3CCQ3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccq300
2OTJ3 3CCJ3 1VQM3 1YIJ3 1KC84 1VQP3 1M904 3CCR3 1YIT3 1Q814 1QVG2 1VQ63 1KQS2 3I563 3CXC2 1JJ22 3CC73 3G4S3 3G713 1VQ53 1W2B2 3G6E3 1VQ43 1Q864 3CD63 1K9M4 3CC23 3CCE3 1VQL3 3CCV3 3CPW2 1K8A4 3CCM3 1YHQ3 1NJI4 3CCS3 1N8R4 1S723 3CMA3 2QEX3 1K734 1VQ83 3CC43 2QA43 2OTL3 1YJW3 1YJ93 1VQN3 1Q7Y4 1VQ73 1VQ93 1QVF2 1VQO3 1VQK3 1KD14 1M1K4 3CME3 3I553 1YJN3 3CCU3 1YI23 1Q824 3CCQ3 3OW22 3CCL3
chains in the Genus database with same CATH superfamily
5IERA 4WWUC 9RNTA 3MKIA 2FNQA 1D6UA 1QVG2 2CFLA 4HM3B 4WYKB 2XFTA 4PEJA 1SPUA 1VQ53 3VF1A 2F4YA 4MMZB 3L0RA 3BNEA 2L1SA 4XM4A 1SQWA 2Z77A 3PCRA 3AMOB 3CPW2 3ALAA 3KFQC 3T0UA 1EQKA 1M1XB 2CHCA 3JUQA 4OVMA 2R4IA 5LC7A 3V99A 1RMSA 2ML6A 1B3SA 4HM0B 4K1UA 4K90B 1RGFA 1BIRA 5IG0A 1UUGB 3EF8A 2W04A 1RTUA 3EC9A 7GSPA 1VQ93 1FA3A 1BSEA 4HYZA 3X40A 5STDA 3BB9A 3NBBA 4BL3A 1HKXA 1X1UA 2LYXA 4O3VA 2P38A 4JF8A 2E2UA 3X3XA 4AKZA 3BLZA 3KSED 3CXC2 3B4PA 3JVCA 3G713 1W2B2 3LTCA 4L8OA 3CD63 3EN1B 1RRLA 1A2PA 2CG1A 3V92A 1FYSA 1G0TA 1OACA 2BMRB 1RGEA 3FSDA 4HZBB 1GY6A 4XDVA 1FGRA 2WO0A 1W7CA 2F56A 1O7PB 2XF3A 2BIRA 3NXJA 1GSPA 3BNCA 2QA43 1CYVA 5DREA 3VSYA 1A90A 1VQK3 5IEOA 2YFJB 3KCHA 2BMOB 3KKGA 3Q2PA 5D82A 3LT9A 5RNTA 1KC84 1I3FA 3N54B 2GBWB 1MWUA 3G8ZA 2QIYA 1RCLA 2V1LA 1TRQA 4BTYA 3G4S3 4EV2A 2F5WA 4BIRA 2WOHA 2JQ5A 2HMJB 1OGXA 4MMYB 4H3UA 2O9UX 3D3LA 1FW7A 1T3BA 2MC8A 3CCS3 2CFGA 2W9QA 3NBRA 1JZDA 1NB3I 1UI8A 1W6CA 4IT7A 1U8CB 4KT3B 4LGQA 1FZUA 4MEIA 3D4AA 2CK3H 1BU4A 1JKGB 1TUHA 3FZWA 4OUQA 4R80A 3SX1A 1MWRA 3NV0A 4HOHA 1VQN3 4FMCA 3JUPA 1S5AA 2FGTA 3EN8A 2GU3A 3OWYA 2H0GA 1RN4A 2XSHB 3K0ZA 3WODG 2P05A 3D9RA 3WOFB 2E2TA 1QJGA 3NBJA 2KRTA 5AEUB 3T8UA 2OTJ3 4HM7B 1YNVX 1MGWA 3LZAA 3CU3A 3LOYA 1YGWA 1IK3A 2CX1A 3Q3FA 1TU5A 1CQSA 1FGMA 2IUKA 3F7XA 2HOHA 1RNTA 1UGHI 5TGNA 3PZWA 4KFDA 1WMNA 1V58A 1FUWA 1Q40B 3PGBA 4I5QA 1JN5B 4H61A 4CCVA 1UCKA 2AADA 3IJEB 1BRKA 2GU1A 5G2GA 1K41A 2QGUA 5JPPA 3BNBA 5A0OB 3HZPA 2INXA 3Q90A 1MWTA 2JDIH 3F8XA 4FCZA 2C11A 1N5PA 2XEPA 1BOXA 1JB5A 1JV2B 1O7WB 1BGSA 2W56B 3IMAB 1OPYA 3LTAA 5AI1A 1YJN3 3T8NA 5IG5A 2F5MA 1LNIA 4IPBA 2KF4A 3MHEA 4OK0A 4RNZA 1A2VA 3DGNA 1ROAA 4NREA 3RNTA 6GSPA 8RNTA 1LOVA 2ZA4A 1OHOA 1RCKA 4BTXA 4RZMA 3ZFZA 2HMLB 4EC6A 2WOFA 1ZGXA 3URPA 3K5TA 2PNCA 2O3OA 4FCMA 4EW5A 1K8A4 4HBRA 1RLSA 5ELUA 1WTHA 1B21A 4BU4A 4HKVB 5IW9A 1QAKA 1GD3A 1RGKA 3GAXA 3EQQB 5DRVA 4NHFA 2XR8B 3LTBA 6RNTA 1BRSA 2XGLA 3RGAA 3RGRA 5BVBA 5CF1A 1VQ83 1RRHA 2PZVA 4LEHA 1C54A 2HMMB 4GHOA 3IPTA 2FXTA 4N6V0 1W6YA 1I70A 4QWTA 4FMBA 5EEOA 1E97A 2I9WA 4R1KA 3X3YA 3DXOA 4KFFA 3I553 4O8SA 1ISKA 1TP6A 4EBGA 3FLJA 5LC6A 3FG3A 1DVDA 2R41A 2SBLA 4HM1B 3I563 2XGNA 1KQS2 1VQ63 1JBRA 1OF5A 3D79A 1HZ1A 1T5YA 1Q9EA 2W6JH 2RNTA 1WMOA 1VQL3 3JUOA 1V74A 2OWPA 4X2OA 1BRIA 2CWUA 1UI7A 1B2SA 1IT7A 1BRHA 3F9SA 1MWSA 3LT8A 2OOVC 3AGNA 4EXRA 3OWUA 4WYKA 2B1XB 3M8CA 4GB5A 1IVWA 1TFOA 1TJDA 1YI23 1QALA 1BSBA 3F14A 4XBYA 1CYUA 5M19A 1B2ZA 1BNJA 5AYSC 4HM2B 1ZS7A 3GZXB 5CLKA 4STDA 2RSXA 3DH2A 1JZOA 1IVVA 1NDOB 3QRDA 3WR2A 3LMLA 1WNHA 2OQEC 1BAOA 3CCV3 1BRJA 1IV7A 1NJI4 1DVCA 4R9KA 1YVBI 4CPKA 5JBSA 4FMAA 1IVXA 1Q7HA 2STDA 4J9AA 1BSDA 3FG1A 3GZRA 2OTL3 1N9EA 1WQLB 4GSPA 3EE1A 1IQYA 3EX9A 2IMJA 1BSCA 4KZ1A 3ZG5A 1G02A 1M9GA 2RBIA 3OW22 3UB1A 3H51A 3NX0A 3SOYA 4TX4A 1IT8A 7STDA 1Q7Y4 4KVHA 2IYJA 1K28A 3F40A 2XSOB 5D83A 1BRGA 1Y4KA 5HOHA 2IA7A 3H3HA 2M7OA 3FF0A 1FUSA 4KFEA 1LOYA 1BNFA 1UCJA 2Y73A 3WDGB 1DMMA 1RN1A 1UGIA 1B2UA 5AIHA 3FH1A 1NB5I 3CC43 4JRFA 5IG4A 4AEQA 1JBSA 1FGOA 3KIIA 4DKIA 2CC3A 2GXFA 2H0HA 1BSAA 5M18A 1N8QA 1UDII 1Z1SA 1Q824 1MOLA 3CCL3 3STDA 4J5GA 1A67A 3EBTA 4HAAA 3U1WA 3I0YA 6STDA 2YFLB 2RCDA 2KAAA 3ECFA 1U5OA 3LH4A 3CC73 4HM6B 1RGCA 8CHOA 1BNEA 1GY5A 1LXEA 3GRDA 3N8BA 4N6UA 2E2VA 1RGGA 1VQ43 3SEDA 4L8PA 4ORLA 1BNSA 5AIFA 2BHMA 3NHXA 3N9HA 3FCSB 3OXAA 1C7HA 2MF7A 3F8HA 4N6OB 5AIIA 2KF5A 5I97A 1AR0A 1BANA 1OHSA 3B4OA 1LVNA 2CIUA 4FMDA 1A2KA 1NU3A 1OH0A 4O02B 4Q53A 4RNTA 5G1LA 2K0MA 1PU4A 2F98A 4MJDA 3CNMA 2KCDA 3MYTA 2CWVA 2A15A 2OOVA 1Q40A 5GSPA 1STFI 3TDGA 2GEXA 1YIT3 3E99A 1D6ZA 2K54A 2P09A 1JJ22 4U13A 4N3VA 3LYGA 3WHOA 3G6E3 1DE3A 1AVLA 2ZL8A 1DYUA 3BU4A 3ROBA 1I3IA 1Q864 3CC23 5EQLA 2XFSA 3HOHA 4R4KA 3MPHA 3SLUA 3RDEA 1BVIA 1I0XA 1PY3A 1D6YA 4LSOA 1Q42A 1UCLA 1L5GB 2GSPA 2IUJA 1AVKA 1O7HB 2OQEA 3A5EA 1YJW3 1LOXA 4FR9A 1EUIC 1VZZA 3Q1CA 1IDPA 1IQXA 1T2HA 4G1MB 2CX0A 2W03A 1M1K4 1BNIA 1RDSA 1UUWB 1N5HA 1VQP3 3FGYA 1QAFA 4BTWA 1I8VA 1I2GA 3KN4A 4HM8B 3NUVA 3D5IA 5IEPA 3K9MC 3GWRA 1G96A 3NQZA 4IIAA 5FW5A 2B24B 1BUQA 5CF2A 2Z7AA 3ZG0A 3DMCA 1JRQA 3EB8A 1EEJA 4K61A 1BUJA 1RJOA 1STDA 3D5GA 3S28A 1FGTA 3BIRA 3CCM3 1YHQ3 1GMQA 1AY7A 3CMA3 4R9LA 2QEX3 2RGQA 1IVUA 1SJWA 1MGRA 4ILFA 2CW9A 4N6LA 2CFKA 1CH0A 1EA2A 1W01A 1NNVA 1IQ8A 3WMDA 2C10A 3KE7A 3VGNA 1B20A 5BU4A 3DZLA 1ULIB 3CCU3 1YGEA 1LOWA 1IYYA 1FUTA 1I2EA 2P0XA 1GMPA 3OX9A 1M904 1SARA 3AMOA 1Q814 3WOEB 1JB2A 3HX8A 4NPBA 2W0QA 4I4KA 3MG1A 1B2XA 3LTDA 7RNTA 1OGZA 3PYJA 2RFRA 2GEYA 1GYBA 5BIRA 3X3ZA 1ZX2A 3V98A 2Z76A 1MNLA 4CJNA 1ZO2A 1W02A 2P0MA 1R4CA 4EYCA 1N9JA 1W6GA 2F86B 3MWZA 3CNXA 5CK6A 1K734 4N6TA 1UCIA 2W2CA 1YJ93 1B2MA 1ULJB 5AYRB 2AAEA 2LQVA 3MG3A 1X1WA 3AHSA 3DGLA 3X42A 1QVF2 5HGRA 4GL6A 1JB4A 3ER7A 3S27A 5BXQA 1JBTA 2L4VA 5CXOA 1E3VA 2WGQA 5AIGA 3J7Yd 3HIIA 3PS8A 1YIJ3 3B8LA 1F8NA 1O7NB 2W9PA 3CCR3 1J2BA 1US1A 5G1KA 2XH9A 1I2FA 3K63A 1AQZA 3HI7A 3SVAA 1WMPA 3GSPA 2CH9A 1PFPA 3CPOA 4XBTA 3DY5A 1TFKA 4HM5B 3O8YA 3MG2A 1OUNA 2BT3A 1GY7A 4FCJA 1N8R4 2Z6BA 1R4YA 3DM8A 1RHLA 3S5CA 1GOUA 2GBXB 1BNRA 1FGQA 1RKYA 4J5KA 1RGAA 2BNGA 3JUMA 2KXGA 1VQ73 4XB5A 5IENA 1DMQA 1SIHA 3PXMA 4J8TA 3WA3A 1GMRA 3F7SA 2Q07A 1X1YA 2UUGC 4LMIA 3FKAA 4O2HA 2KF6A 3GZBA 4MMXB 1LRAA 1IU7A 3NV0B 3MSOA 3NM2A 4LYLB 1W00A 4RBNA 1JKGA 4ZM8A 3CCE3 3KSPA 3K7CA 4WP5A 4BL2A 1GD4A 1LQMB 1RGLA 3KZTA 1S723 3LXUX 4HZ9B 2ZHXB 1QMAA 2CFWA 3NQYA 1TTOA 4N6MA 5FGOA 2J8XB 4L7KA 1UW1A 1TRPA 5D81A 3UL5A 1VQO3 3G16A 1TIJA 1B27A 2HMKB 3AGOA 3HK4A 1EKMA 5KP3A 5ELJA 1KSIA 4HVNA 4RNYA 1GOYA 1NWWA 3A76A 5M1AA 1CEWI 1IV9A 3U97A 4AKYA 4HJLB 3CCJ3 1VQM3 4X2HA 1V57A 2D42A 2C4BA 1DETA 2HMNB 3GZYB 1JN5A 1E3RA 1RSNA 3HIGA 1I0VA 2YFIB 3EJVA 3S67A 1SIIA 2YX9A 1LNHA 1W4NA 3UJMA 2BU4A 3WA2X 5KP4A 1K9M4 1W2ZA 2D1WA 1AV4A 2OCTA 3FF2A 3OV4A 1NO3A 2CFDA 2W56A 1RNBA 3SOAA 3UNLA 4LZIA 3DGYA 1HU9A 2BMQB 2BO9B 2XRXB 3S29A 4WHAA 2UX0A 1BRNL 3NM7A 1X1XA 1JNQA 1KD14 1VQQA 3UL6A 1ROVA 4XBXA 3CME3 2CKFB 1EG9B 3B7CA 3BNDA 3SYUA 3DGOA 3CCQ3 1GOVA 4N6NB 1BNGA 3PCSA 3AHWA 2K3DA 5JPUA 1UUVB 2HMOB 4HM4B 3EHCA 4XDWA 1RGHA 1W5ZA 5IF6A 3G0KA 3SXXA 1ASKA 1OCVA 1O7MB 3EBYA 2SARA 2WGOA 2CG0A 4K1VA 4EV5A 2Y74A 5EVHA 3OWSA 5AEWB 1RN7A 1YVSA 1KWIA 5KP1A 1O7GB 3QK9A 2UGIA 3X41A 1OF5B 2CWTA 1GS3A 4CDLA 3DUKA 1PYLA 3DGMA 1LQGC 1OHPA 2F99A 1DMNA 1T2IA 2KF3A 3JUNA 2ML5A 2ZDJA 2IY2A 5IG3A 2H0IA 3FG4A 1HYFA 4WFOA
chains in the Genus database with same CATH topology
5IERA 4WWUC 3MKIA 2FNQA 1D6UA 1QVG2 2CFLA 4HM3B 4WYKB 2XFTA 4PEJA 1SPUA 1VQ53 3VF1A 4MMZB 3L0RA 3BNEA 4XM4A 1SQWA 2Z77A 3PCRA 3AMOB 3CPW2 3ALAA 3KFQC 3T0UA 1EQKA 1M1XB 2CHCA 3JUQA 4OVMA 2R4IA 5LC7A 3V99A 2ML6A 4K1UA 4HM0B 4K90B 5IG0A 3EF8A 2W04A 3EC9A 1VQ93 1FA3A 4HYZA 3X40A 5STDA 3BB9A 3NBBA 1HKXA 2LYXA 4O3VA 2P38A 4JF8A 2E2UA 3X3XA 4AKZA 3BLZA 3KSED 3CXC2 3B4PA 3JVCA 3G713 1W2B2 3LTCA 4L8OA 3CD63 3EN1B 1RRLA 3V92A 2CG1A 2BMRB 1OACA 3FSDA 4HZBB 1GY6A 4XDVA 1FGRA 2WO0A 1W7CA 1O7PB 2XF3A 3NXJA 3BNCA 2QA43 1CYVA 5DREA 3VSYA 1A90A 1VQK3 5IEOA 2YFJB 3KKGA 2BMOB 3Q2PA 5D82A 1KC84 3LT9A 3N54B 2GBWB 3G8ZA 2QIYA 2V1LA 4BTYA 3G4S3 4EV2A 2WOHA 2JQ5A 2HMJB 1OGXA 4MMYB 4H3UA 2O9UX 3D3LA 2MC8A 3CCS3 2CFGA 2W9QA 3NBRA 1NB3I 1UI8A 1W6CA 4IT7A 1U8CB 4LGQA 4MEIA 3SOYA 3WA3A 2CK3H 1JKGB 3FZWA 1TUHA 4OUQA 4R80A 3SX1A 3NV0A 1VQN3 4FMCA 3JUPA 1S5AA 2FGTA 3EN8A 2GU3A 3OWYA 2XSHB 3K0ZA 3WODG 2P05A 3D9RA 3WOFB 2E2TA 1QJGA 3NBJA 2KRTA 5AEUB 3T8UA 2OTJ3 4HM7B 3LZAA 3CU3A 3LOYA 1TU5A 1IK3A 1CQSA 1FGMA 2IUKA 3F7XA 5TGNA 3PZWA 4KFDA 1WMNA 1FUWA 1Q40B 3PGBA 1JN5B 4H61A 4CCVA 3IJEB 2GU1A 5G2GA 1K41A 2QGUA 5JPPA 3BNBA 5A0OB 3HZPA 2INXA 3Q90A 2JDIH 3F8XA 4FCZA 2C11A 1N5PA 2XEPA 1JB5A 1JV2B 1O7WB 2W56B 3IMAB 1YJN3 1OPYA 3LTAA 5AI1A 3T8NA 5IG5A 4OK0A 4IPBA 4RNZA 3MHEA 1A2VA 3DGNA 1ROAA 4NREA 1OHOA 4BTXA 4RZMA 2HMLB 4EC6A 2WOFA 3K5TA 2PNCA 2O3OA 4FCMA 1K8A4 4HBRA 5ELUA 1WTHA 5IW9A 4HKVB 1QAKA 1GD3A 3GAXA 5DRVA 3EQQB 4NHFA 2XR8B 3LTBA 3RGRA 2XGLA 3RGAA 5BVBA 5CF1A 1VQ83 1RRHA 2PZVA 4LEHA 2HMMB 5EEOA 3IPTA 2FXTA 4N6V0 1W6YA 4QWTA 4FMBA 1E97A 2I9WA 4R1KA 3X3YA 3DXOA 4KFFA 3I553 4O8SA 1ISKA 1TP6A 4EBGA 3FLJA 5LC6A 3FG3A 1DVDA 2SBLA 4HM1B 3I563 2XGNA 1KQS2 1VQ63 1OF5A 1T5YA 2W6JH 1WMOA 1VQL3 3JUOA 1V74A 2OWPA 4X2OA 2CWUA 1UI7A 1IT7A 3F9SA 3LT8A 2OOVC 4EXRA 3OWUA 4WYKA 2B1XB 3M8CA 4GB5A 1IVWA 1TFOA 1YI23 1QALA 3F14A 4XBYA 1CYUA 5AYSC 4HM2B 3GZXB 5CLKA 4STDA 2RSXA 1IVVA 1NDOB 3QRDA 3LMLA 1WNHA 2OQEC 3CCV3 1IV7A 1NJI4 1DVCA 4R9KA 1YVBI 5JBSA 4FMAA 1IVXA 2STDA 4J9AA 3FG1A 3GZRA 2OTL3 1N9EA 1WQLB 3EE1A 1IQYA 3EX9A 2IMJA 4KZ1A 1M9GA 3OW22 3UB1A 3H51A 3NX0A 4TX4A 1IT8A 7STDA 4KVHA 1K28A 3F40A 2XSOB 5D83A 1Y4KA 2IA7A 3H3HA 2M7OA 3FF0A 4KFEA 2Y73A 3WDGB 1DMMA 5AIHA 3FH1A 1NB5I 3CC43 4JRFA 5IG4A 4AEQA 1FGOA 3KIIA 2CC3A 2GXFA 1N8QA 1Z1SA 1Q824 1MOLA 3CCL3 3STDA 1A67A 3EBTA 3U1WA 3I0YA 6STDA 2YFLB 2RCDA 3ECFA 1U5OA 3LH4A 3CC73 4HM6B 8CHOA 1GY5A 1LXEA 3GRDA 3N8BA 4N6UA 2E2VA 1VQ43 3SEDA 4L8PA 4ORLA 5AIFA 2BHMA 3NHXA 3N9HA 3FCSB 3OXAA 1C7HA 2MF7A 3F8HA 4N6OB 5AIIA 5I97A 1AR0A 1OHSA 3B4OA 1LVNA 2CIUA 4FMDA 1A2KA 1NU3A 1OH0A 4O02B 4Q53A 2K0MA 1PU4A 2F98A 4MJDA 3CNMA 2KCDA 3MYTA 2CWVA 2A15A 2OOVA 1Q40A 3TDGA 1STFI 2GEXA 1YIT3 3E99A 1D6ZA 2K54A 2P09A 1JJ22 4U13A 4N3VA 3LYGA 3G6E3 1AVLA 2ZL8A 1DYUA 3ROBA 1Q864 3CC23 5EQLA 2XFSA 4R4KA 3MPHA 3SLUA 3RDEA 1D6YA 4LSOA 1Q42A 1L5GB 2IUJA 1AVKA 1O7HB 2OQEA 1YJW3 1LOXA 4FR9A 1VZZA 3Q1CA 1IDPA 1IQXA 4G1MB 1M1K4 2W03A 1UUWB 1N5HA 1VQP3 3FGYA 1QAFA 4BTWA 3KN4A 4HM8B 3NUVA 5IEPA 3K9MC 3GWRA 1G96A 3NQZA 4IIAA 5FW5A 2B24B 1BUQA 5CF2A 2Z7AA 3DMCA 1JRQA 3EB8A 4K61A 1RJOA 1STDA 3S28A 1FGTA 3CCM3 1YHQ3 3CMA3 4R9LA 2QEX3 2RGQA 1IVUA 1SJWA 4N6LA 2CW9A 2CFKA 1EA2A 1W01A 1IQ8A 3WMDA 2C10A 3KE7A 3VGNA 3DZLA 1ULIB 3CCU3 1YGEA 2P0XA 3OX9A 1M904 3AMOA 1Q814 3WOEB 1JB2A 3HX8A 2W0QA 4I4KA 3MG1A 3LTDA 1OGZA 3PYJA 2RFRA 2GEYA 1GYBA 3X3ZA 1ZX2A 3V98A 2Z76A 1MNLA 1ZO2A 1W02A 2P0MA 1R4CA 4EYCA 1N9JA 1W6GA 2F86B 3MWZA 3CNXA 5CK6A 1K734 4N6TA 2W2CA 1YJ93 1ULJB 5AYRB 1QVF2 2LQVA 3MG3A 3DGLA 3X42A 5HGRA 4GL6A 1JB4A 3ER7A 3S27A 5BXQA 2L4VA 5CXOA 2WGQA 1E3VA 5AIGA 3J7Yd 3HIIA 3PS8A 1YIJ3 3B8LA 1F8NA 1O7NB 2W9PA 3CCR3 1J2BA 1US1A 2XH9A 3K63A 3HI7A 3SVAA 1WMPA 4XBTA 2CH9A 1PFPA 3CPOA 3DY5A 1TFKA 4HM5B 3O8YA 3MG2A 1OUNA 2BT3A 1GY7A 4FCJA 1N8R4 2Z6BA 3S5CA 3DM8A 2GBXB 1FGQA 1RKYA 2BNGA 3JUMA 2KXGA 1VQ73 4XB5A 5IENA 1DMQA 1SIHA 3PXMA 4J8TA 3F7SA 2Q07A 4LMIA 3FKAA 4O2HA 3GZBA 4MMXB 1IU7A 3NV0B 3MSOA 3NM2A 1W00A 4RBNA 1JKGA 4ZM8A 3CCE3 3KSPA 3K7CA 4WP5A 1GD4A 3KZTA 1S723 3LXUX 4HZ9B 1QMAA 2CFWA 3NQYA 4N6MA 5FGOA 4L7KA 1UW1A 5D81A 3UL5A 1VQO3 3G16A 1TIJA 2HMKB 3HK4A 1EKMA 5KP3A 5ELJA 1KSIA 4HVNA 4RNYA 1NWWA 3A76A 3U97A 4AKYA 1CEWI 1IV9A 4HJLB 3CCJ3 1VQM3 4X2HA 2D42A 2HMNB 3GZYB 1JN5A 1E3RA 3HIGA 2YFIB 3EJVA 3S67A 1SIIA 2YX9A 1LNHA 1W4NA 3UJMA 3WA2X 5KP4A 1K9M4 1W2ZA 2D1WA 1AV4A 2OCTA 3FF2A 3OV4A 1NO3A 2CFDA 2W56A 3SOAA 3UNLA 4LZIA 1HU9A 2BMQB 2BO9B 2XRXB 3S29A 4WHAA 2UX0A 3NM7A 1JNQA 1KD14 3UL6A 3CME3 1ROVA 4XBXA 2CKFB 1EG9B 3B7CA 3BNDA 3DGOA 3CCQ3 4N6NB 3PCSA 5JPUA 1UUVB 2HMOB 4HM4B 3EHCA 4XDWA 1W5ZA 5IF6A 3G0KA 3SXXA 1ASKA 1OCVA 1O7MB 3EBYA 4K1VA 2WGOA 2CG0A 4EV5A 2Y74A 5EVHA 3OWSA 5AEWB 1RN7A 1KWIA 5KP1A 1O7GB 3QK9A 3X41A 1OF5B 2CWTA 1GS3A 4CDLA 3DUKA 3DGMA 2F99A 1OHPA 1DMNA 3JUNA 2ML5A 2ZDJA 5IG3A 3FG4A 1Q7Y4 4WFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ 3;  3CCJ 3;  1VQM 3;  1YIJ 3;  1KC8 4;  1VQP 3;  1M90 4;  3CCR 3;  1YIT 3;  1Q81 4;  1QVG 2;  1VQ6 3;  1KQS 2;  3I56 3;  3CXC 2;  1JJ2 2;  3CC7 3;  3G4S 3;  3G71 3;  1VQ5 3;  1W2B 2;  3G6E 3;  1VQ4 3;  1Q86 4;  3CD6 3;  1K9M 4;  3CC2 3;  3CCE 3;  1VQL 3;  3CCV 3;  3CPW 2;  1K8A 4;  3CCM 3;  1YHQ 3;  1NJI 4;  3CCS 3;  1N8R 4;  1S72 3;  3CMA 3;  2QEX 3;  1K73 4;  1VQ8 3;  3CC4 3;  2QA4 3;  2OTL 3;  1YJW 3;  1YJ9 3;  1VQN 3;  1Q7Y 4;  1VQ7 3;  1VQ9 3;  1QVF 2;  1VQO 3;  1VQK 3;  1KD1 4;  1M1K 4;  3CME 3;  3I55 3;  1YJN 3;  3CCU 3;  1YI2 3;  1Q82 4;  3CCQ 3;  3OW2 2;  3CCL 3; 
#chains in the Genus database with same CATH topology
 5IER A;  4WWU C;  9RNT A;  3MKI A;  2FNQ A;  1D6U A;  1QVG 2;  2CFL A;  4HM3 B;  4WYK B;  2XFT A;  4PEJ A;  1SPU A;  1VQ5 3;  3VF1 A;  2F4Y A;  4MMZ B;  3L0R A;  3BNE A;  2L1S A;  4XM4 A;  1SQW A;  2Z77 A;  3PCR A;  3AMO B;  3CPW 2;  3ALA A;  3KFQ C;  3T0U A;  1EQK A;  1M1X B;  2CHC A;  3JUQ A;  4OVM A;  2R4I A;  5LC7 A;  3V99 A;  1RMS A;  2ML6 A;  1B3S A;  4HM0 B;  4K1U A;  4K90 B;  1RGF A;  1BIR A;  5IG0 A;  1UUG B;  3EF8 A;  2W04 A;  1RTU A;  3EC9 A;  7GSP A;  1VQ9 3;  1FA3 A;  1BSE A;  4HYZ A;  3X40 A;  5STD A;  3BB9 A;  3NBB A;  4BL3 A;  1HKX A;  1X1U A;  2LYX A;  4O3V A;  2P38 A;  4JF8 A;  2E2U A;  3X3X A;  4AKZ A;  3BLZ A;  3KSE D;  3CXC 2;  3B4P A;  3JVC A;  3G71 3;  1W2B 2;  3LTC A;  4L8O A;  3CD6 3;  3EN1 B;  1RRL A;  1A2P A;  2CG1 A;  3V92 A;  1FYS A;  1G0T A;  1OAC A;  2BMR B;  1RGE A;  3FSD A;  4HZB B;  1GY6 A;  4XDV A;  1FGR A;  2WO0 A;  1W7C A;  2F56 A;  1O7P B;  2XF3 A;  2BIR A;  3NXJ A;  1GSP A;  3BNC A;  2QA4 3;  1CYV A;  5DRE A;  3VSY A;  1A90 A;  1VQK 3;  5IEO A;  2YFJ B;  3KCH A;  2BMO B;  3KKG A;  3Q2P A;  5D82 A;  3LT9 A;  5RNT A;  1KC8 4;  1I3F A;  3N54 B;  2GBW B;  1MWU A;  3G8Z A;  2QIY A;  1RCL A;  2V1L A;  1TRQ A;  4BTY A;  3G4S 3;  4EV2 A;  2F5W A;  4BIR A;  2WOH A;  2JQ5 A;  2HMJ B;  1OGX A;  4MMY B;  4H3U A;  2O9U X;  3D3L A;  1FW7 A;  1T3B A;  2MC8 A;  3CCS 3;  2CFG A;  2W9Q A;  3NBR A;  1JZD A;  1NB3 I;  1UI8 A;  1W6C A;  4IT7 A;  1U8C B;  4KT3 B;  4LGQ A;  1FZU A;  4MEI A;  3D4A A;  2CK3 H;  1BU4 A;  1JKG B;  1TUH A;  3FZW A;  4OUQ A;  4R80 A;  3SX1 A;  1MWR A;  3NV0 A;  4HOH A;  1VQN 3;  4FMC A;  3JUP A;  1S5A A;  2FGT A;  3EN8 A;  2GU3 A;  3OWY A;  2H0G A;  1RN4 A;  2XSH B;  3K0Z A;  3WOD G;  2P05 A;  3D9R A;  3WOF B;  2E2T A;  1QJG A;  3NBJ A;  2KRT A;  5AEU B;  3T8U A;  2OTJ 3;  4HM7 B;  1YNV X;  1MGW A;  3LZA A;  3CU3 A;  3LOY A;  1YGW A;  1IK3 A;  2CX1 A;  3Q3F A;  1TU5 A;  1CQS A;  1FGM A;  2IUK A;  3F7X A;  2HOH A;  1RNT A;  1UGH I;  5TGN A;  3PZW A;  4KFD A;  1WMN A;  1V58 A;  1FUW A;  1Q40 B;  3PGB A;  4I5Q A;  1JN5 B;  4H61 A;  4CCV A;  1UCK A;  2AAD A;  3IJE B;  1BRK A;  2GU1 A;  5G2G A;  1K41 A;  2QGU A;  5JPP A;  3BNB A;  5A0O B;  3HZP A;  2INX A;  3Q90 A;  1MWT A;  2JDI H;  3F8X A;  4FCZ A;  2C11 A;  1N5P A;  2XEP A;  1BOX A;  1JB5 A;  1JV2 B;  1O7W B;  1BGS A;  2W56 B;  3IMA B;  1OPY A;  3LTA A;  5AI1 A;  1YJN 3;  3T8N A;  5IG5 A;  2F5M A;  1LNI A;  4IPB A;  2KF4 A;  3MHE A;  4OK0 A;  4RNZ A;  1A2V A;  3DGN A;  1ROA A;  4NRE A;  3RNT A;  6GSP A;  8RNT A;  1LOV A;  2ZA4 A;  1OHO A;  1RCK A;  4BTX A;  4RZM A;  3ZFZ A;  2HML B;  4EC6 A;  2WOF A;  1ZGX A;  3URP A;  3K5T A;  2PNC A;  2O3O A;  4FCM A;  4EW5 A;  1K8A 4;  4HBR A;  1RLS A;  5ELU A;  1WTH A;  1B21 A;  4BU4 A;  4HKV B;  5IW9 A;  1QAK A;  1GD3 A;  1RGK A;  3GAX A;  3EQQ B;  5DRV A;  4NHF A;  2XR8 B;  3LTB A;  6RNT A;  1BRS A;  2XGL A;  3RGA A;  3RGR A;  5BVB A;  5CF1 A;  1VQ8 3;  1RRH A;  2PZV A;  4LEH A;  1C54 A;  2HMM B;  4GHO A;  3IPT A;  2FXT A;  4N6V 0;  1W6Y A;  1I70 A;  4QWT A;  4FMB A;  5EEO A;  1E97 A;  2I9W A;  4R1K A;  3X3Y A;  3DXO A;  4KFF A;  3I55 3;  4O8S A;  1ISK A;  1TP6 A;  4EBG A;  3FLJ A;  5LC6 A;  3FG3 A;  1DVD A;  2R41 A;  2SBL A;  4HM1 B;  3I56 3;  2XGN A;  1KQS 2;  1VQ6 3;  1JBR A;  1OF5 A;  3D79 A;  1HZ1 A;  1T5Y A;  1Q9E A;  2W6J H;  2RNT A;  1WMO A;  1VQL 3;  3JUO A;  1V74 A;  2OWP A;  4X2O A;  1BRI A;  2CWU A;  1UI7 A;  1B2S A;  1IT7 A;  1BRH A;  3F9S A;  1MWS A;  3LT8 A;  2OOV C;  3AGN A;  4EXR A;  3OWU A;  4WYK A;  2B1X B;  3M8C A;  4GB5 A;  1IVW A;  1TFO A;  1TJD A;  1YI2 3;  1QAL A;  1BSB A;  3F14 A;  4XBY A;  1CYU A;  5M19 A;  1B2Z A;  1BNJ A;  5AYS C;  4HM2 B;  1ZS7 A;  3GZX B;  5CLK A;  4STD A;  2RSX A;  3DH2 A;  1JZO A;  1IVV A;  1NDO B;  3QRD A;  3WR2 A;  3LML A;  1WNH A;  2OQE C;  1BAO A;  3CCV 3;  1BRJ A;  1IV7 A;  1NJI 4;  1DVC A;  4R9K A;  1YVB I;  4CPK A;  5JBS A;  4FMA A;  1IVX A;  1Q7H A;  2STD A;  4J9A A;  1BSD A;  3FG1 A;  3GZR A;  2OTL 3;  1N9E A;  1WQL B;  4GSP A;  3EE1 A;  1IQY A;  3EX9 A;  2IMJ A;  1BSC A;  4KZ1 A;  3ZG5 A;  1G02 A;  1M9G A;  2RBI A;  3OW2 2;  3UB1 A;  3H51 A;  3NX0 A;  3SOY A;  4TX4 A;  1IT8 A;  7STD A;  1Q7Y 4;  4KVH A;  2IYJ A;  1K28 A;  3F40 A;  2XSO B;  5D83 A;  1BRG A;  1Y4K A;  5HOH A;  2IA7 A;  3H3H A;  2M7O A;  3FF0 A;  1FUS A;  4KFE A;  1LOY A;  1BNF A;  1UCJ A;  2Y73 A;  3WDG B;  1DMM A;  1RN1 A;  1UGI A;  1B2U A;  5AIH A;  3FH1 A;  1NB5 I;  3CC4 3;  4JRF A;  5IG4 A;  4AEQ A;  1JBS A;  1FGO A;  3KII A;  4DKI A;  2CC3 A;  2GXF A;  2H0H A;  1BSA A;  5M18 A;  1N8Q A;  1UDI I;  1Z1S A;  1Q82 4;  1MOL A;  3CCL 3;  3STD A;  4J5G A;  1A67 A;  3EBT A;  4HAA A;  3U1W A;  3I0Y A;  6STD A;  2YFL B;  2RCD A;  2KAA A;  3ECF A;  1U5O A;  3LH4 A;  3CC7 3;  4HM6 B;  1RGC A;  8CHO A;  1BNE A;  1GY5 A;  1LXE A;  3GRD A;  3N8B A;  4N6U A;  2E2V A;  1RGG A;  1VQ4 3;  3SED A;  4L8P A;  4ORL A;  1BNS A;  5AIF A;  2BHM A;  3NHX A;  3N9H A;  3FCS B;  3OXA A;  1C7H A;  2MF7 A;  3F8H A;  4N6O B;  5AII A;  2KF5 A;  5I97 A;  1AR0 A;  1BAN A;  1OHS A;  3B4O A;  1LVN A;  2CIU A;  4FMD A;  1A2K A;  1NU3 A;  1OH0 A;  4O02 B;  4Q53 A;  4RNT A;  5G1L A;  2K0M A;  1PU4 A;  2F98 A;  4MJD A;  3CNM A;  2KCD A;  3MYT A;  2CWV A;  2A15 A;  2OOV A;  1Q40 A;  5GSP A;  1STF I;  3TDG A;  2GEX A;  1YIT 3;  3E99 A;  1D6Z A;  2K54 A;  2P09 A;  1JJ2 2;  4U13 A;  4N3V A;  3LYG A;  3WHO A;  3G6E 3;  1DE3 A;  1AVL A;  2ZL8 A;  1DYU A;  3BU4 A;  3ROB A;  1I3I A;  1Q86 4;  3CC2 3;  5EQL A;  2XFS A;  3HOH A;  4R4K A;  3MPH A;  3SLU A;  3RDE A;  1BVI A;  1I0X A;  1PY3 A;  1D6Y A;  4LSO A;  1Q42 A;  1UCL A;  1L5G B;  2GSP A;  2IUJ A;  1AVK A;  1O7H B;  2OQE A;  3A5E A;  1YJW 3;  1LOX A;  4FR9 A;  1EUI C;  1VZZ A;  3Q1C A;  1IDP A;  1IQX A;  1T2H A;  4G1M B;  2CX0 A;  2W03 A;  1M1K 4;  1BNI A;  1RDS A;  1UUW B;  1N5H A;  1VQP 3;  3FGY A;  1QAF A;  4BTW A;  1I8V A;  1I2G A;  3KN4 A;  4HM8 B;  3NUV A;  3D5I A;  5IEP A;  3K9M C;  3GWR A;  1G96 A;  3NQZ A;  4IIA A;  5FW5 A;  2B24 B;  1BUQ A;  5CF2 A;  2Z7A A;  3ZG0 A;  3DMC A;  1JRQ A;  3EB8 A;  1EEJ A;  4K61 A;  1BUJ A;  1RJO A;  1STD A;  3D5G A;  3S28 A;  1FGT A;  3BIR A;  3CCM 3;  1YHQ 3;  1GMQ A;  1AY7 A;  3CMA 3;  4R9L A;  2QEX 3;  2RGQ A;  1IVU A;  1SJW A;  1MGR A;  4ILF A;  2CW9 A;  4N6L A;  2CFK A;  1CH0 A;  1EA2 A;  1W01 A;  1NNV A;  1IQ8 A;  3WMD A;  2C10 A;  3KE7 A;  3VGN A;  1B20 A;  5BU4 A;  3DZL A;  1ULI B;  3CCU 3;  1YGE A;  1LOW A;  1IYY A;  1FUT A;  1I2E A;  2P0X A;  1GMP A;  3OX9 A;  1M90 4;  1SAR A;  3AMO A;  1Q81 4;  3WOE B;  1JB2 A;  3HX8 A;  4NPB A;  2W0Q A;  4I4K A;  3MG1 A;  1B2X A;  3LTD A;  7RNT A;  1OGZ A;  3PYJ A;  2RFR A;  2GEY A;  1GYB A;  5BIR A;  3X3Z A;  1ZX2 A;  3V98 A;  2Z76 A;  1MNL A;  4CJN A;  1ZO2 A;  1W02 A;  2P0M A;  1R4C A;  4EYC A;  1N9J A;  1W6G A;  2F86 B;  3MWZ A;  3CNX A;  5CK6 A;  1K73 4;  4N6T A;  1UCI A;  2W2C A;  1YJ9 3;  1B2M A;  1ULJ B;  5AYR B;  2AAE A;  2LQV A;  3MG3 A;  1X1W A;  3AHS A;  3DGL A;  3X42 A;  1QVF 2;  5HGR A;  4GL6 A;  1JB4 A;  3ER7 A;  3S27 A;  5BXQ A;  1JBT A;  2L4V A;  5CXO A;  1E3V A;  2WGQ A;  5AIG A;  3J7Y d;  3HII A;  3PS8 A;  1YIJ 3;  3B8L A;  1F8N A;  1O7N B;  2W9P A;  3CCR 3;  1J2B A;  1US1 A;  5G1K A;  2XH9 A;  1I2F A;  3K63 A;  1AQZ A;  3HI7 A;  3SVA A;  1WMP A;  3GSP A;  2CH9 A;  1PFP A;  3CPO A;  4XBT A;  3DY5 A;  1TFK A;  4HM5 B;  3O8Y A;  3MG2 A;  1OUN A;  2BT3 A;  1GY7 A;  4FCJ A;  1N8R 4;  2Z6B A;  1R4Y A;  3DM8 A;  1RHL A;  3S5C A;  1GOU A;  2GBX B;  1BNR A;  1FGQ A;  1RKY A;  4J5K A;  1RGA A;  2BNG A;  3JUM A;  2KXG A;  1VQ7 3;  4XB5 A;  5IEN A;  1DMQ A;  1SIH A;  3PXM A;  4J8T A;  3WA3 A;  1GMR A;  3F7S A;  2Q07 A;  1X1Y A;  2UUG C;  4LMI A;  3FKA A;  4O2H A;  2KF6 A;  3GZB A;  4MMX B;  1LRA A;  1IU7 A;  3NV0 B;  3MSO A;  3NM2 A;  4LYL B;  1W00 A;  4RBN A;  1JKG A;  4ZM8 A;  3CCE 3;  3KSP A;  3K7C A;  4WP5 A;  4BL2 A;  1GD4 A;  1LQM B;  1RGL A;  3KZT A;  1S72 3;  3LXU X;  4HZ9 B;  2ZHX B;  1QMA A;  2CFW A;  3NQY A;  1TTO A;  4N6M A;  5FGO A;  2J8X B;  4L7K A;  1UW1 A;  1TRP A;  5D81 A;  3UL5 A;  1VQO 3;  3G16 A;  1TIJ A;  1B27 A;  2HMK B;  3AGO A;  3HK4 A;  1EKM A;  5KP3 A;  5ELJ A;  1KSI A;  4HVN A;  4RNY A;  1GOY A;  1NWW A;  3A76 A;  5M1A A;  1CEW I;  1IV9 A;  3U97 A;  4AKY A;  4HJL B;  3CCJ 3;  1VQM 3;  4X2H A;  1V57 A;  2D42 A;  2C4B A;  1DET A;  2HMN B;  3GZY B;  1JN5 A;  1E3R A;  1RSN A;  3HIG A;  1I0V A;  2YFI B;  3EJV A;  3S67 A;  1SII A;  2YX9 A;  1LNH A;  1W4N A;  3UJM A;  2BU4 A;  3WA2 X;  5KP4 A;  1K9M 4;  1W2Z A;  2D1W A;  1AV4 A;  2OCT A;  3FF2 A;  3OV4 A;  1NO3 A;  2CFD A;  2W56 A;  1RNB A;  3SOA A;  3UNL A;  4LZI A;  3DGY A;  1HU9 A;  2BMQ B;  2BO9 B;  2XRX B;  3S29 A;  4WHA A;  2UX0 A;  1BRN L;  3NM7 A;  1X1X A;  1JNQ A;  1KD1 4;  1VQQ A;  3UL6 A;  1ROV A;  4XBX A;  3CME 3;  2CKF B;  1EG9 B;  3B7C A;  3BND A;  3SYU A;  3DGO A;  3CCQ 3;  1GOV A;  4N6N B;  1BNG A;  3PCS A;  3AHW A;  2K3D A;  5JPU A;  1UUV B;  2HMO B;  4HM4 B;  3EHC A;  4XDW A;  1RGH A;  1W5Z A;  5IF6 A;  3G0K A;  3SXX A;  1ASK A;  1OCV A;  1O7M B;  3EBY A;  2SAR A;  2WGO A;  2CG0 A;  4K1V A;  4EV5 A;  2Y74 A;  5EVH A;  3OWS A;  5AEW B;  1RN7 A;  1YVS A;  1KWI A;  5KP1 A;  1O7G B;  3QK9 A;  2UGI A;  3X41 A;  1OF5 B;  2CWT A;  1GS3 A;  4CDL A;  3DUK A;  1PYL A;  3DGM A;  1LQG C;  1OHP A;  2F99 A;  1DMN A;  1T2I A;  2KF3 A;  3JUN A;  2ML5 A;  2ZDJ A;  2IY2 A;  5IG3 A;  2H0I A;  3FG4 A;  1HYF A;  4WFO A; 
#chains in the Genus database with same CATH homology
 5IER A;  4WWU C;  3MKI A;  2FNQ A;  1D6U A;  1QVG 2;  2CFL A;  4HM3 B;  4WYK B;  2XFT A;  4PEJ A;  1SPU A;  1VQ5 3;  3VF1 A;  4MMZ B;  3L0R A;  3BNE A;  4XM4 A;  1SQW A;  2Z77 A;  3PCR A;  3AMO B;  3CPW 2;  3ALA A;  3KFQ C;  3T0U A;  1EQK A;  1M1X B;  2CHC A;  3JUQ A;  4OVM A;  2R4I A;  5LC7 A;  3V99 A;  2ML6 A;  4K1U A;  4HM0 B;  4K90 B;  5IG0 A;  3EF8 A;  2W04 A;  3EC9 A;  1VQ9 3;  1FA3 A;  4HYZ A;  3X40 A;  5STD A;  3BB9 A;  3NBB A;  1HKX A;  2LYX A;  4O3V A;  2P38 A;  4JF8 A;  2E2U A;  3X3X A;  4AKZ A;  3BLZ A;  3KSE D;  3CXC 2;  3B4P A;  3JVC A;  3G71 3;  1W2B 2;  3LTC A;  4L8O A;  3CD6 3;  3EN1 B;  1RRL A;  3V92 A;  2CG1 A;  2BMR B;  1OAC A;  3FSD A;  4HZB B;  1GY6 A;  4XDV A;  1FGR A;  2WO0 A;  1W7C A;  1O7P B;  2XF3 A;  3NXJ A;  3BNC A;  2QA4 3;  1CYV A;  5DRE A;  3VSY A;  1A90 A;  1VQK 3;  5IEO A;  2YFJ B;  3KKG A;  2BMO B;  3Q2P A;  5D82 A;  1KC8 4;  3LT9 A;  3N54 B;  2GBW B;  3G8Z A;  2QIY A;  2V1L A;  4BTY A;  3G4S 3;  4EV2 A;  2WOH A;  2JQ5 A;  2HMJ B;  1OGX A;  4MMY B;  4H3U A;  2O9U X;  3D3L A;  2MC8 A;  3CCS 3;  2CFG A;  2W9Q A;  3NBR A;  1NB3 I;  1UI8 A;  1W6C A;  4IT7 A;  1U8C B;  4LGQ A;  4MEI A;  3SOY A;  3WA3 A;  2CK3 H;  1JKG B;  3FZW A;  1TUH A;  4OUQ A;  4R80 A;  3SX1 A;  3NV0 A;  1VQN 3;  4FMC A;  3JUP A;  1S5A A;  2FGT A;  3EN8 A;  2GU3 A;  3OWY A;  2XSH B;  3K0Z A;  3WOD G;  2P05 A;  3D9R A;  3WOF B;  2E2T A;  1QJG A;  3NBJ A;  2KRT A;  5AEU B;  3T8U A;  2OTJ 3;  4HM7 B;  3LZA A;  3CU3 A;  3LOY A;  1TU5 A;  1IK3 A;  1CQS A;  1FGM A;  2IUK A;  3F7X A;  5TGN A;  3PZW A;  4KFD A;  1WMN A;  1FUW A;  1Q40 B;  3PGB A;  1JN5 B;  4H61 A;  4CCV A;  3IJE B;  2GU1 A;  5G2G A;  1K41 A;  2QGU A;  5JPP A;  3BNB A;  5A0O B;  3HZP A;  2INX A;  3Q90 A;  2JDI H;  3F8X A;  4FCZ A;  2C11 A;  1N5P A;  2XEP A;  1JB5 A;  1JV2 B;  1O7W B;  2W56 B;  3IMA B;  1YJN 3;  1OPY A;  3LTA A;  5AI1 A;  3T8N A;  5IG5 A;  4OK0 A;  4IPB A;  4RNZ A;  3MHE A;  1A2V A;  3DGN A;  1ROA A;  4NRE A;  1OHO A;  4BTX A;  4RZM A;  2HML B;  4EC6 A;  2WOF A;  3K5T A;  2PNC A;  2O3O A;  4FCM A;  1K8A 4;  4HBR A;  5ELU A;  1WTH A;  5IW9 A;  4HKV B;  1QAK A;  1GD3 A;  3GAX A;  5DRV A;  3EQQ B;  4NHF A;  2XR8 B;  3LTB A;  3RGR A;  2XGL A;  3RGA A;  5BVB A;  5CF1 A;  1VQ8 3;  1RRH A;  2PZV A;  4LEH A;  2HMM B;  5EEO A;  3IPT A;  2FXT A;  4N6V 0;  1W6Y A;  4QWT A;  4FMB A;  1E97 A;  2I9W A;  4R1K A;  3X3Y A;  3DXO A;  4KFF A;  3I55 3;  4O8S A;  1ISK A;  1TP6 A;  4EBG A;  3FLJ A;  5LC6 A;  3FG3 A;  1DVD A;  2SBL A;  4HM1 B;  3I56 3;  2XGN A;  1KQS 2;  1VQ6 3;  1OF5 A;  1T5Y A;  2W6J H;  1WMO A;  1VQL 3;  3JUO A;  1V74 A;  2OWP A;  4X2O A;  2CWU A;  1UI7 A;  1IT7 A;  3F9S A;  3LT8 A;  2OOV C;  4EXR A;  3OWU A;  4WYK A;  2B1X B;  3M8C A;  4GB5 A;  1IVW A;  1TFO A;  1YI2 3;  1QAL A;  3F14 A;  4XBY A;  1CYU A;  5AYS C;  4HM2 B;  3GZX B;  5CLK A;  4STD A;  2RSX A;  1IVV A;  1NDO B;  3QRD A;  3LML A;  1WNH A;  2OQE C;  3CCV 3;  1IV7 A;  1NJI 4;  1DVC A;  4R9K A;  1YVB I;  5JBS A;  4FMA A;  1IVX A;  2STD A;  4J9A A;  3FG1 A;  3GZR A;  2OTL 3;  1N9E A;  1WQL B;  3EE1 A;  1IQY A;  3EX9 A;  2IMJ A;  4KZ1 A;  1M9G A;  3OW2 2;  3UB1 A;  3H51 A;  3NX0 A;  4TX4 A;  1IT8 A;  7STD A;  4KVH A;  1K28 A;  3F40 A;  2XSO B;  5D83 A;  1Y4K A;  2IA7 A;  3H3H A;  2M7O A;  3FF0 A;  4KFE A;  2Y73 A;  3WDG B;  1DMM A;  5AIH A;  3FH1 A;  1NB5 I;  3CC4 3;  4JRF A;  5IG4 A;  4AEQ A;  1FGO A;  3KII A;  2CC3 A;  2GXF A;  1N8Q A;  1Z1S A;  1Q82 4;  1MOL A;  3CCL 3;  3STD A;  1A67 A;  3EBT A;  3U1W A;  3I0Y A;  6STD A;  2YFL B;  2RCD A;  3ECF A;  1U5O A;  3LH4 A;  3CC7 3;  4HM6 B;  8CHO A;  1GY5 A;  1LXE A;  3GRD A;  3N8B A;  4N6U A;  2E2V A;  1VQ4 3;  3SED A;  4L8P A;  4ORL A;  5AIF A;  2BHM A;  3NHX A;  3N9H A;  3FCS B;  3OXA A;  1C7H A;  2MF7 A;  3F8H A;  4N6O B;  5AII A;  5I97 A;  1AR0 A;  1OHS A;  3B4O A;  1LVN A;  2CIU A;  4FMD A;  1A2K A;  1NU3 A;  1OH0 A;  4O02 B;  4Q53 A;  2K0M A;  1PU4 A;  2F98 A;  4MJD A;  3CNM A;  2KCD A;  3MYT A;  2CWV A;  2A15 A;  2OOV A;  1Q40 A;  3TDG A;  1STF I;  2GEX A;  1YIT 3;  3E99 A;  1D6Z A;  2K54 A;  2P09 A;  1JJ2 2;  4U13 A;  4N3V A;  3LYG A;  3G6E 3;  1AVL A;  2ZL8 A;  1DYU A;  3ROB A;  1Q86 4;  3CC2 3;  5EQL A;  2XFS A;  4R4K A;  3MPH A;  3SLU A;  3RDE A;  1D6Y A;  4LSO A;  1Q42 A;  1L5G B;  2IUJ A;  1AVK A;  1O7H B;  2OQE A;  1YJW 3;  1LOX A;  4FR9 A;  1VZZ A;  3Q1C A;  1IDP A;  1IQX A;  4G1M B;  1M1K 4;  2W03 A;  1UUW B;  1N5H A;  1VQP 3;  3FGY A;  1QAF A;  4BTW A;  3KN4 A;  4HM8 B;  3NUV A;  5IEP A;  3K9M C;  3GWR A;  1G96 A;  3NQZ A;  4IIA A;  5FW5 A;  2B24 B;  1BUQ A;  5CF2 A;  2Z7A A;  3DMC A;  1JRQ A;  3EB8 A;  4K61 A;  1RJO A;  1STD A;  3S28 A;  1FGT A;  3CCM 3;  1YHQ 3;  3CMA 3;  4R9L A;  2QEX 3;  2RGQ A;  1IVU A;  1SJW A;  4N6L A;  2CW9 A;  2CFK A;  1EA2 A;  1W01 A;  1IQ8 A;  3WMD A;  2C10 A;  3KE7 A;  3VGN A;  3DZL A;  1ULI B;  3CCU 3;  1YGE A;  2P0X A;  3OX9 A;  1M90 4;  3AMO A;  1Q81 4;  3WOE B;  1JB2 A;  3HX8 A;  2W0Q A;  4I4K A;  3MG1 A;  3LTD A;  1OGZ A;  3PYJ A;  2RFR A;  2GEY A;  1GYB A;  3X3Z A;  1ZX2 A;  3V98 A;  2Z76 A;  1MNL A;  1ZO2 A;  1W02 A;  2P0M A;  1R4C A;  4EYC A;  1N9J A;  1W6G A;  2F86 B;  3MWZ A;  3CNX A;  5CK6 A;  1K73 4;  4N6T A;  2W2C A;  1YJ9 3;  1ULJ B;  5AYR B;  1QVF 2;  2LQV A;  3MG3 A;  3DGL A;  3X42 A;  5HGR A;  4GL6 A;  1JB4 A;  3ER7 A;  3S27 A;  5BXQ A;  2L4V A;  5CXO A;  2WGQ A;  1E3V A;  5AIG A;  3J7Y d;  3HII A;  3PS8 A;  1YIJ 3;  3B8L A;  1F8N A;  1O7N B;  2W9P A;  3CCR 3;  1J2B A;  1US1 A;  2XH9 A;  3K63 A;  3HI7 A;  3SVA A;  1WMP A;  4XBT A;  2CH9 A;  1PFP A;  3CPO A;  3DY5 A;  1TFK A;  4HM5 B;  3O8Y A;  3MG2 A;  1OUN A;  2BT3 A;  1GY7 A;  4FCJ A;  1N8R 4;  2Z6B A;  3S5C A;  3DM8 A;  2GBX B;  1FGQ A;  1RKY A;  2BNG A;  3JUM A;  2KXG A;  1VQ7 3;  4XB5 A;  5IEN A;  1DMQ A;  1SIH A;  3PXM A;  4J8T A;  3F7S A;  2Q07 A;  4LMI A;  3FKA A;  4O2H A;  3GZB A;  4MMX B;  1IU7 A;  3NV0 B;  3MSO A;  3NM2 A;  1W00 A;  4RBN A;  1JKG A;  4ZM8 A;  3CCE 3;  3KSP A;  3K7C A;  4WP5 A;  1GD4 A;  3KZT A;  1S72 3;  3LXU X;  4HZ9 B;  1QMA A;  2CFW A;  3NQY A;  4N6M A;  5FGO A;  4L7K A;  1UW1 A;  5D81 A;  3UL5 A;  1VQO 3;  3G16 A;  1TIJ A;  2HMK B;  3HK4 A;  1EKM A;  5KP3 A;  5ELJ A;  1KSI A;  4HVN A;  4RNY A;  1NWW A;  3A76 A;  3U97 A;  4AKY A;  1CEW I;  1IV9 A;  4HJL B;  3CCJ 3;  1VQM 3;  4X2H A;  2D42 A;  2HMN B;  3GZY B;  1JN5 A;  1E3R A;  3HIG A;  2YFI B;  3EJV A;  3S67 A;  1SII A;  2YX9 A;  1LNH A;  1W4N A;  3UJM A;  3WA2 X;  5KP4 A;  1K9M 4;  1W2Z A;  2D1W A;  1AV4 A;  2OCT A;  3FF2 A;  3OV4 A;  1NO3 A;  2CFD A;  2W56 A;  3SOA A;  3UNL A;  4LZI A;  1HU9 A;  2BMQ B;  2BO9 B;  2XRX B;  3S29 A;  4WHA A;  2UX0 A;  3NM7 A;  1JNQ A;  1KD1 4;  3UL6 A;  3CME 3;  1ROV A;  4XBX A;  2CKF B;  1EG9 B;  3B7C A;  3BND A;  3DGO A;  3CCQ 3;  4N6N B;  3PCS A;  5JPU A;  1UUV B;  2HMO B;  4HM4 B;  3EHC A;  4XDW A;  1W5Z A;  5IF6 A;  3G0K A;  3SXX A;  1ASK A;  1OCV A;  1O7M B;  3EBY A;  4K1V A;  2WGO A;  2CG0 A;  4EV5 A;  2Y74 A;  5EVH A;  3OWS A;  5AEW B;  1RN7 A;  1KWI A;  5KP1 A;  1O7G B;  3QK9 A;  3X41 A;  1OF5 B;  2CWT A;  1GS3 A;  4CDL A;  3DUK A;  3DGM A;  2F99 A;  1OHP A;  1DMN A;  3JUN A;  2ML5 A;  2ZDJ A;  5IG3 A;  3FG4 A;  1Q7Y 4;  4WFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...