3KE7A

Crystal structure of putative ketosteroid isomerase (yp_001303366.1) from parabacteroides distasonis atcc 8503 at 1.45 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
QKNMENKTLNENIPEMIISLEKEALASTDPMAFVELSDTDVIYFDPSLETKIEGLEQLRTYYKGMQLPPADHFDMIRPVVQVAQNIAVLTFNLDSYLSDKVIKWNCTEVYRRNPDNQWKIIQTHWSYVKPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative ketosteroid isomerase
publication title Crystal structure of putative ketosteroid isomerase (YP_001303366.1) from Parabacteroides distasonis ATCC 8503 at 1.45 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
total genus 36
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ke7A00
3K7CA 3G0KA 1OGXA 2RCDA 3EQQB 4R1KA 5CF2A 5D81A 3JUNA 3EBYA 4RZMA 3GWRA 3NV0A 3BLZA 3GZYB 5IEOA 4L8OA 5IEPA 3FKAA 5JPPA 2OWPA 5BVBA 2B1XB 1SJWA 2Z7AA 2K54A 3B8LA 1W02A 5KP3A 5FW5A 4LMIA 1O7HB 3NXJA 4ORLA 3CNMA 3EC9A 1HKXA 4N3VA 1ZX2A 1GY6A 3H3HA 1WQLB 3DXOA 3FGYA 1U5OA 4WYKA 1Z1SA 3DUKA 3DZLA 3HX8A 3RGAA 2GBXB 3BB9A 1ISKA 3E99A 5CXOA 2INXA 1JKGA 1NU3A 5HGRA 5IG0A 3DMCA 2A15A 2BMRB 4FCJA 2R4IA 1ULJB 1E97A 1O7WB 3LYGA 4XDWA 5AI1A 1AR0A 4L8PA 3EHCA 4HM6B 5IG5A 4OVMA 3F14A 3T8UA 4HM2B 1A2KA 4J9AA 4FCMA 4K1VA 4CDLA 5AEWB 5EVHA 2W2CA 1DMMA 1JN5A 2Z77A 1GY5A 4L7KA 3F8XA 3GZRA 3NV0B 1UUVB 3VSYA 4X2OA 5BXQA 5CK6A 5STDA 3B4OA 3FZWA 3K0ZA 2BMQB 4R9KA 1Q40A 3OWUA 3FSDA 4STDA 1ASKA 2CHCA 3MKIA 3D9RA 1GY7A 3GZBA 5DREA 5D83A 1E3RA 1OHPA 2QIYA 1C7HA 3VGNA 3GZXB 1CQSA 1O7MB 3Q90A 2GBWB 3HZPA 8CHOA 3SOYA 1ULIB 5IERA 1JB2A 5DRVA 1OF5A 3M8CA 3MSOA 1S5AA 2JQ5A 3EN8A 3A76A 4HM3B 3MG3A 5CLKA 1OPYA 1JKGB 5D82A 2GEXA 3CU3A 4R9LA 4HZBB 3ROBA 3MYTA 5IENA 1DMQA 3OXAA 5AIFA 3NBRA 1TP6A 4HM4B 3UNLA 4IIAA 3DM8A 3IPTA 5G2GA 3WMDA 3F7XA 2HMKB 3EN1B 3FF2A 2BMOB 4XBXA 3G8ZA 1OCVA 3I0YA 3FH1A 4Q53A 4XB5A 2F99A 4WP5A 3NUVA 3SEDA 4U13A 5AIGA 3GRDA 1Q42A 4HM7B 4OUQA 4HM8B 3JUOA 3FF0A 3UJMA 3KZTA 1OHOA 3B7CA 5CF1A 1Q40B 5IF6A 3ER7A 1BUQA 2XRXB 1OH0A 2YFJB 1IDPA 5AEUB 1E3VA 2STDA 3OWYA 3F40A 4MJDA 2CKFB 4HKVB 3H51A 1EG9B 2PZVA 2GXFA 3B4PA 3STDA 4HM0B 2YFLB 3FLJA 1W01A 3EBTA 5AIHA 3F8HA 4HZ9B 1O7PB 3ECFA 1DMNA 3MHEA 4XM4A 1OUNA 1ZO2A 2HMLB 3F7SA 2F98A 3S5CA 2RFRA 3F9SA 4WWUC 5KP1A 3SOAA 4X2HA 1GS3A 4WYKB 2HMNB 4LGQA 2HMOB 4HM1B 4HVNA 3CPOA 3JUQA 3HK4A 4J8TA 2IMJA 5TGNA 2HMJB 3KKGA 4XBYA 4XDVA 4XBTA 3EJVA 3NHXA 3T8NA 1QMAA 2XR8B 1NDOB 3KE7A 3EF8A 2UX0A 5AIIA 2B24B 3G16A 1NWWA 1O7GB 3OV4A 2XSOB 3MG2A 4K1UA 6STDA 4HJLB 3MG1A 3OWSA 1JB4A 1VZZA 1JN5B 4LEHA 2I9WA 4KVHA 1K41A 2GEYA 5JPUA 1EA2A 1TUHA 3RGRA 5IG4A 3JUPA 1W6YA 3LZAA 4H3UA 7STDA 5IG3A 1UUWB 3CNXA 4HM5B 1GYBA 2QGUA 2XSHB 5KP4A 1OGZA 2YFIB 1JB5A 3EX9A 2Z76A 4GB5A 2HMMB 3OX9A 4I4KA 2F86B 3KSPA 1QJGA 1W00A 1O7NB 2BNGA 2RGQA 1OHSA 3JUMA 1STDA 4PEJA 1OF5B 3NM2A
chains in the Genus database with same CATH superfamily
3I553 3K7CA 3AMOB 1BUJA 3G0KA 4RNYA 1TFOA 3WDGB 6GSPA 3ZG5A 1C54A 1OGXA 1MGRA 3L0RA 2RCDA 3EQQB 1FGTA 4R1KA 3S67A 1T3BA 3ZFZA 1G0TA 1RN1A 1YIJ3 4BU4A 4EC6A 5CF2A 2P05A 1U8CB 3D5IA 3BNCA 1GD3A 5D81A 3JUNA 1FUWA 1DVCA 2JDIH 3EBYA 4RZMA 1DETA 3GWRA 3NV0A 1G96A 2AAEA 3BLZA 1X1WA 3GZYB 5IEOA 4L8OA 1KD14 1IV9A 4JRFA 1DE3A 1AQZA 3Q2PA 1IT8A 3LT9A 5IEPA 3LH4A 4RBNA 1B2XA 3FKAA 1YJN3 5A0OB 1RDSA 5JPPA 2OWPA 1N8QA 3AGOA 4N6NB 4BL3A 1YVBI 2B1XB 5BVBA 2KF3A 4KFEA 1SJWA 2Z7AA 2GU1A 2K54A 3B8LA 1W02A 1WMNA 1I2EA 4OK0A 1W7CA 5KP3A 3V99A 5FW5A 4LMIA 4GSPA 1BRSA 4WHAA 2ZDJA 1HYFA 1SIHA 1B20A 2W6JH 2IUJA 1O7HB 3PXMA 1I70A 1VQ53 3LMLA 4RNTA 3QK9A 3NXJA 1BSEA 4ORLA 2FXTA 3U97A 2R41A 3CNMA 1B21A 3DGYA 1SQWA 1UI8A 2CWUA 3EC9A 2O3OA 1HKXA 1IT7A 1NNVA 2ML5A 3NQYA 4N3VA 3X40A 3HIIA 2D42A 2HOHA 3G4S3 1ZX2A 1YGWA 1ZS7A 1GY6A 1JRQA 1YJW3 3H3HA 1WQLB 1STFI 2KAAA 1Q864 1GSPA 3V98A 3DXOA 3FGYA 1IVXA 1K28A 1U5OA 4WYKA 1GD4A 5BIRA 1Z1SA 1W6GA 3DUKA 1W4NA 3SX1A 4GL6A 4K61A 1Q824 3DZLA 1RCKA 3HX8A 3RGAA 2GBXB 3BB9A 2XGNA 5FGOA 4ZM8A 1ISKA 4K90B 1RCLA 3MWZA 1UCKA 3WODG 3E99A 1GMPA 5CXOA 3CCM3 2INXA 3NX0A 3FG1A 1JKGA 1VQO3 1LVNA 3JVCA 1GOUA 1M9GA 2CG1A 1JV2B 1NU3A 5HGRA 1BRJA 5IG0A 1I8VA 2P0MA 3HOHA 3PCSA 1KC84 3DMCA 1PY3A 1AVKA 4BTXA 2WO0A 3AHSA 2A15A 1W6CA 3UL5A 2BMRB 2LYXA 4FCJA 1BRNL 1YIT3 1RGAA 1KWIA 1RRLA 4EBGA 2R4IA 1ULJB 2BIRA 1E97A 1O7WB 3LYGA 2W56B 4AKZA 2AADA 4XDWA 1AR0A 5AI1A 1QAKA 2F5MA 4L8PA 3CCR3 5ELJA 5I97A 3EHCA 5GSPA 3A5EA 4R80A 4HM6B 1GMQA 5IG5A 4OVMA 1BNGA 3K5TA 3F14A 3T8UA 4HM2B 5EQLA 3N54B 1J2BA 2OQEA 1GMRA 3DH2A 7RNTA 1VQL3 1A2KA 3LTDA 4J9AA 1MWUA 4FCMA 4K1VA 2F4YA 1DVDA 2XGLA 3CCL3 1T2IA 4CDLA 2FNQA 5AEWB 4I5QA 5EVHA 3K63A 1BNFA 1B27A 2GSPA 1L5GB 1UDII 2W2CA 2XF3A 3AHWA 1DMMA 1JN5A 5M18A 1UGIA 1SARA 2C10A 4FMBA 2Y73A 1ROVA 2Z77A 4N6UA 1GY5A 3X3ZA 1I2FA 3D5GA 4L7KA 1IQ8A 3F8XA 1RLSA 3GZRA 3IMAB 1CYVA 3NV0B 1BRKA 1N9EA 4QWTA 3URPA 1EQKA 2H0HA 4J5KA 1FUSA 1UUVB 3VSYA 1N5PA 1W2B2 4X2OA 4MMXB 5BXQA 2CFLA 5CK6A 5STDA 1F8NA 3B4OA 1LNIA 4IT7A 3FZWA 3K0ZA 1B2SA 1MNLA 1RGFA 1UCLA 2BMQB 4R9KA 4CJNA 1Q40A 2ML6A 2E2UA 2SBLA 3ALAA 1QAFA 3CCE3 1IV7A 3CC73 2CFKA 3RNTA 2OTJ3 3OWUA 3FSDA 1US1A 4STDA 1I0VA 1ASKA 1K9M4 3S29A 2CHCA 3N9HA 2M7OA 3MKIA 1IVWA 3D9RA 1CEWI 2P09A 3WHOA 5JBSA 4BTYA 1GY7A 3HI7A 1VQK3 3CCQ3 3GZBA 5DREA 1MWSA 5D83A 1BSBA 1E3RA 2W03A 3X3XA 3ZG0A 1OHPA 2QIYA 2WGOA 2ZA4A 2J8XB 3CCV3 1C7HA 4AKYA 1BNIA 3CCS3 3VGNA 1T5YA 1RGLA 4BTWA 1I0XA 2CFWA 1FA3A 3GZXB 1N5HA 1VQ93 1CQSA 1VQP3 1Q7HA 1O7MB 1A2PA 1V57A 3PYJA 1LOYA 3BU4A 4ILFA 1VQQA 1RTUA 4HAAA 1IK3A 3NM7A 3Q90A 1A67A 2GBWB 1RGEA 3HZPA 1AY7A 1RN7A 1BRGA 5ELUA 8CHOA 3IJEB 3SOYA 1BANA 2GU3A 1ULIB 4FR9A 4GHOA 4KT3B 5IERA 1JB2A 5DRVA 4N6LA 1K734 1PFPA 1NO3A 2WOFA 1OF5A 3M8CA 2CX0A 3AMOA 3MSOA 2OQEC 1LOWA 1S5AA 2JQ5A 2ZHXB 1BNJA 1LQMB 2RBIA 3EN8A 1RN4A 9RNTA 1LQGC 1BGSA 3A76A 4HM3B 3MG3A 4DKIA 1G02A 4EV2A 1YJ93 3BIRA 3FG3A 5CLKA 1OPYA 1R4CA 5BU4A 2XFSA 1JKGB 3G6E3 5D82A 1TRPA 1JNQA 2GEXA 2BO9B 3CU3A 2E2TA 4R9LA 4HZBB 1TRQA 3ROBA 3MYTA 2W9PA 1RGGA 5IENA 2Q07A 1DMQA 2K3DA 1UW1A 1YHQ3 1VQN3 2YX9A 1FUTA 3OXAA 5AIFA 3NBRA 1JBSA 1I3IA 1TP6A 4HM4B 1N9JA 1BNSA 3KFQC 3UNLA 4IIAA 3DM8A 1UI7A 3IPTA 1HU9A 5G2GA 3NBBA 1RSNA 3WMDA 2D1WA 1WTHA 1NB5I 3F7XA 3LTAA 2HMKB 3LOYA 1V58A 3EN1B 2Y74A 3FF2A 2BMOB 3WOEB 1RHLA 1MOLA 4XBXA 3G8ZA 2C4BA 2L4VA 1OCVA 3I0YA 3I563 4LSOA 2KF6A 1EEJA 3OW22 3DGOA 3FH1A 4FCZA 4O2HA 1PU4A 4Q53A 3FG4A 4XB5A 2F99A 3LTCA 4HYZA 4WP5A 3D3LA 3NUVA 4O8SA 3SEDA 1LOXA 2IUKA 2LQVA 4U13A 4NHFA 5AIGA 3DGNA 3GRDA 1Q42A 4HBRA 4HM7B 7GSPA 4O3VA 3UB1A 1TIJA 2CK3H 4OUQA 4HM8B 3VF1A 3JUOA 1MWTA 1X1UA 3FF0A 3J7Yd 1FGRA 1S723 3UJMA 3CME3 1RNBA 3KZTA 1YNVX 2OOVA 1OHOA 4N6MA 2XH9A 3B7CA 3NBJA 3MPHA 1VQM3 3S28A 1M1K4 4WFOA 3CCU3 2MF7A 5CF1A 1IYYA 2PNCA 1Q40B 5IF6A 2RSXA 1GOYA 3ER7A 5LC6A 1BUQA 2XRXB 1OH0A 2KXGA 3SYUA 2YFJB 5HOHA 3PS8A 4EW5A 1GOVA 1ROAA 2CX1A 3X41A 1TU5A 1IDPA 4KFFA 5M1AA 3BNDA 2Z6BA 1Q7Y4 1IQXA 1FYSA 2V1LA 3D4AA 5AEUB 1E3VA 2STDA 3OWYA 3F40A 3NQZA 1QVG2 4MJDA 2CKFB 3AGNA 4RNZA 4HKVB 5RNTA 3U1WA 3H51A 1EG9B 2PZVA 2KF4A 2GXFA 3B4PA 1K8A4 3STDA 1T2HA 4HM0B 2WOHA 1A2VA 1X1XA 4EXRA 1KSIA 2YFLB 4JF8A 3LTBA 1LXEA 2L1SA 1QALA 1X1YA 1JJ22 3FLJA 3CMA3 3BNEA 1D6ZA 1W01A 3PCRA 3EBTA 1LOVA 5AIHA 1NB3I 4NPBA 3F8HA 1M904 1SPUA 4HZ9B 4AEQA 1RRHA 1O7PB 1V74A 3ECFA 1CYUA 1DMNA 3MHEA 2H0IA 1FW7A 4XM4A 1ZGXA 1NJI4 1BIRA 1OUNA 1RNTA 1ZO2A 1WMOA 1LRAA 4LYLB 2HMLB 3O8YA 2E2VA 4R4KA 3F7SA 1EKMA 2F98A 1YI23 5G1KA 3HIGA 1BRHA 4LZIA 3S5CA 2RFRA 3K9MC 3F9SA 4WWUC 8RNTA 5KP1A 3CC23 3CCJ3 1TFKA 1IVVA 2KCDA 2UGIA 1W5ZA 1I2GA 1MWRA 1LNHA 3PGBA 3SOAA 2W04A 2XEPA 1QVF2 1N8R4 1BU4A 4KZ1A 4HOHA 4BIRA 4X2HA 1Q9EA 1GS3A 4WYKB 2HMNB 1RGCA 4LGQA 1M1XB 1RMSA 2FGTA 2HMOB 2OOVC 1JBRA 4HM1B 4MMYB 4HVNA 3CPOA 3JUQA 1Y4KA 3S27A 1D6YA 1AVLA 1TTOA 4EV5A 3CPW2 3KN4A 4N6TA 2CW9A 3DGMA 4FMCA 3CC43 3HK4A 4J8TA 3LT8A 3CXC2 1RJOA 2IMJA 3WR2A 2W0QA 2CIUA 3BNBA 5TGNA 1FGOA 3N8BA 1VQ43 1I3FA 1MGWA 2HMJB 3KKGA 4XBYA 3CD63 1WMPA 4XDVA 4XBTA 3SXXA 3EJVA 4FMDA 5M19A 3NHXA 1BSCA 3T8NA 2IYJA 3X3YA 4CCVA 1B2UA 1IU7A 1QMAA 2XR8B 3SVAA 6RNTA 1NDOB 3Q3FA 3UL6A 3V92A 2F5WA 1BSAA 1BSDA 1OACA 3EF8A 3GSPA 3KE7A 2UX0A 5AYSC 5AIIA 4J5GA 2OTL3 1VQ73 2B24B 2CFDA 3G16A 1NWWA 1O7GB 2W9QA 5IW9A 3OV4A 2P38A 2XSOB 3MG2A 2CG0A 4K1UA 1JZDA 6STDA 1A90A 4HJLB 3SLUA 1AV4A 3MG1A 4N6V0 1PYLA 3D79A 3OWSA 1D6UA 1JB4A 1RGKA 3LXUX 1VZZA 1SIIA 1JN5B 4LEHA 3KCHA 4H61A 1UGHI 2I9WA 2KRTA 1VQ63 1FZUA 4KVHA 3KIIA 1K41A 4CPKA 4N6OB 3X42A 2CFGA 2GEYA 5G1LA 5JPUA 2IY2A 4MMZB 1B2MA 2P0XA 1IVUA 1EUIC 1EA2A 1TUHA 1R4YA 3RGRA 3KSED 1RKYA 2RNTA 4TX4A 5IG4A 3JUPA 5LC7A 1W6YA 1WNHA 3LZAA 4FMAA 4H3UA 7STDA 2SARA 2XFTA 1W2ZA 2O9UX 5IG3A 1KQS2 1UCIA 1UUWB 3CNXA 4HM5B 5EEOA 1GYBA 2QA43 2QGUA 2XSHB 3Q1CA 1BVIA 5KP4A 1IQYA 1UUGB 1Q814 2BHMA 1OGZA 1FGQA 2CWTA 3EB8A 1BNEA 2YFIB 4IPBA 2ZL8A 3EE1A 4BL2A 2BU4A 1TJDA 2IA7A 1B2ZA 2CC3A 2F56A 3FCSB 1JB5A 2K0MA 3EX9A 4O02B 2KF5A 3WA3A 1JBTA 2Z76A 2CH9A 1B3SA 3RDEA 1UCJA 2OCTA 4GB5A 1CH0A 2HMMB 1HZ1A 2QEX3 1BRIA 3OX9A 1BAOA 4KFDA 2BT3A 1YVSA 1BOXA 2CWVA 4NREA 4EYCA 4I4KA 1DYUA 2W56A 2F86B 2WGQA 2C11A 1BNRA 3KSPA 1QJGA 1W00A 4MEIA 1YGEA 2UUGC 1O7NB 2BNGA 3DY5A 2RGQA 1OHSA 3JUMA 3GAXA 4G1MB 3T0UA 3WA2X 3WOFB 3G713 3QRDA 1FGMA 1STDA 2H0GA 3DGLA 3PZWA 4PEJA 2MC8A 1VQ83 1JZOA 1RGHA 5AYRB 3TDGA 1OF5B 3NM2A
chains in the Genus database with same CATH topology
3I553 3K7CA 3AMOB 3G0KA 4RNYA 1TFOA 3WDGB 1OGXA 3L0RA 2RCDA 3EQQB 1FGTA 4R1KA 3S67A 1YIJ3 4EC6A 5CF2A 2P05A 1U8CB 3BNCA 1GD3A 5D81A 3JUNA 1FUWA 1DVCA 2JDIH 3EBYA 4RZMA 3GWRA 3NV0A 1G96A 3BLZA 3GZYB 5IEOA 4L8OA 1KD14 1IV9A 4JRFA 3Q2PA 1IT8A 3LT9A 5IEPA 3LH4A 4RBNA 1YJN3 3FKAA 5A0OB 5JPPA 2OWPA 1N8QA 4N6NB 1YVBI 2B1XB 5BVBA 4KFEA 1SJWA 2Z7AA 2GU1A 2K54A 3B8LA 1W02A 1WMNA 4OK0A 1W7CA 5KP3A 3V99A 5FW5A 4LMIA 4WHAA 2ZDJA 1SIHA 2W6JH 2IUJA 1O7HB 3PXMA 1VQ53 3LMLA 3QK9A 3NXJA 4ORLA 2FXTA 3U97A 3CNMA 1SQWA 1UI8A 2CWUA 3EC9A 2O3OA 1HKXA 1IT7A 2ML5A 3NQYA 4N3VA 3X40A 3HIIA 2D42A 3G4S3 1ZX2A 1YJW3 1GY6A 1JRQA 3H3HA 1WQLB 1STFI 1Q864 3V98A 3DXOA 3FGYA 1IVXA 1K28A 1U5OA 4WYKA 1GD4A 1Z1SA 1W6GA 3DUKA 1W4NA 3SX1A 4GL6A 4K61A 1Q824 3DZLA 3HX8A 3RGAA 2GBXB 3BB9A 2XGNA 5FGOA 4ZM8A 1ISKA 4K90B 3MWZA 3WODG 3E99A 5CXOA 3CCM3 2INXA 3NX0A 3FG1A 1JKGA 1VQO3 1LVNA 3JVCA 1M9GA 2CG1A 1JV2B 1NU3A 5HGRA 5IG0A 2P0MA 3PCSA 1KC84 3DMCA 1AVKA 4BTXA 2WO0A 3UL5A 2A15A 1W6CA 2BMRB 2LYXA 4FCJA 1YIT3 1KWIA 1RRLA 4EBGA 2R4IA 1ULJB 1E97A 1O7WB 3LYGA 2W56B 4AKZA 4XDWA 1AR0A 5AI1A 1QAKA 4L8PA 3CCR3 5ELJA 5I97A 3EHCA 4R80A 4HM6B 5IG5A 4OVMA 3K5TA 3F14A 3T8UA 4HM2B 5EQLA 3N54B 1J2BA 2OQEA 1VQL3 1A2KA 3LTDA 4J9AA 4FCMA 4K1VA 1DVDA 2XGLA 3CCL3 4CDLA 2FNQA 5AEWB 5EVHA 3K63A 1L5GB 2W2CA 2XF3A 1DMMA 1JN5A 2C10A 4FMBA 2Y73A 1ROVA 2Z77A 4N6UA 1GY5A 3X3ZA 4L7KA 1IQ8A 3F8XA 1EQKA 3GZRA 3IMAB 1CYVA 3NV0B 1N9EA 4QWTA 1W2B2 1UUVB 3VSYA 1N5PA 4X2OA 4MMXB 5BXQA 2CFLA 5CK6A 5STDA 1F8NA 3B4OA 4IT7A 3FZWA 3K0ZA 1MNLA 2BMQB 4R9KA 1Q40A 2ML6A 2E2UA 2SBLA 3ALAA 1QAFA 3CCE3 1IV7A 3CC73 2CFKA 3OWUA 3FSDA 1US1A 4STDA 1ASKA 1K9M4 3S29A 2CHCA 3N9HA 2M7OA 3MKIA 1IVWA 3D9RA 1CEWI 2P09A 5JBSA 4BTYA 1GY7A 3HI7A 1VQK3 3CCQ3 3GZBA 5DREA 5D83A 1E3RA 2W03A 3X3XA 1OHPA 2QIYA 2WGOA 3CCV3 1C7HA 4AKYA 3CCS3 3VGNA 1T5YA 4BTWA 1FA3A 2CFWA 3GZXB 1N5HA 1VQ93 1CQSA 1VQP3 1O7MB 3PYJA 1IK3A 3NM7A 3Q90A 1A67A 2GBWB 3HZPA 1RN7A 5ELUA 8CHOA 3IJEB 3SOYA 2GU3A 4FR9A 1ULIB 5IERA 1K734 1JB2A 5DRVA 4N6LA 1PFPA 1NO3A 2WOFA 1OF5A 3M8CA 3AMOA 3MSOA 2OQEC 1S5AA 2JQ5A 3CMA3 2OTJ3 3EN8A 4EV2A 3A76A 4HM3B 3MG3A 1YJ93 3FG3A 5CLKA 1OPYA 1R4CA 2XFSA 1JKGB 3G6E3 5D82A 1JNQA 2GEXA 2BO9B 3CU3A 2E2TA 4R9LA 4HZBB 3ROBA 3MYTA 2W9PA 5IENA 2Q07A 1DMQA 1YHQ3 1UW1A 1VQN3 2YX9A 3OXAA 5AIFA 3NBRA 1TP6A 4HM4B 1N9JA 3KFQC 3UNLA 4IIAA 3DM8A 1UI7A 3IPTA 1HU9A 5G2GA 3NBBA 3WMDA 2D1WA 1WTHA 1NB5I 3F7XA 3LTAA 2HMKB 3LOYA 3EN1B 2Y74A 3FF2A 2BMOB 3WOEB 1MOLA 4XBXA 3G8ZA 2L4VA 1OCVA 3I0YA 3I563 4LSOA 3OW22 3DGOA 3FH1A 4FCZA 4O2HA 1PU4A 4Q53A 3FG4A 4XB5A 2F99A 3LTCA 4HYZA 4WP5A 3D3LA 3NUVA 4O8SA 3SEDA 1LOXA 2IUKA 2LQVA 4U13A 4NHFA 5AIGA 3DGNA 3GRDA 1Q42A 4HM7B 4O3VA 3UB1A 1TIJA 2CK3H 4OUQA 4HM8B 3VF1A 3JUOA 3FF0A 3J7Yd 1FGRA 1S723 3UJMA 3CME3 3KZTA 2OOVA 1OHOA 4N6MA 2XH9A 3B7CA 3NBJA 3MPHA 1VQM3 3S28A 1M1K4 4WFOA 3CCU3 2MF7A 5CF1A 2PNCA 1Q40B 5IF6A 2RSXA 3ER7A 5LC6A 1BUQA 2XRXB 1OH0A 2KXGA 2YFJB 3PS8A 1ROAA 3X41A 1TU5A 1IDPA 4KFFA 3BNDA 2Z6BA 1Q7Y4 1IQXA 2V1LA 5AEUB 1E3VA 2STDA 3OWYA 3F40A 3NQZA 1QVG2 4MJDA 2CKFB 4RNZA 4HKVB 3U1WA 3H51A 1EG9B 2PZVA 2GXFA 3B4PA 1K8A4 3STDA 4HM0B 2WOHA 1A2VA 4EXRA 1KSIA 2YFLB 4JF8A 3LTBA 1LXEA 1QALA 1JJ22 3FLJA 3BNEA 1D6ZA 1W01A 3PCRA 3EBTA 5AIHA 1NB3I 1M904 3F8HA 1SPUA 4HZ9B 4AEQA 1RRHA 1O7PB 1V74A 3ECFA 1CYUA 1DMNA 3MHEA 4XM4A 1NJI4 1OUNA 1ZO2A 1WMOA 2HMLB 3O8YA 2E2VA 4R4KA 3F7SA 1EKMA 2F98A 1YI23 3HIGA 3S5CA 4LZIA 3CC23 2RFRA 3K9MC 3F9SA 4WWUC 5KP1A 3CCJ3 1TFKA 1IVVA 2KCDA 1W5ZA 3PGBA 1LNHA 3SOAA 2W04A 2XEPA 1QVF2 1N8R4 4KZ1A 4X2HA 1GS3A 4WYKB 2HMNB 4LGQA 1M1XB 2FGTA 2HMOB 2OOVC 4HM1B 4MMYB 4HVNA 3CPOA 3JUQA 1Y4KA 3S27A 1D6YA 1AVLA 4EV5A 3CPW2 3KN4A 4N6TA 2CW9A 3DGMA 4FMCA 3CC43 3HK4A 4J8TA 3LT8A 3CXC2 1RJOA 2IMJA 2W0QA 2CIUA 3BNBA 5TGNA 1FGOA 3N8BA 1VQ43 2HMJB 3KKGA 4XBYA 3CD63 1WMPA 4XDVA 4XBTA 3SXXA 3EJVA 4FMDA 3NHXA 3T8NA 3X3YA 4CCVA 1IU7A 1QMAA 2XR8B 3SVAA 1NDOB 3UL6A 3V92A 3KE7A 1OACA 3EF8A 2UX0A 5AYSC 5AIIA 2OTL3 1VQ73 2B24B 2CFDA 3G16A 1NWWA 1O7GB 2W9QA 5IW9A 3OV4A 2P38A 2XSOB 3MG2A 2CG0A 4K1UA 6STDA 1A90A 4HJLB 3SLUA 1AV4A 3MG1A 4N6V0 3OWSA 1D6UA 1JB4A 3LXUX 1VZZA 1SIIA 1JN5B 4LEHA 4H61A 2I9WA 2KRTA 1VQ63 4KVHA 3KIIA 1K41A 4N6OB 3X42A 2CFGA 2GEYA 5JPUA 4MMZB 2P0XA 1IVUA 1EA2A 1TUHA 3RGRA 3KSED 1RKYA 4TX4A 5IG4A 3JUPA 5LC7A 1W6YA 1WNHA 3LZAA 4FMAA 4H3UA 7STDA 2XFTA 1KQS2 1W2ZA 2O9UX 5IG3A 1UUWB 3CNXA 4HM5B 5EEOA 1GYBA 2QA43 2QGUA 2XSHB 3Q1CA 5KP4A 1IQYA 1Q814 2BHMA 1OGZA 1FGQA 2CWTA 3EB8A 2YFIB 4IPBA 2ZL8A 3EE1A 2IA7A 2CC3A 3FCSB 1JB5A 2K0MA 3EX9A 4O02B 3WA3A 2Z76A 2CH9A 3RDEA 2OCTA 4GB5A 2HMMB 2QEX3 3OX9A 4KFDA 2BT3A 2CWVA 4NREA 4EYCA 4I4KA 1DYUA 2WGQA 2F86B 2W56A 2C11A 3KSPA 1QJGA 1W00A 4MEIA 1YGEA 1O7NB 2BNGA 3DY5A 2RGQA 1OHSA 3JUMA 3GAXA 4G1MB 3T0UA 3WA2X 3WOFB 3G713 3QRDA 1FGMA 1STDA 3DGLA 3PZWA 4PEJA 2MC8A 1VQ83 4HBRA 5AYRB 3TDGA 1OF5B 3NM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7C A;  3G0K A;  1OGX A;  2RCD A;  3EQQ B;  4R1K A;  5CF2 A;  5D81 A;  3JUN A;  3EBY A;  4RZM A;  3GWR A;  3NV0 A;  3BLZ A;  3GZY B;  5IEO A;  4L8O A;  5IEP A;  3FKA A;  5JPP A;  2OWP A;  5BVB A;  2B1X B;  1SJW A;  2Z7A A;  2K54 A;  3B8L A;  1W02 A;  5KP3 A;  5FW5 A;  4LMI A;  1O7H B;  3NXJ A;  4ORL A;  3CNM A;  3EC9 A;  1HKX A;  4N3V A;  1ZX2 A;  1GY6 A;  3H3H A;  1WQL B;  3DXO A;  3FGY A;  1U5O A;  4WYK A;  1Z1S A;  3DUK A;  3DZL A;  3HX8 A;  3RGA A;  2GBX B;  3BB9 A;  1ISK A;  3E99 A;  5CXO A;  2INX A;  1JKG A;  1NU3 A;  5HGR A;  5IG0 A;  3DMC A;  2A15 A;  2BMR B;  4FCJ A;  2R4I A;  1ULJ B;  1E97 A;  1O7W B;  3LYG A;  4XDW A;  5AI1 A;  1AR0 A;  4L8P A;  3EHC A;  4HM6 B;  5IG5 A;  4OVM A;  3F14 A;  3T8U A;  4HM2 B;  1A2K A;  4J9A A;  4FCM A;  4K1V A;  4CDL A;  5AEW B;  5EVH A;  2W2C A;  1DMM A;  1JN5 A;  2Z77 A;  1GY5 A;  4L7K A;  3F8X A;  3GZR A;  3NV0 B;  1UUV B;  3VSY A;  4X2O A;  5BXQ A;  5CK6 A;  5STD A;  3B4O A;  3FZW A;  3K0Z A;  2BMQ B;  4R9K A;  1Q40 A;  3OWU A;  3FSD A;  4STD A;  1ASK A;  2CHC A;  3MKI A;  3D9R A;  1GY7 A;  3GZB A;  5DRE A;  5D83 A;  1E3R A;  1OHP A;  2QIY A;  1C7H A;  3VGN A;  3GZX B;  1CQS A;  1O7M B;  3Q90 A;  2GBW B;  3HZP A;  8CHO A;  3SOY A;  1ULI B;  5IER A;  1JB2 A;  5DRV A;  1OF5 A;  3M8C A;  3MSO A;  1S5A A;  2JQ5 A;  3EN8 A;  3A76 A;  4HM3 B;  3MG3 A;  5CLK A;  1OPY A;  1JKG B;  5D82 A;  2GEX A;  3CU3 A;  4R9L A;  4HZB B;  3ROB A;  3MYT A;  5IEN A;  1DMQ A;  3OXA A;  5AIF A;  3NBR A;  1TP6 A;  4HM4 B;  3UNL A;  4IIA A;  3DM8 A;  3IPT A;  5G2G A;  3WMD A;  3F7X A;  2HMK B;  3EN1 B;  3FF2 A;  2BMO B;  4XBX A;  3G8Z A;  1OCV A;  3I0Y A;  3FH1 A;  4Q53 A;  4XB5 A;  2F99 A;  4WP5 A;  3NUV A;  3SED A;  4U13 A;  5AIG A;  3GRD A;  1Q42 A;  4HM7 B;  4OUQ A;  4HM8 B;  3JUO A;  3FF0 A;  3UJM A;  3KZT A;  1OHO A;  3B7C A;  5CF1 A;  1Q40 B;  5IF6 A;  3ER7 A;  1BUQ A;  2XRX B;  1OH0 A;  2YFJ B;  1IDP A;  5AEU B;  1E3V A;  2STD A;  3OWY A;  3F40 A;  4MJD A;  2CKF B;  4HKV B;  3H51 A;  1EG9 B;  2PZV A;  2GXF A;  3B4P A;  3STD A;  4HM0 B;  2YFL B;  3FLJ A;  1W01 A;  3EBT A;  5AIH A;  3F8H A;  4HZ9 B;  1O7P B;  3ECF A;  1DMN A;  3MHE A;  4XM4 A;  1OUN A;  1ZO2 A;  2HML B;  3F7S A;  2F98 A;  3S5C A;  2RFR A;  3F9S A;  4WWU C;  5KP1 A;  3SOA A;  4X2H A;  1GS3 A;  4WYK B;  2HMN B;  4LGQ A;  2HMO B;  4HM1 B;  4HVN A;  3CPO A;  3JUQ A;  3HK4 A;  4J8T A;  2IMJ A;  5TGN A;  2HMJ B;  3KKG A;  4XBY A;  4XDV A;  4XBT A;  3EJV A;  3NHX A;  3T8N A;  1QMA A;  2XR8 B;  1NDO B;  3KE7 A;  3EF8 A;  2UX0 A;  5AII A;  2B24 B;  3G16 A;  1NWW A;  1O7G B;  3OV4 A;  2XSO B;  3MG2 A;  4K1U A;  6STD A;  4HJL B;  3MG1 A;  3OWS A;  1JB4 A;  1VZZ A;  1JN5 B;  4LEH A;  2I9W A;  4KVH A;  1K41 A;  2GEY A;  5JPU A;  1EA2 A;  1TUH A;  3RGR A;  5IG4 A;  3JUP A;  1W6Y A;  3LZA A;  4H3U A;  7STD A;  5IG3 A;  1UUW B;  3CNX A;  4HM5 B;  1GYB A;  2QGU A;  2XSH B;  5KP4 A;  1OGZ A;  2YFI B;  1JB5 A;  3EX9 A;  2Z76 A;  4GB5 A;  2HMM B;  3OX9 A;  4I4K A;  2F86 B;  3KSP A;  1QJG A;  1W00 A;  1O7N B;  2BNG A;  2RGQ A;  1OHS A;  3JUM A;  1STD A;  4PEJ A;  1OF5 B;  3NM2 A; 
#chains in the Genus database with same CATH topology
 3I55 3;  3K7C A;  3AMO B;  1BUJ A;  3G0K A;  4RNY A;  1TFO A;  3WDG B;  6GSP A;  3ZG5 A;  1C54 A;  1OGX A;  1MGR A;  3L0R A;  2RCD A;  3EQQ B;  1FGT A;  4R1K A;  3S67 A;  1T3B A;  3ZFZ A;  1G0T A;  1RN1 A;  1YIJ 3;  4BU4 A;  4EC6 A;  5CF2 A;  2P05 A;  1U8C B;  3D5I A;  3BNC A;  1GD3 A;  5D81 A;  3JUN A;  1FUW A;  1DVC A;  2JDI H;  3EBY A;  4RZM A;  1DET A;  3GWR A;  3NV0 A;  1G96 A;  2AAE A;  3BLZ A;  1X1W A;  3GZY B;  5IEO A;  4L8O A;  1KD1 4;  1IV9 A;  4JRF A;  1DE3 A;  1AQZ A;  3Q2P A;  1IT8 A;  3LT9 A;  5IEP A;  3LH4 A;  4RBN A;  1B2X A;  3FKA A;  1YJN 3;  5A0O B;  1RDS A;  5JPP A;  2OWP A;  1N8Q A;  3AGO A;  4N6N B;  4BL3 A;  1YVB I;  2B1X B;  5BVB A;  2KF3 A;  4KFE A;  1SJW A;  2Z7A A;  2GU1 A;  2K54 A;  3B8L A;  1W02 A;  1WMN A;  1I2E A;  4OK0 A;  1W7C A;  5KP3 A;  3V99 A;  5FW5 A;  4LMI A;  4GSP A;  1BRS A;  4WHA A;  2ZDJ A;  1HYF A;  1SIH A;  1B20 A;  2W6J H;  2IUJ A;  1O7H B;  3PXM A;  1I70 A;  1VQ5 3;  3LML A;  4RNT A;  3QK9 A;  3NXJ A;  1BSE A;  4ORL A;  2FXT A;  3U97 A;  2R41 A;  3CNM A;  1B21 A;  3DGY A;  1SQW A;  1UI8 A;  2CWU A;  3EC9 A;  2O3O A;  1HKX A;  1IT7 A;  1NNV A;  2ML5 A;  3NQY A;  4N3V A;  3X40 A;  3HII A;  2D42 A;  2HOH A;  3G4S 3;  1ZX2 A;  1YGW A;  1ZS7 A;  1GY6 A;  1JRQ A;  1YJW 3;  3H3H A;  1WQL B;  1STF I;  2KAA A;  1Q86 4;  1GSP A;  3V98 A;  3DXO A;  3FGY A;  1IVX A;  1K28 A;  1U5O A;  4WYK A;  1GD4 A;  5BIR A;  1Z1S A;  1W6G A;  3DUK A;  1W4N A;  3SX1 A;  4GL6 A;  4K61 A;  1Q82 4;  3DZL A;  1RCK A;  3HX8 A;  3RGA A;  2GBX B;  3BB9 A;  2XGN A;  5FGO A;  4ZM8 A;  1ISK A;  4K90 B;  1RCL A;  3MWZ A;  1UCK A;  3WOD G;  3E99 A;  1GMP A;  5CXO A;  3CCM 3;  2INX A;  3NX0 A;  3FG1 A;  1JKG A;  1VQO 3;  1LVN A;  3JVC A;  1GOU A;  1M9G A;  2CG1 A;  1JV2 B;  1NU3 A;  5HGR A;  1BRJ A;  5IG0 A;  1I8V A;  2P0M A;  3HOH A;  3PCS A;  1KC8 4;  3DMC A;  1PY3 A;  1AVK A;  4BTX A;  2WO0 A;  3AHS A;  2A15 A;  1W6C A;  3UL5 A;  2BMR B;  2LYX A;  4FCJ A;  1BRN L;  1YIT 3;  1RGA A;  1KWI A;  1RRL A;  4EBG A;  2R4I A;  1ULJ B;  2BIR A;  1E97 A;  1O7W B;  3LYG A;  2W56 B;  4AKZ A;  2AAD A;  4XDW A;  1AR0 A;  5AI1 A;  1QAK A;  2F5M A;  4L8P A;  3CCR 3;  5ELJ A;  5I97 A;  3EHC A;  5GSP A;  3A5E A;  4R80 A;  4HM6 B;  1GMQ A;  5IG5 A;  4OVM A;  1BNG A;  3K5T A;  3F14 A;  3T8U A;  4HM2 B;  5EQL A;  3N54 B;  1J2B A;  2OQE A;  1GMR A;  3DH2 A;  7RNT A;  1VQL 3;  1A2K A;  3LTD A;  4J9A A;  1MWU A;  4FCM A;  4K1V A;  2F4Y A;  1DVD A;  2XGL A;  3CCL 3;  1T2I A;  4CDL A;  2FNQ A;  5AEW B;  4I5Q A;  5EVH A;  3K63 A;  1BNF A;  1B27 A;  2GSP A;  1L5G B;  1UDI I;  2W2C A;  2XF3 A;  3AHW A;  1DMM A;  1JN5 A;  5M18 A;  1UGI A;  1SAR A;  2C10 A;  4FMB A;  2Y73 A;  1ROV A;  2Z77 A;  4N6U A;  1GY5 A;  3X3Z A;  1I2F A;  3D5G A;  4L7K A;  1IQ8 A;  3F8X A;  1RLS A;  3GZR A;  3IMA B;  1CYV A;  3NV0 B;  1BRK A;  1N9E A;  4QWT A;  3URP A;  1EQK A;  2H0H A;  4J5K A;  1FUS A;  1UUV B;  3VSY A;  1N5P A;  1W2B 2;  4X2O A;  4MMX B;  5BXQ A;  2CFL A;  5CK6 A;  5STD A;  1F8N A;  3B4O A;  1LNI A;  4IT7 A;  3FZW A;  3K0Z A;  1B2S A;  1MNL A;  1RGF A;  1UCL A;  2BMQ B;  4R9K A;  4CJN A;  1Q40 A;  2ML6 A;  2E2U A;  2SBL A;  3ALA A;  1QAF A;  3CCE 3;  1IV7 A;  3CC7 3;  2CFK A;  3RNT A;  2OTJ 3;  3OWU A;  3FSD A;  1US1 A;  4STD A;  1I0V A;  1ASK A;  1K9M 4;  3S29 A;  2CHC A;  3N9H A;  2M7O A;  3MKI A;  1IVW A;  3D9R A;  1CEW I;  2P09 A;  3WHO A;  5JBS A;  4BTY A;  1GY7 A;  3HI7 A;  1VQK 3;  3CCQ 3;  3GZB A;  5DRE A;  1MWS A;  5D83 A;  1BSB A;  1E3R A;  2W03 A;  3X3X A;  3ZG0 A;  1OHP A;  2QIY A;  2WGO A;  2ZA4 A;  2J8X B;  3CCV 3;  1C7H A;  4AKY A;  1BNI A;  3CCS 3;  3VGN A;  1T5Y A;  1RGL A;  4BTW A;  1I0X A;  2CFW A;  1FA3 A;  3GZX B;  1N5H A;  1VQ9 3;  1CQS A;  1VQP 3;  1Q7H A;  1O7M B;  1A2P A;  1V57 A;  3PYJ A;  1LOY A;  3BU4 A;  4ILF A;  1VQQ A;  1RTU A;  4HAA A;  1IK3 A;  3NM7 A;  3Q90 A;  1A67 A;  2GBW B;  1RGE A;  3HZP A;  1AY7 A;  1RN7 A;  1BRG A;  5ELU A;  8CHO A;  3IJE B;  3SOY A;  1BAN A;  2GU3 A;  1ULI B;  4FR9 A;  4GHO A;  4KT3 B;  5IER A;  1JB2 A;  5DRV A;  4N6L A;  1K73 4;  1PFP A;  1NO3 A;  2WOF A;  1OF5 A;  3M8C A;  2CX0 A;  3AMO A;  3MSO A;  2OQE C;  1LOW A;  1S5A A;  2JQ5 A;  2ZHX B;  1BNJ A;  1LQM B;  2RBI A;  3EN8 A;  1RN4 A;  9RNT A;  1LQG C;  1BGS A;  3A76 A;  4HM3 B;  3MG3 A;  4DKI A;  1G02 A;  4EV2 A;  1YJ9 3;  3BIR A;  3FG3 A;  5CLK A;  1OPY A;  1R4C A;  5BU4 A;  2XFS A;  1JKG B;  3G6E 3;  5D82 A;  1TRP A;  1JNQ A;  2GEX A;  2BO9 B;  3CU3 A;  2E2T A;  4R9L A;  4HZB B;  1TRQ A;  3ROB A;  3MYT A;  2W9P A;  1RGG A;  5IEN A;  2Q07 A;  1DMQ A;  2K3D A;  1UW1 A;  1YHQ 3;  1VQN 3;  2YX9 A;  1FUT A;  3OXA A;  5AIF A;  3NBR A;  1JBS A;  1I3I A;  1TP6 A;  4HM4 B;  1N9J A;  1BNS A;  3KFQ C;  3UNL A;  4IIA A;  3DM8 A;  1UI7 A;  3IPT A;  1HU9 A;  5G2G A;  3NBB A;  1RSN A;  3WMD A;  2D1W A;  1WTH A;  1NB5 I;  3F7X A;  3LTA A;  2HMK B;  3LOY A;  1V58 A;  3EN1 B;  2Y74 A;  3FF2 A;  2BMO B;  3WOE B;  1RHL A;  1MOL A;  4XBX A;  3G8Z A;  2C4B A;  2L4V A;  1OCV A;  3I0Y A;  3I56 3;  4LSO A;  2KF6 A;  1EEJ A;  3OW2 2;  3DGO A;  3FH1 A;  4FCZ A;  4O2H A;  1PU4 A;  4Q53 A;  3FG4 A;  4XB5 A;  2F99 A;  3LTC A;  4HYZ A;  4WP5 A;  3D3L A;  3NUV A;  4O8S A;  3SED A;  1LOX A;  2IUK A;  2LQV A;  4U13 A;  4NHF A;  5AIG A;  3DGN A;  3GRD A;  1Q42 A;  4HBR A;  4HM7 B;  7GSP A;  4O3V A;  3UB1 A;  1TIJ A;  2CK3 H;  4OUQ A;  4HM8 B;  3VF1 A;  3JUO A;  1MWT A;  1X1U A;  3FF0 A;  3J7Y d;  1FGR A;  1S72 3;  3UJM A;  3CME 3;  1RNB A;  3KZT A;  1YNV X;  2OOV A;  1OHO A;  4N6M A;  2XH9 A;  3B7C A;  3NBJ A;  3MPH A;  1VQM 3;  3S28 A;  1M1K 4;  4WFO A;  3CCU 3;  2MF7 A;  5CF1 A;  1IYY A;  2PNC A;  1Q40 B;  5IF6 A;  2RSX A;  1GOY A;  3ER7 A;  5LC6 A;  1BUQ A;  2XRX B;  1OH0 A;  2KXG A;  3SYU A;  2YFJ B;  5HOH A;  3PS8 A;  4EW5 A;  1GOV A;  1ROA A;  2CX1 A;  3X41 A;  1TU5 A;  1IDP A;  4KFF A;  5M1A A;  3BND A;  2Z6B A;  1Q7Y 4;  1IQX A;  1FYS A;  2V1L A;  3D4A A;  5AEU B;  1E3V A;  2STD A;  3OWY A;  3F40 A;  3NQZ A;  1QVG 2;  4MJD A;  2CKF B;  3AGN A;  4RNZ A;  4HKV B;  5RNT A;  3U1W A;  3H51 A;  1EG9 B;  2PZV A;  2KF4 A;  2GXF A;  3B4P A;  1K8A 4;  3STD A;  1T2H A;  4HM0 B;  2WOH A;  1A2V A;  1X1X A;  4EXR A;  1KSI A;  2YFL B;  4JF8 A;  3LTB A;  1LXE A;  2L1S A;  1QAL A;  1X1Y A;  1JJ2 2;  3FLJ A;  3CMA 3;  3BNE A;  1D6Z A;  1W01 A;  3PCR A;  3EBT A;  1LOV A;  5AIH A;  1NB3 I;  4NPB A;  3F8H A;  1M90 4;  1SPU A;  4HZ9 B;  4AEQ A;  1RRH A;  1O7P B;  1V74 A;  3ECF A;  1CYU A;  1DMN A;  3MHE A;  2H0I A;  1FW7 A;  4XM4 A;  1ZGX A;  1NJI 4;  1BIR A;  1OUN A;  1RNT A;  1ZO2 A;  1WMO A;  1LRA A;  4LYL B;  2HML B;  3O8Y A;  2E2V A;  4R4K A;  3F7S A;  1EKM A;  2F98 A;  1YI2 3;  5G1K A;  3HIG A;  1BRH A;  4LZI A;  3S5C A;  2RFR A;  3K9M C;  3F9S A;  4WWU C;  8RNT A;  5KP1 A;  3CC2 3;  3CCJ 3;  1TFK A;  1IVV A;  2KCD A;  2UGI A;  1W5Z A;  1I2G A;  1MWR A;  1LNH A;  3PGB A;  3SOA A;  2W04 A;  2XEP A;  1QVF 2;  1N8R 4;  1BU4 A;  4KZ1 A;  4HOH A;  4BIR A;  4X2H A;  1Q9E A;  1GS3 A;  4WYK B;  2HMN B;  1RGC A;  4LGQ A;  1M1X B;  1RMS A;  2FGT A;  2HMO B;  2OOV C;  1JBR A;  4HM1 B;  4MMY B;  4HVN A;  3CPO A;  3JUQ A;  1Y4K A;  3S27 A;  1D6Y A;  1AVL A;  1TTO A;  4EV5 A;  3CPW 2;  3KN4 A;  4N6T A;  2CW9 A;  3DGM A;  4FMC A;  3CC4 3;  3HK4 A;  4J8T A;  3LT8 A;  3CXC 2;  1RJO A;  2IMJ A;  3WR2 A;  2W0Q A;  2CIU A;  3BNB A;  5TGN A;  1FGO A;  3N8B A;  1VQ4 3;  1I3F A;  1MGW A;  2HMJ B;  3KKG A;  4XBY A;  3CD6 3;  1WMP A;  4XDV A;  4XBT A;  3SXX A;  3EJV A;  4FMD A;  5M19 A;  3NHX A;  1BSC A;  3T8N A;  2IYJ A;  3X3Y A;  4CCV A;  1B2U A;  1IU7 A;  1QMA A;  2XR8 B;  3SVA A;  6RNT A;  1NDO B;  3Q3F A;  3UL6 A;  3V92 A;  2F5W A;  1BSA A;  1BSD A;  1OAC A;  3EF8 A;  3GSP A;  3KE7 A;  2UX0 A;  5AYS C;  5AII A;  4J5G A;  2OTL 3;  1VQ7 3;  2B24 B;  2CFD A;  3G16 A;  1NWW A;  1O7G B;  2W9Q A;  5IW9 A;  3OV4 A;  2P38 A;  2XSO B;  3MG2 A;  2CG0 A;  4K1U A;  1JZD A;  6STD A;  1A90 A;  4HJL B;  3SLU A;  1AV4 A;  3MG1 A;  4N6V 0;  1PYL A;  3D79 A;  3OWS A;  1D6U A;  1JB4 A;  1RGK A;  3LXU X;  1VZZ A;  1SII A;  1JN5 B;  4LEH A;  3KCH A;  4H61 A;  1UGH I;  2I9W A;  2KRT A;  1VQ6 3;  1FZU A;  4KVH A;  3KII A;  1K41 A;  4CPK A;  4N6O B;  3X42 A;  2CFG A;  2GEY A;  5G1L A;  5JPU A;  2IY2 A;  4MMZ B;  1B2M A;  2P0X A;  1IVU A;  1EUI C;  1EA2 A;  1TUH A;  1R4Y A;  3RGR A;  3KSE D;  1RKY A;  2RNT A;  4TX4 A;  5IG4 A;  3JUP A;  5LC7 A;  1W6Y A;  1WNH A;  3LZA A;  4FMA A;  4H3U A;  7STD A;  2SAR A;  2XFT A;  1W2Z A;  2O9U X;  5IG3 A;  1KQS 2;  1UCI A;  1UUW B;  3CNX A;  4HM5 B;  5EEO A;  1GYB A;  2QA4 3;  2QGU A;  2XSH B;  3Q1C A;  1BVI A;  5KP4 A;  1IQY A;  1UUG B;  1Q81 4;  2BHM A;  1OGZ A;  1FGQ A;  2CWT A;  3EB8 A;  1BNE A;  2YFI B;  4IPB A;  2ZL8 A;  3EE1 A;  4BL2 A;  2BU4 A;  1TJD A;  2IA7 A;  1B2Z A;  2CC3 A;  2F56 A;  3FCS B;  1JB5 A;  2K0M A;  3EX9 A;  4O02 B;  2KF5 A;  3WA3 A;  1JBT A;  2Z76 A;  2CH9 A;  1B3S A;  3RDE A;  1UCJ A;  2OCT A;  4GB5 A;  1CH0 A;  2HMM B;  1HZ1 A;  2QEX 3;  1BRI A;  3OX9 A;  1BAO A;  4KFD A;  2BT3 A;  1YVS A;  1BOX A;  2CWV A;  4NRE A;  4EYC A;  4I4K A;  1DYU A;  2W56 A;  2F86 B;  2WGQ A;  2C11 A;  1BNR A;  3KSP A;  1QJG A;  1W00 A;  4MEI A;  1YGE A;  2UUG C;  1O7N B;  2BNG A;  3DY5 A;  2RGQ A;  1OHS A;  3JUM A;  3GAX A;  4G1M B;  3T0U A;  3WA2 X;  3WOF B;  3G71 3;  3QRD A;  1FGM A;  1STD A;  2H0G A;  3DGL A;  3PZW A;  4PEJ A;  2MC8 A;  1VQ8 3;  1JZO A;  1RGH A;  5AYR B;  3TDG A;  1OF5 B;  3NM2 A; 
#chains in the Genus database with same CATH homology
 3I55 3;  3K7C A;  3AMO B;  3G0K A;  4RNY A;  1TFO A;  3WDG B;  1OGX A;  3L0R A;  2RCD A;  3EQQ B;  1FGT A;  4R1K A;  3S67 A;  1YIJ 3;  4EC6 A;  5CF2 A;  2P05 A;  1U8C B;  3BNC A;  1GD3 A;  5D81 A;  3JUN A;  1FUW A;  1DVC A;  2JDI H;  3EBY A;  4RZM A;  3GWR A;  3NV0 A;  1G96 A;  3BLZ A;  3GZY B;  5IEO A;  4L8O A;  1KD1 4;  1IV9 A;  4JRF A;  3Q2P A;  1IT8 A;  3LT9 A;  5IEP A;  3LH4 A;  4RBN A;  1YJN 3;  3FKA A;  5A0O B;  5JPP A;  2OWP A;  1N8Q A;  4N6N B;  1YVB I;  2B1X B;  5BVB A;  4KFE A;  1SJW A;  2Z7A A;  2GU1 A;  2K54 A;  3B8L A;  1W02 A;  1WMN A;  4OK0 A;  1W7C A;  5KP3 A;  3V99 A;  5FW5 A;  4LMI A;  4WHA A;  2ZDJ A;  1SIH A;  2W6J H;  2IUJ A;  1O7H B;  3PXM A;  1VQ5 3;  3LML A;  3QK9 A;  3NXJ A;  4ORL A;  2FXT A;  3U97 A;  3CNM A;  1SQW A;  1UI8 A;  2CWU A;  3EC9 A;  2O3O A;  1HKX A;  1IT7 A;  2ML5 A;  3NQY A;  4N3V A;  3X40 A;  3HII A;  2D42 A;  3G4S 3;  1ZX2 A;  1YJW 3;  1GY6 A;  1JRQ A;  3H3H A;  1WQL B;  1STF I;  1Q86 4;  3V98 A;  3DXO A;  3FGY A;  1IVX A;  1K28 A;  1U5O A;  4WYK A;  1GD4 A;  1Z1S A;  1W6G A;  3DUK A;  1W4N A;  3SX1 A;  4GL6 A;  4K61 A;  1Q82 4;  3DZL A;  3HX8 A;  3RGA A;  2GBX B;  3BB9 A;  2XGN A;  5FGO A;  4ZM8 A;  1ISK A;  4K90 B;  3MWZ A;  3WOD G;  3E99 A;  5CXO A;  3CCM 3;  2INX A;  3NX0 A;  3FG1 A;  1JKG A;  1VQO 3;  1LVN A;  3JVC A;  1M9G A;  2CG1 A;  1JV2 B;  1NU3 A;  5HGR A;  5IG0 A;  2P0M A;  3PCS A;  1KC8 4;  3DMC A;  1AVK A;  4BTX A;  2WO0 A;  3UL5 A;  2A15 A;  1W6C A;  2BMR B;  2LYX A;  4FCJ A;  1YIT 3;  1KWI A;  1RRL A;  4EBG A;  2R4I A;  1ULJ B;  1E97 A;  1O7W B;  3LYG A;  2W56 B;  4AKZ A;  4XDW A;  1AR0 A;  5AI1 A;  1QAK A;  4L8P A;  3CCR 3;  5ELJ A;  5I97 A;  3EHC A;  4R80 A;  4HM6 B;  5IG5 A;  4OVM A;  3K5T A;  3F14 A;  3T8U A;  4HM2 B;  5EQL A;  3N54 B;  1J2B A;  2OQE A;  1VQL 3;  1A2K A;  3LTD A;  4J9A A;  4FCM A;  4K1V A;  1DVD A;  2XGL A;  3CCL 3;  4CDL A;  2FNQ A;  5AEW B;  5EVH A;  3K63 A;  1L5G B;  2W2C A;  2XF3 A;  1DMM A;  1JN5 A;  2C10 A;  4FMB A;  2Y73 A;  1ROV A;  2Z77 A;  4N6U A;  1GY5 A;  3X3Z A;  4L7K A;  1IQ8 A;  3F8X A;  1EQK A;  3GZR A;  3IMA B;  1CYV A;  3NV0 B;  1N9E A;  4QWT A;  1W2B 2;  1UUV B;  3VSY A;  1N5P A;  4X2O A;  4MMX B;  5BXQ A;  2CFL A;  5CK6 A;  5STD A;  1F8N A;  3B4O A;  4IT7 A;  3FZW A;  3K0Z A;  1MNL A;  2BMQ B;  4R9K A;  1Q40 A;  2ML6 A;  2E2U A;  2SBL A;  3ALA A;  1QAF A;  3CCE 3;  1IV7 A;  3CC7 3;  2CFK A;  3OWU A;  3FSD A;  1US1 A;  4STD A;  1ASK A;  1K9M 4;  3S29 A;  2CHC A;  3N9H A;  2M7O A;  3MKI A;  1IVW A;  3D9R A;  1CEW I;  2P09 A;  5JBS A;  4BTY A;  1GY7 A;  3HI7 A;  1VQK 3;  3CCQ 3;  3GZB A;  5DRE A;  5D83 A;  1E3R A;  2W03 A;  3X3X A;  1OHP A;  2QIY A;  2WGO A;  3CCV 3;  1C7H A;  4AKY A;  3CCS 3;  3VGN A;  1T5Y A;  4BTW A;  1FA3 A;  2CFW A;  3GZX B;  1N5H A;  1VQ9 3;  1CQS A;  1VQP 3;  1O7M B;  3PYJ A;  1IK3 A;  3NM7 A;  3Q90 A;  1A67 A;  2GBW B;  3HZP A;  1RN7 A;  5ELU A;  8CHO A;  3IJE B;  3SOY A;  2GU3 A;  4FR9 A;  1ULI B;  5IER A;  1K73 4;  1JB2 A;  5DRV A;  4N6L A;  1PFP A;  1NO3 A;  2WOF A;  1OF5 A;  3M8C A;  3AMO A;  3MSO A;  2OQE C;  1S5A A;  2JQ5 A;  3CMA 3;  2OTJ 3;  3EN8 A;  4EV2 A;  3A76 A;  4HM3 B;  3MG3 A;  1YJ9 3;  3FG3 A;  5CLK A;  1OPY A;  1R4C A;  2XFS A;  1JKG B;  3G6E 3;  5D82 A;  1JNQ A;  2GEX A;  2BO9 B;  3CU3 A;  2E2T A;  4R9L A;  4HZB B;  3ROB A;  3MYT A;  2W9P A;  5IEN A;  2Q07 A;  1DMQ A;  1YHQ 3;  1UW1 A;  1VQN 3;  2YX9 A;  3OXA A;  5AIF A;  3NBR A;  1TP6 A;  4HM4 B;  1N9J A;  3KFQ C;  3UNL A;  4IIA A;  3DM8 A;  1UI7 A;  3IPT A;  1HU9 A;  5G2G A;  3NBB A;  3WMD A;  2D1W A;  1WTH A;  1NB5 I;  3F7X A;  3LTA A;  2HMK B;  3LOY A;  3EN1 B;  2Y74 A;  3FF2 A;  2BMO B;  3WOE B;  1MOL A;  4XBX A;  3G8Z A;  2L4V A;  1OCV A;  3I0Y A;  3I56 3;  4LSO A;  3OW2 2;  3DGO A;  3FH1 A;  4FCZ A;  4O2H A;  1PU4 A;  4Q53 A;  3FG4 A;  4XB5 A;  2F99 A;  3LTC A;  4HYZ A;  4WP5 A;  3D3L A;  3NUV A;  4O8S A;  3SED A;  1LOX A;  2IUK A;  2LQV A;  4U13 A;  4NHF A;  5AIG A;  3DGN A;  3GRD A;  1Q42 A;  4HM7 B;  4O3V A;  3UB1 A;  1TIJ A;  2CK3 H;  4OUQ A;  4HM8 B;  3VF1 A;  3JUO A;  3FF0 A;  3J7Y d;  1FGR A;  1S72 3;  3UJM A;  3CME 3;  3KZT A;  2OOV A;  1OHO A;  4N6M A;  2XH9 A;  3B7C A;  3NBJ A;  3MPH A;  1VQM 3;  3S28 A;  1M1K 4;  4WFO A;  3CCU 3;  2MF7 A;  5CF1 A;  2PNC A;  1Q40 B;  5IF6 A;  2RSX A;  3ER7 A;  5LC6 A;  1BUQ A;  2XRX B;  1OH0 A;  2KXG A;  2YFJ B;  3PS8 A;  1ROA A;  3X41 A;  1TU5 A;  1IDP A;  4KFF A;  3BND A;  2Z6B A;  1Q7Y 4;  1IQX A;  2V1L A;  5AEU B;  1E3V A;  2STD A;  3OWY A;  3F40 A;  3NQZ A;  1QVG 2;  4MJD A;  2CKF B;  4RNZ A;  4HKV B;  3U1W A;  3H51 A;  1EG9 B;  2PZV A;  2GXF A;  3B4P A;  1K8A 4;  3STD A;  4HM0 B;  2WOH A;  1A2V A;  4EXR A;  1KSI A;  2YFL B;  4JF8 A;  3LTB A;  1LXE A;  1QAL A;  1JJ2 2;  3FLJ A;  3BNE A;  1D6Z A;  1W01 A;  3PCR A;  3EBT A;  5AIH A;  1NB3 I;  1M90 4;  3F8H A;  1SPU A;  4HZ9 B;  4AEQ A;  1RRH A;  1O7P B;  1V74 A;  3ECF A;  1CYU A;  1DMN A;  3MHE A;  4XM4 A;  1NJI 4;  1OUN A;  1ZO2 A;  1WMO A;  2HML B;  3O8Y A;  2E2V A;  4R4K A;  3F7S A;  1EKM A;  2F98 A;  1YI2 3;  3HIG A;  3S5C A;  4LZI A;  3CC2 3;  2RFR A;  3K9M C;  3F9S A;  4WWU C;  5KP1 A;  3CCJ 3;  1TFK A;  1IVV A;  2KCD A;  1W5Z A;  3PGB A;  1LNH A;  3SOA A;  2W04 A;  2XEP A;  1QVF 2;  1N8R 4;  4KZ1 A;  4X2H A;  1GS3 A;  4WYK B;  2HMN B;  4LGQ A;  1M1X B;  2FGT A;  2HMO B;  2OOV C;  4HM1 B;  4MMY B;  4HVN A;  3CPO A;  3JUQ A;  1Y4K A;  3S27 A;  1D6Y A;  1AVL A;  4EV5 A;  3CPW 2;  3KN4 A;  4N6T A;  2CW9 A;  3DGM A;  4FMC A;  3CC4 3;  3HK4 A;  4J8T A;  3LT8 A;  3CXC 2;  1RJO A;  2IMJ A;  2W0Q A;  2CIU A;  3BNB A;  5TGN A;  1FGO A;  3N8B A;  1VQ4 3;  2HMJ B;  3KKG A;  4XBY A;  3CD6 3;  1WMP A;  4XDV A;  4XBT A;  3SXX A;  3EJV A;  4FMD A;  3NHX A;  3T8N A;  3X3Y A;  4CCV A;  1IU7 A;  1QMA A;  2XR8 B;  3SVA A;  1NDO B;  3UL6 A;  3V92 A;  3KE7 A;  1OAC A;  3EF8 A;  2UX0 A;  5AYS C;  5AII A;  2OTL 3;  1VQ7 3;  2B24 B;  2CFD A;  3G16 A;  1NWW A;  1O7G B;  2W9Q A;  5IW9 A;  3OV4 A;  2P38 A;  2XSO B;  3MG2 A;  2CG0 A;  4K1U A;  6STD A;  1A90 A;  4HJL B;  3SLU A;  1AV4 A;  3MG1 A;  4N6V 0;  3OWS A;  1D6U A;  1JB4 A;  3LXU X;  1VZZ A;  1SII A;  1JN5 B;  4LEH A;  4H61 A;  2I9W A;  2KRT A;  1VQ6 3;  4KVH A;  3KII A;  1K41 A;  4N6O B;  3X42 A;  2CFG A;  2GEY A;  5JPU A;  4MMZ B;  2P0X A;  1IVU A;  1EA2 A;  1TUH A;  3RGR A;  3KSE D;  1RKY A;  4TX4 A;  5IG4 A;  3JUP A;  5LC7 A;  1W6Y A;  1WNH A;  3LZA A;  4FMA A;  4H3U A;  7STD A;  2XFT A;  1KQS 2;  1W2Z A;  2O9U X;  5IG3 A;  1UUW B;  3CNX A;  4HM5 B;  5EEO A;  1GYB A;  2QA4 3;  2QGU A;  2XSH B;  3Q1C A;  5KP4 A;  1IQY A;  1Q81 4;  2BHM A;  1OGZ A;  1FGQ A;  2CWT A;  3EB8 A;  2YFI B;  4IPB A;  2ZL8 A;  3EE1 A;  2IA7 A;  2CC3 A;  3FCS B;  1JB5 A;  2K0M A;  3EX9 A;  4O02 B;  3WA3 A;  2Z76 A;  2CH9 A;  3RDE A;  2OCT A;  4GB5 A;  2HMM B;  2QEX 3;  3OX9 A;  4KFD A;  2BT3 A;  2CWV A;  4NRE A;  4EYC A;  4I4K A;  1DYU A;  2WGQ A;  2F86 B;  2W56 A;  2C11 A;  3KSP A;  1QJG A;  1W00 A;  4MEI A;  1YGE A;  1O7N B;  2BNG A;  3DY5 A;  2RGQ A;  1OHS A;  3JUM A;  3GAX A;  4G1M B;  3T0U A;  3WA2 X;  3WOF B;  3G71 3;  3QRD A;  1FGM A;  1STD A;  3DGL A;  3PZW A;  4PEJ A;  2MC8 A;  1VQ8 3;  4HBR A;  5AYR B;  3TDG A;  1OF5 B;  3NM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...