  4XBY A;  1SQW A;  2CFD A;  3U1W A;  3DMC A;  3NV0 A;  1OF5 A;  2P0X A;  1NB5 I;  4MMY B;  3LH4 A;  5CF1 A;  2Z76 A;  3S28 A;  1OH0 A;  1DVD A;  1UUW B;  2V1L A;  3G16 A;  3BND A;  3OV4 A;  3BLZ A;  3LT8 A;  4K1U A;  1US1 A;  2FGT A;  3RGR A;  3EE1 A;  3CC7 3;  1U5O A;  4AKZ A;  1JKG A;  2YX9 A;  4GL6 A;  5LC7 A;  1SIH A;  3AMO B;  1Z1S A;  3GZR A;  3SOA A;  3OW2 2;  1TFO A;  5A0O B;  4N6V 0;  4FCJ A;  3FG1 A;  5CXO A;  5IG3 A;  2CC3 A;  2R4I A;  3PGB A;  2W56 A;  1IV9 A;  1JN5 A;  1Q40 B;  3JUM A;  1QJG A;  1GY6 A;  3PYJ A;  1K41 A;  1NU3 A;  4CCV A;  2YFJ B;  2CHC A;  3TDG A;  1N9E A;  1VQN 3;  3F14 A;  3JUO A;  4I4K A;  1R4C A;  3I55 3;  3FZW A;  4HKV B;  2Z6B A;  4ZM8 A;  5IG4 A;  3G71 3;  3LTD A;  2WGO A;  2KCD A;  1FGT A;  5EEO A;  1VQL 3;  1VQ6 3;  3GAX A;  5I97 A;  2M7O A;  3SLU A;  4N3V A;  4EYC A;  4WHA A;  2PNC A;  2W2C A;  5JPU A;  4HZ9 B;  1M1X B;  3EBT A;  1DMN A;  3DGL A;  5CLK A;  5JPP A;  4PEJ A;  4EC6 A;  1TU5 A;  2GEX A;  3CCM 3;  3KSE D;  3SX1 A;  4O3V A;  2QEX 3;  3Q2P A;  4HM8 B;  4WYK A;  3JUN A;  2WGQ A;  3PCS A;  3CCE 3;  1Q86 4;  3FKA A;  5DRE A;  1M90 4;  2CFL A;  5DRV A;  1AR0 A;  2GXF A;  1VZZ A;  3PS8 A;  1VQK 3;  4MEI A;  1DVC A;  1YHQ 3;  4BTW A;  3H3H A;  4H3U A;  4STD A;  3BNE A;  4HM6 B;  2ML6 A;  3LTA A;  1JB4 A;  3JUP A;  1A2K A;  5JBS A;  4HZB B;  1MNL A;  1RN7 A;  4L8P A;  5IG5 A;  5IEN A;  3CME 3;  2IUK A;  3CCR 3;  3KN4 A;  1FGQ A;  3EJV A;  5D81 A;  1VQO 3;  3NM2 A;  1VQ4 3;  2CW9 A;  1L5G B;  3FCS B;  2MC8 A;  3WDG B;  2HML B;  3FG3 A;  4MJD A;  3G0K A;  3L0R A;  1Q42 A;  4HM1 B;  4MMX B;  5FGO A;  2Z77 A;  4QWT A;  2ZDJ A;  4XDV A;  3HK4 A;  3LML A;  3DM8 A;  4BTX A;  2BO9 B;  2HMM B;  1DMM A;  2CFW A;  3V99 A;  6STD A;  1VQP 3;  1OHO A;  1JB2 A;  3CC4 3;  1ISK A;  3N54 B;  2RCD A;  5KP1 A;  1IVX A;  3CCL 3;  1TFK A;  2P0M A;  1Q7Y 4;  4KFF A;  2CIU A;  4FMB A;  2OTJ 3;  5AII A;  5AI1 A;  2XFS A;  3SOY A;  4N6M A;  4O8S A;  1K9M 4;  1IVW A;  4XBT A;  3KZT A;  3GZB A;  4AKY A;  3IMA B;  4Q53 A;  3GRD A;  3AMO A;  1QMA A;  1STF I;  3QRD A;  4L7K A;  1ULI B;  3VGN A;  1IVU A;  4N6L A;  3HI7 A;  1JRQ A;  1NO3 A;  3MHE A;  3OXA A;  3NQY A;  2XR8 B;  3GWR A;  5KP4 A;  1AVK A;  3G8Z A;  2XGL A;  4EV2 A;  3CNM A;  1OUN A;  3ER7 A;  1EKM A;  3B8L A;  1GYB A;  1ZX2 A;  4X2O A;  2STD A;  3MG3 A;  2XSO B;  1D6U A;  3HX8 A;  4H61 A;  3F7X A;  1WMP A;  1W2Z A;  3DGO A;  3NX0 A;  1UI8 A;  4N6N B;  2F99 A;  2BMQ B;  1W00 A;  2INX A;  2K54 A;  4WP5 A;  4RNY A;  4RBN A;  3SVA A;  1IK3 A;  2P05 A;  4LGQ A;  1UI7 A;  1E3R A;  1MOL A;  2W03 A;  3T8U A;  3D9R A;  4HM3 B;  3HII A;  3I0Y A;  5IEP A;  3X3Y A;  1IQY A;  2WO0 A;  1KWI A;  1VQ8 3;  3LT9 A;  1IT8 A;  2JDI H;  5AYS C;  3X3Z A;  3HIG A;  3OWS A;  1JJ2 2;  3SED A;  1ZO2 A;  3KKG A;  1D6Y A;  3N9H A;  3UL5 A;  8CHO A;  3FSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...