3CCQ3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccq300
2OTL3 1VQN3 3CCU3 1VQ83 3OW22 3I563 3CCE3 1M904 3CD63 1YJN3 1KD14 1K8A4 1YJ93 1YJW3 1KC84 1YHQ3 1W2B2 1KQS2 3CME3 1VQM3 1YI23 2OTJ3 3CXC2 3CC23 3CCJ3 1Q7Y4 1Q824 1M1K4 1VQK3 3CCV3 3G713 3I553 1NJI4 1JJ22 3CCS3 1S723 1QVG2 3CC43 1VQ43 1VQ73 1QVF2 3CCM3 3CCQ3 3CCL3 3G4S3 1K734 1Q814 1N8R4 1VQ93 2QEX3 3G6E3 1YIT3 1VQP3 1VQ63 1VQO3 1VQL3 1YIJ3 1K9M4 3CPW2 3CCR3 2QA43 1VQ53 1Q864 3CMA3 3CC73
chains in the Genus database with same CATH superfamily
2W9QA 3DGYA 4RBNA 1IQYA 3DZLA 3EE1A 3X3YA 3CCU3 2C4BA 2OTL3 4EC6A 3CC43 3WODG 4R9LA 3K0ZA 1BU4A 2IYJA 1RKYA 1YJN3 2H0HA 2W04A 1MGRA 5D81A 3VF1A 1PFPA 3D3LA 3JVCA 1JNQA 1I3IA 3SOYA 4BTXA 2E2TA 2JDIH 1EKMA 5A0OB 1I8VA 2E2UA 1OH0A 1SQWA 3DMCA 1W7CA 1YGEA 4U13A 1NJI4 4EW5A 3JUMA 1JB4A 3CCM3 1NU3A 2IMJA 1UUVB 3D5GA 3OV4A 1WTHA 4K90B 2ML5A 1JKGA 2YFIB 4MMYB 3LOYA 5BIRA 1PU4A 1U5OA 4QWTA 4XBXA 1OGXA 4HM0B 3KFQC 4H61A 2QA43 3CC73 5LC7A 1Q40B 1UUGB 4WP5A 5I97A 1IT7A 5RNTA 1JBTA 1IYYA 3AHWA 1RN4A 2UGIA 4N6NB 4STDA 2BMQB 3TDGA 3CD63 2BO9B 1C54A 4ZM8A 1BNRA 4FMAA 4HAAA 2FXTA 3WA2X 1TJDA 2CFKA 2CG1A 1LQMB 3V99A 3CCV3 1ZO2A 1M9GA 1RGEA 1T2IA 1UUWB 3WA3A 3K5TA 1VQ73 3RNTA 1OF5B 4WYKB 3F40A 3G4S3 1Q814 5HOHA 1VQQA 2RCDA 3B4PA 2KRTA 5JPPA 1AVKA 1MWRA 2XEPA 3MG1A 1BSCA 1RJOA 4NHFA 1RHLA 1BRSA 1UCIA 3STDA 3S27A 2CX0A 2CWVA 1FZUA 4PEJA 3U97A 1WQLB 2KAAA 1RRHA 3B8LA 1F8NA 2HMNB 2RFRA 1B2MA 3PXMA 2CHCA 3S28A 4KVHA 1OHPA 1RGKA 2SBLA 1BRKA 3LTAA 3CXC2 1Q7Y4 4FCMA 1BRJA 1MGWA 2GU3A 1SIIA 1HU9A 1RRLA 3Q2PA 4JF8A 5AEWB 1D6YA 1DVDA 1W02A 1QAFA 5M19A 2KF3A 2UUGC 3MKIA 1OGZA 3GZYB 1FGOA 3CCL3 2W56B 2OWPA 3A5EA 4GL6A 1RCLA 3GSPA 1VQL3 3FG3A 1W4NA 2CC3A 3URPA 1LOYA 4L8OA 1T5YA 2QIYA 1FUWA 1I3FA 1Q42A 1IQXA 3EN1B 4BU4A 2XGNA 4MEIA 1BNFA 3LT8A 4TX4A 6STDA 3CNXA 1W00A 1VQM3 3FZWA 2L4VA 1CYUA 2R4IA 5LC6A 1SJWA 1M1K4 3LXUX 5D82A 4EV2A 3FKAA 3O8YA 1OPYA 1B2XA 2STDA 3KSED 2MF7A 4O02B 2AADA 3EF8A 2F56A 1B2UA 5KP1A 8RNTA 5KP4A 1SARA 3MG3A 2XGLA 3IMAB 7STDA 4HYZA 5FGOA 1RGGA 1YIJ3 1Y4KA 3M8CA 1VQ53 1IU7A 3HIGA 3DH2A 5D83A 1A2KA 3RGRA 2UX0A 3BLZA 3SXXA 3BNDA 1O7NB 2GEYA 1LOXA 2IUKA 3AMOB 3NUVA 2BIRA 3EX9A 1C7HA 1SIHA 3K7CA 4XB5A 4BIRA 2SARA 6RNTA 1B20A 3JUOA 1JB2A 3NM2A 3CU3A 1BRHA 1W6GA 1YI23 2FGTA 1IV9A 3EJVA 3WOEB 1GY7A 3FG4A 3Q90A 2PNCA 2CK3H 1JZDA 1UCKA 3CCS3 2WGQA 1JN5A 1STFI 3NX0A 5G1LA 1J2BA 2KXGA 2O9UX 3WHOA 1RNBA 3WOFB 3S5CA 4KFDA 1G02A 1LRAA 2H0IA 5AIIA 2OCTA 3F7XA 3SYUA 3FGYA 3G8ZA 1Q864 1OCVA 1TRQA 1TU5A 1EA2A 5CXOA 1ULIB 1BNJA 1A2VA 1FUSA 1K28A 3L0RA 4O2HA 5M1AA 1IK3A 1BGSA 4FR9A 4R9KA 4AEQA 2XSOB 3KE7A 1OHSA 2O3OA 3LTDA 5EVHA 1T2HA 1W2B2 1GD3A 1OHOA 1W6YA 2CWUA 3GRDA 3ZFZA 3D79A 3EQQB 1BAOA 3H3HA 2I9WA 2B1XB 2BU4A 4R4KA 1O7HB 2PZVA 1A90A 3MPHA 5AYSC 2W6JH 1FUTA 2KCDA 1UI7A 3JUNA 4N3VA 1QJGA 1E3VA 3DGOA 4EXRA 1FYSA 1O7PB 3IPTA 4J5GA 2GU1A 3Q1CA 4DKIA 3K9MC 4IIAA 3OW22 3LH4A 1US1A 4FMCA 4AKYA 1L5GB 1O7MB 3NM7A 5IEOA 3FF0A 1ZX2A 1A67A 5M18A 4HM4B 1M904 1NB5I 3HZPA 1TUHA 3D4AA 2C11A 1YGWA 3CPOA 5TGNA 2HMKB 3SOAA 1EQKA 3QRDA 1NWWA 1UCJA 1TTOA 3MWZA 4LMIA 4CPKA 3CME3 1O7GB 2XFTA 3CCJ3 3G16A 1SPUA 3NQYA 2OQEC 4G1MB 2F5MA 4NPBA 1AVLA 1BRIA 1ASKA 4J9AA 1BSBA 1CH0A 3ER7A 3EC9A 4Q53A 2OQEA 4CCVA 1RDSA 1RSNA 1NDOB 3NBJA 3JUQA 4KT3B 5EQLA 3X40A 2P09A 3S29A 1EUIC 1E3RA 1TIJA 4HM1B 3FLJA 3FH1A 1G96A 1K41A 1BVIA 4L8PA 1QAKA 3EBTA 3X41A 1R4YA 3FSDA 4GSPA 4HKVB 1JKGB 3KIIA 3GZXB 1FW7A 1R4CA 1MWSA 4BL3A 1IVWA 1YHQ3 3DGMA 3LYGA 1BSDA 1HKXA 1YVSA 1RCKA 1U8CB 1YNVX 2Z6BA 1D6ZA 3AGNA 3GWRA 3LT9A 1ISKA 5EEOA 4OK0A 4R80A 3I553 2BMOB 1MOLA 1B2SA 4OUQA 5STDA 4WFOA 1I70A 1I2FA 3EBYA 3CCQ3 3V92A 1JZOA 1N8R4 4AKZA 1IVUA 4K1UA 1AV4A 4NREA 3J7Yd 7GSPA 3PCSA 1I0XA 2W0QA 3EB8A 3VSYA 1BNSA 1QVG2 3DUKA 1KD14 1DE3A 3NXJA 1YJ93 1GS3A 3UB1A 5IG4A 1BRGA 1RGHA 2OOVC 3N54B 2OOVA 2CW9A 1GOUA 4MMZB 4XDWA 1GSPA 1G0TA 1ZGXA 2K0MA 5AI1A 1UCLA 1WNHA 4LZIA 3WDGB 2HMMB 3B4OA 1QVF2 1FGRA 2F4YA 1UI8A 1BRNL 4O8SA 8CHOA 3BNCA 2W2CA 3DM8A 2INXA 3X3ZA 4ORLA 3OX9A 3G6E3 3N9HA 1NO3A 2GBXB 3NBBA 2IUJA 2XRXB 3PCRA 3NV0B 2M7OA 2CWTA 3MSOA 4I5QA 2A15A 1E97A 3HK4A 2CG0A 2WOFA 2CIUA 3GZBA 3MG2A 3HOHA 1I2EA 3DXOA 4EYCA 2ZL8A 2JQ5A 3ECFA 3HX8A 1X1XA 3E99A 3LTCA 4XDVA 3FG1A 4ILFA 2RNTA 2H0GA 2WGOA 5CF2A 3CC23 4HJLB 1LVNA 1RTUA 1FGQA 3GZRA 4LSOA 2CH9A 2Z77A 1JBRA 1B2ZA 2HMJB 5DREA 1V58A 3LZAA 1JJ22 1TP6A 1WMOA 2QEX3 4IPBA 1W5ZA 1CEWI 4HVNA 4X2OA 4WHAA 3U1WA 1JBSA 1M1XB 1VQP3 2ZDJA 1BSAA 1RLSA 1EG9B 1RN7A 2CX1A 3EHCA 4XBTA 4N6OB 1VQN3 1GYBA 1FGMA 2F98A 1N5HA 4RNZA 3NQZA 1TRPA 1YJW3 1OUNA 1W01A 5HGRA 3GAXA 1KC84 1B27A 5AIHA 2B24B 1W6CA 3JUPA 2L1SA 3RGAA 1LNHA 4MMXB 5BU4A 3PYJA 1X1YA 5CLKA 1RGFA 2RBIA 2V1LA 5AYRB 3RDEA 1I2GA 2IA7A 1Q824 4BTWA 1RGLA 1S5AA 3PZWA 1Q40A 2E2VA 3F9SA 4FCZA 4IT7A 1S723 1RN1A 1N5PA 4L7KA 4HM6B 4HZBB 1V74A 2Z7AA 2KF6A 4HOHA 1N9EA 2HMLB 1ZS7A 1DYUA 3CCR3 2RGQA 2F5WA 3OXAA 3OWYA 5IG0A 3BNEA 1AR0A 3BB9A 1JN5B 3SLUA 1FA3A 2BMRB 2F86B 2GXFA 1HZ1A 3S67A 3B7CA 5IENA 1DETA 1OF5A 2XF3A 4WYKA 3X3XA 1RGCA 2BT3A 4O3VA 3CNMA 3F14A 1GMRA 2Y73A 3BNBA 1NNVA 5CK6A 5DRVA 3UL6A 5IW9A 1CQSA 2ZA4A 4HM3B 5IF6A 2RSXA 2Q07A 2XR8B 4J5KA 1VQ43 5G1KA 5BVBA 2LQVA 1K734 1BUQA 1BIRA 1IVVA 3F7SA 1BNIA 4GHOA 1LOWA 2D1WA 2K54A 2D42A 2R41A 3VGNA 1YIT3 2Z76A 1WMNA 2GSPA 3KZTA 2KF5A 1IQ8A 1AY7A 1QALA 1KSIA 3BIRA 1I0VA 3Q3FA 1RNTA 5GSPA 1VQ83 1LQGC 3NBRA 1RMSA 4HM2B 1GD4A 4HZ9B 3CCE3 2YFLB 1GMQA 4JRFA 1B21A 1IVXA 5FW5A 2W03A 1UDII 4CDLA 1D6UA 3G0KA 2W56A 3OWSA 1KQS2 4KZ1A 1BANA 3T8NA 2W9PA 2YX9A 2XSHB 1BUJA 1MWUA 3KCHA 3LMLA 5AIGA 1IDPA 1GMPA 2CKFB 1RGAA 2KF4A 4GB5A 5G2GA 1YVBI 5ELUA 1GY6A 4N6TA 4EBGA 1MWTA 1V57A 3WR2A 3ROBA 1VZZA 1NB3I 2FNQA 3UL5A 5IG5A 2HOHA 1VQ63 2BHMA 2BNGA 3T0UA 2WO0A 6GSPA 2IY2A 1K9M4 1LXEA 1STDA 4LEHA 2P0XA 5BXQA 3I563 1BNGA 2P38A 2J8XB 2YFJB 4BTYA 1B3SA 2AAEA 2ZHXB 1K8A4 3X42A 3DY5A 1BNEA 3QK9A 7RNTA 3PGBA 5AEUB 2OTJ3 1Q7HA 3NV0A 1GOYA 4RNTA 3G713 1BOXA 1PY3A 3SX1A 2MC8A 3T8UA 5ELJA 5KP3A 1ROVA 4EV5A 4KFFA 1JRQA 1KWIA 4K1VA 4N6LA 3AMOA 1MNLA 5AIFA 2F99A 4I4KA 4HM8B 3K63A 1ULJB 3CPW2 3PS8A 1QMAA 1UW1A 3CMA3 1O7WB 4KFEA 4R1KA 3LTBA 3A76A 4BL2A 1JB5A 3HIIA 1GY5A 2CFWA 1EEJA 2LYXA 3NHXA 1DMMA 2P05A 5IG3A 2P0MA 5IEPA 1T3BA 2HMOB 2WOHA 3KN4A 3ALAA 3BU4A 1UGIA 4HBRA 1IV7A 4X2HA 3SVAA 3D5IA 5CF1A 3KSPA 1UGHI 1WMPA 3SEDA 4FMDA 1A2PA 1CYVA 4LYLB 1LOVA 3MYTA 4HM7B 1TFOA 1ROAA 2C10A 1Q9EA 4MJDA 5JPUA 3FCSB 3HI7A 3UJMA 3ZG0A 1VQ93 1DVCA 4CJNA 4J8TA 4RZMA 4FCJA 3FF2A 3N8BA 3KKGA 3WMDA 3IJEB 1AQZA 2Y74A 3V98A 1BSEA 1Z1SA 4RNYA 1W2ZA 3DGNA 1N9JA 3OWUA 3MHEA 3I0YA 3F8XA 2GBWB 2QGUA 4FMBA 9RNTA 2XH9A 2CFLA 4HM5B 1JV2B 4N6MA 2ML6A 3DGLA 4LGQA 1N8QA 3AGOA 1IT8A 2K3DA 1HYFA 3H51A 4H3UA 1VQK3 1PYLA 2GEXA 3AHSA 3F8HA 3UNLA 1GOVA 1FGTA 3ZG5A 1DMNA 3EN8A 4WWUC 4N6UA 2XFSA 2CFGA 4XM4A 5IERA 1X1UA 1DMQA 1X1WA 2CFDA 5JBSA 1VQO3 1OACA 4N6V0 4K61A 4OVMA 1LNIA 3D9RA 4XBYA 1TFKA
chains in the Genus database with same CATH topology
2W9QA 4RBNA 2OTL3 1IQYA 3DZLA 3EE1A 3X3YA 3CCU3 4EC6A 3WODG 4R9LA 3K0ZA 1YJN3 1RKYA 2W04A 5D81A 3VF1A 1PFPA 3D3LA 3JVCA 1JNQA 3SOYA 4BTXA 2E2TA 2JDIH 1EKMA 5A0OB 2E2UA 1OH0A 1SQWA 3DMCA 1W7CA 1YGEA 4U13A 1NJI4 3JUMA 1JB4A 3CCM3 1NU3A 2IMJA 1UUVB 3OV4A 1WTHA 4K90B 2ML5A 1JKGA 2YFIB 4MMYB 3LOYA 1PU4A 1U5OA 4QWTA 4XBXA 1OGXA 4HM0B 3KFQC 4H61A 2QA43 3CC73 5LC7A 1Q40B 4WP5A 5I97A 1IT7A 4N6NB 4STDA 2BMQB 3TDGA 3CD63 2BO9B 4ZM8A 4FMAA 2FXTA 3WA2X 2CFKA 2CG1A 3V99A 3CCV3 1ZO2A 1M9GA 1UUWB 3WA3A 3K5TA 1VQ73 3G4S3 1OF5B 4WYKB 3F40A 1Q814 2RCDA 3B4PA 2KRTA 5JPPA 1AVKA 2XEPA 3MG1A 1RJOA 4NHFA 3STDA 3S27A 2CWVA 4PEJA 3U97A 1WQLB 1RRHA 3B8LA 1F8NA 2HMNB 2RFRA 3PXMA 2CHCA 3S28A 4KVHA 1OHPA 2SBLA 3LTAA 3CXC2 1Q7Y4 4FCMA 2GU3A 1SIIA 1HU9A 1RRLA 3Q2PA 4JF8A 5AEWB 1D6YA 1DVDA 1W02A 1QAFA 3MKIA 1OGZA 3GZYB 1FGOA 3CCL3 2W56B 2OWPA 4GL6A 1VQL3 3FG3A 1W4NA 2CC3A 4L8OA 1T5YA 2QIYA 1FUWA 1Q42A 1IQXA 3EN1B 2XGNA 4MEIA 3LT8A 4TX4A 6STDA 3CNXA 1W00A 1VQM3 3FZWA 2L4VA 1CYUA 2R4IA 5LC6A 1SJWA 1M1K4 3LXUX 5D82A 4EV2A 3FKAA 3O8YA 1OPYA 2STDA 3KSED 2MF7A 4O02B 3EF8A 5KP1A 5KP4A 3MG3A 2XGLA 3IMAB 7STDA 4HYZA 5FGOA 1YIJ3 1Y4KA 3M8CA 1VQ53 1IU7A 3HIGA 5D83A 1A2KA 3RGRA 2UX0A 3BLZA 3SXXA 3BNDA 1O7NB 2GEYA 1LOXA 2IUKA 3AMOB 3NUVA 3EX9A 5AEUB 1C7HA 1SIHA 3K7CA 4XB5A 3JUOA 1JB2A 3NM2A 3CU3A 1W6GA 1YI23 2FGTA 1IV9A 3EJVA 3WOEB 1GY7A 3FG4A 3Q90A 2PNCA 2CK3H 3CCS3 2WGQA 1JN5A 1STFI 3NX0A 1J2BA 2KXGA 2O9UX 3WOFB 3S5CA 4KFDA 5AIIA 2OCTA 3F7XA 3FGYA 3G8ZA 1Q864 1OCVA 1TU5A 1EA2A 5CXOA 1ULIB 1A2VA 1K28A 3L0RA 4O2HA 1IK3A 4FR9A 4R9KA 4AEQA 2XSOB 3KE7A 1OHSA 2O3OA 3LTDA 5EVHA 1W2B2 1GD3A 1OHOA 1W6YA 2CWUA 3GRDA 3EQQB 3H3HA 2I9WA 2B1XB 4R4KA 1O7HB 2PZVA 1A90A 3MPHA 5AYSC 2W6JH 2KCDA 1UI7A 3JUNA 4N3VA 1QJGA 1E3VA 3DGOA 4EXRA 1O7PB 3IPTA 2GU1A 3Q1CA 3K9MC 4IIAA 3OW22 3LH4A 1US1A 4FMCA 4AKYA 1L5GB 1O7MB 3NM7A 5IEOA 3FF0A 1ZX2A 1A67A 1M904 4HM4B 1NB5I 3HZPA 1TUHA 2C11A 3CPOA 5TGNA 2HMKB 3SOAA 1EQKA 3QRDA 1NWWA 3MWZA 4LMIA 3CME3 1O7GB 2XFTA 3CCJ3 3G16A 1SPUA 3NQYA 2OQEC 4G1MB 5ELUA 1AVLA 4CCVA 1ASKA 4J9AA 2OQEA 4Q53A 3ER7A 3EC9A 1QVG2 3CC43 1NDOB 3NBJA 3JUQA 5EQLA 3X40A 2P09A 3S29A 1E3RA 1TIJA 4HM1B 3FLJA 3FH1A 1G96A 1K41A 4L8PA 1QAKA 3EBTA 3X41A 3FSDA 4HKVB 1JKGB 3KIIA 3GZXB 1R4CA 1IVWA 1YHQ3 3DGMA 3LYGA 1HKXA 1U8CB 3GWRA 2Z6BA 1D6ZA 3LT9A 1ISKA 5EEOA 4OK0A 4R80A 3I553 2BMOB 1MOLA 4OUQA 5STDA 4WFOA 3EBYA 3CCQ3 3V92A 1N8R4 4AKZA 1IVUA 4K1UA 1AV4A 4NREA 3J7Yd 3PCSA 2W0QA 3EB8A 3VSYA 3DUKA 1KD14 3NXJA 1YJ93 1GS3A 3UB1A 5IG4A 2OOVC 3N54B 2OOVA 2CW9A 4MMZB 4XDWA 2K0MA 5AI1A 1WNHA 4LZIA 3WDGB 2HMMB 3B4OA 1QVF2 1FGRA 1UI8A 4O8SA 8CHOA 3BNCA 2W2CA 3DM8A 2INXA 3X3ZA 4ORLA 3OX9A 3G6E3 3N9HA 1NO3A 2GBXB 3NBBA 2IUJA 2XRXB 3PCRA 3NV0B 2M7OA 2CWTA 3MSOA 1E97A 2A15A 3HK4A 2CG0A 2WOFA 2CIUA 3GZBA 3MG2A 3DXOA 4EYCA 2ZL8A 2JQ5A 3ECFA 3HX8A 3LTCA 3E99A 4XDVA 3FG1A 2WGOA 5CF2A 3CC23 4HJLB 1LVNA 1FGQA 3GZRA 4LSOA 2CH9A 2Z77A 5DREA 2HMJB 3LZAA 1JJ22 1TP6A 1WMOA 2QEX3 4IPBA 1W5ZA 1CEWI 4HVNA 4X2OA 4WHAA 3U1WA 1M1XB 1VQP3 2ZDJA 1EG9B 1RN7A 3EHCA 4XBTA 4N6OB 1VQN3 1GYBA 1FGMA 2F98A 1N5HA 4RNZA 3NQZA 1YJW3 1OUNA 1W01A 5HGRA 3GAXA 1KC84 5AIHA 3RGAA 2B24B 1W6CA 3JUPA 1LNHA 4MMXB 3PYJA 5CLKA 3RDEA 1Q824 2V1LA 5AYRB 2IA7A 4BTWA 1S5AA 3PZWA 4IT7A 1Q40A 2E2VA 3F9SA 4FCZA 1S723 1N5PA 4L7KA 4HM6B 4HZBB 1V74A 2Z7AA 1N9EA 2HMLB 1DYUA 3CCR3 2RGQA 3OXAA 3OWYA 5IG0A 3BNEA 1AR0A 3BB9A 1JN5B 3SLUA 1FA3A 2BMRB 2F86B 2GXFA 3S67A 3B7CA 5IENA 1OF5A 4WYKA 2XF3A 3X3XA 2BT3A 4O3VA 3CNMA 3F14A 2Y73A 5CK6A 3BNBA 3UL6A 5DRVA 5IW9A 1CQSA 4HM3B 5IF6A 2RSXA 2Q07A 2XR8B 1VQ43 5BVBA 2LQVA 1K734 1BUQA 1IVVA 3F7SA 2D1WA 2K54A 2D42A 1YIT3 3VGNA 2Z76A 1WMNA 3KZTA 1IQ8A 1QALA 1KSIA 1VQ83 3NBRA 4HM2B 4HZ9B 1GD4A 3CCE3 2YFLB 4JRFA 1IVXA 5FW5A 2W03A 4CDLA 1D6UA 3G0KA 2W56A 3OWSA 1KQS2 4KZ1A 3T8NA 2W9PA 2YX9A 2XSHB 3LMLA 5AIGA 1IDPA 2CKFB 4GB5A 5G2GA 4EBGA 1YVBI 1GY6A 4N6TA 3ROBA 1VZZA 1NB3I 2FNQA 3UL5A 5IG5A 1VQ63 2BHMA 2BNGA 3T0UA 2WO0A 1K9M4 1LXEA 1STDA 4LEHA 2P0XA 5BXQA 3I563 2P38A 2YFJB 4BTYA 1K8A4 3X42A 3DY5A 3QK9A 3PGBA 2OTJ3 3NV0A 3G713 3SX1A 2MC8A 3T8UA 5ELJA 5KP3A 1ROVA 4EV5A 4KFFA 1JRQA 1KWIA 4K1VA 4N6LA 3AMOA 1MNLA 5AIFA 2F99A 4I4KA 4HM8B 3K63A 1ULJB 3CPW2 3PS8A 1QMAA 1UW1A 3CMA3 1O7WB 4KFEA 4R1KA 3LTBA 3A76A 1JB5A 3HIIA 1GY5A 2CFWA 2LYXA 3NHXA 5IG3A 1DMMA 2P05A 5IEPA 2P0MA 2HMOB 2WOHA 3KN4A 3ALAA 4HBRA 1IV7A 4X2HA 3SVAA 5CF1A 3KSPA 1WMPA 3SEDA 4FMDA 1CYVA 3MYTA 4HM7B 1TFOA 1ROAA 2C10A 4MJDA 5JPUA 3FCSB 3HI7A 3UJMA 1VQ93 1DVCA 4J8TA 4RZMA 4FCJA 3FF2A 3N8BA 3KKGA 3WMDA 3IJEB 2Y74A 3V98A 1Z1SA 4RNYA 1W2ZA 3DGNA 1N9JA 3OWUA 3MHEA 3I0YA 3F8XA 2GBWB 2QGUA 4FMBA 2XH9A 2CFLA 4HM5B 1JV2B 4N6MA 2ML6A 3DGLA 4LGQA 1N8QA 1IT8A 3H51A 4H3UA 1VQK3 2GEXA 3F8HA 3UNLA 1FGTA 1DMNA 3EN8A 4WWUC 4N6UA 2XFSA 2CFGA 4XM4A 5IERA 1DMQA 2CFDA 5JBSA 1VQO3 1OACA 4N6V0 4K61A 4OVMA 3D9RA 4XBYA 1TFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL 3;  1VQN 3;  3CCU 3;  1VQ8 3;  3OW2 2;  3I56 3;  3CCE 3;  1M90 4;  3CD6 3;  1YJN 3;  1KD1 4;  1K8A 4;  1YJ9 3;  1YJW 3;  1KC8 4;  1YHQ 3;  1W2B 2;  1KQS 2;  3CME 3;  1VQM 3;  1YI2 3;  2OTJ 3;  3CXC 2;  3CC2 3;  3CCJ 3;  1Q7Y 4;  1Q82 4;  1M1K 4;  1VQK 3;  3CCV 3;  3G71 3;  3I55 3;  1NJI 4;  1JJ2 2;  3CCS 3;  1S72 3;  1QVG 2;  3CC4 3;  1VQ4 3;  1VQ7 3;  1QVF 2;  3CCM 3;  3CCQ 3;  3CCL 3;  3G4S 3;  1K73 4;  1Q81 4;  1N8R 4;  1VQ9 3;  2QEX 3;  3G6E 3;  1YIT 3;  1VQP 3;  1VQ6 3;  1VQO 3;  1VQL 3;  1YIJ 3;  1K9M 4;  3CPW 2;  3CCR 3;  2QA4 3;  1VQ5 3;  1Q86 4;  3CMA 3;  3CC7 3; 
#chains in the Genus database with same CATH topology
 2W9Q A;  3DGY A;  4RBN A;  1IQY A;  3DZL A;  3EE1 A;  3X3Y A;  3CCU 3;  2C4B A;  2OTL 3;  4EC6 A;  3CC4 3;  3WOD G;  4R9L A;  3K0Z A;  1BU4 A;  2IYJ A;  1RKY A;  1YJN 3;  2H0H A;  2W04 A;  1MGR A;  5D81 A;  3VF1 A;  1PFP A;  3D3L A;  3JVC A;  1JNQ A;  1I3I A;  3SOY A;  4BTX A;  2E2T A;  2JDI H;  1EKM A;  5A0O B;  1I8V A;  2E2U A;  1OH0 A;  1SQW A;  3DMC A;  1W7C A;  1YGE A;  4U13 A;  1NJI 4;  4EW5 A;  3JUM A;  1JB4 A;  3CCM 3;  1NU3 A;  2IMJ A;  1UUV B;  3D5G A;  3OV4 A;  1WTH A;  4K90 B;  2ML5 A;  1JKG A;  2YFI B;  4MMY B;  3LOY A;  5BIR A;  1PU4 A;  1U5O A;  4QWT A;  4XBX A;  1OGX A;  4HM0 B;  3KFQ C;  4H61 A;  2QA4 3;  3CC7 3;  5LC7 A;  1Q40 B;  1UUG B;  4WP5 A;  5I97 A;  1IT7 A;  5RNT A;  1JBT A;  1IYY A;  3AHW A;  1RN4 A;  2UGI A;  4N6N B;  4STD A;  2BMQ B;  3TDG A;  3CD6 3;  2BO9 B;  1C54 A;  4ZM8 A;  1BNR A;  4FMA A;  4HAA A;  2FXT A;  3WA2 X;  1TJD A;  2CFK A;  2CG1 A;  1LQM B;  3V99 A;  3CCV 3;  1ZO2 A;  1M9G A;  1RGE A;  1T2I A;  1UUW B;  3WA3 A;  3K5T A;  1VQ7 3;  3RNT A;  1OF5 B;  4WYK B;  3F40 A;  3G4S 3;  1Q81 4;  5HOH A;  1VQQ A;  2RCD A;  3B4P A;  2KRT A;  5JPP A;  1AVK A;  1MWR A;  2XEP A;  3MG1 A;  1BSC A;  1RJO A;  4NHF A;  1RHL A;  1BRS A;  1UCI A;  3STD A;  3S27 A;  2CX0 A;  2CWV A;  1FZU A;  4PEJ A;  3U97 A;  1WQL B;  2KAA A;  1RRH A;  3B8L A;  1F8N A;  2HMN B;  2RFR A;  1B2M A;  3PXM A;  2CHC A;  3S28 A;  4KVH A;  1OHP A;  1RGK A;  2SBL A;  1BRK A;  3LTA A;  3CXC 2;  1Q7Y 4;  4FCM A;  1BRJ A;  1MGW A;  2GU3 A;  1SII A;  1HU9 A;  1RRL A;  3Q2P A;  4JF8 A;  5AEW B;  1D6Y A;  1DVD A;  1W02 A;  1QAF A;  5M19 A;  2KF3 A;  2UUG C;  3MKI A;  1OGZ A;  3GZY B;  1FGO A;  3CCL 3;  2W56 B;  2OWP A;  3A5E A;  4GL6 A;  1RCL A;  3GSP A;  1VQL 3;  3FG3 A;  1W4N A;  2CC3 A;  3URP A;  1LOY A;  4L8O A;  1T5Y A;  2QIY A;  1FUW A;  1I3F A;  1Q42 A;  1IQX A;  3EN1 B;  4BU4 A;  2XGN A;  4MEI A;  1BNF A;  3LT8 A;  4TX4 A;  6STD A;  3CNX A;  1W00 A;  1VQM 3;  3FZW A;  2L4V A;  1CYU A;  2R4I A;  5LC6 A;  1SJW A;  1M1K 4;  3LXU X;  5D82 A;  4EV2 A;  3FKA A;  3O8Y A;  1OPY A;  1B2X A;  2STD A;  3KSE D;  2MF7 A;  4O02 B;  2AAD A;  3EF8 A;  2F56 A;  1B2U A;  5KP1 A;  8RNT A;  5KP4 A;  1SAR A;  3MG3 A;  2XGL A;  3IMA B;  7STD A;  4HYZ A;  5FGO A;  1RGG A;  1YIJ 3;  1Y4K A;  3M8C A;  1VQ5 3;  1IU7 A;  3HIG A;  3DH2 A;  5D83 A;  1A2K A;  3RGR A;  2UX0 A;  3BLZ A;  3SXX A;  3BND A;  1O7N B;  2GEY A;  1LOX A;  2IUK A;  3AMO B;  3NUV A;  2BIR A;  3EX9 A;  1C7H A;  1SIH A;  3K7C A;  4XB5 A;  4BIR A;  2SAR A;  6RNT A;  1B20 A;  3JUO A;  1JB2 A;  3NM2 A;  3CU3 A;  1BRH A;  1W6G A;  1YI2 3;  2FGT A;  1IV9 A;  3EJV A;  3WOE B;  1GY7 A;  3FG4 A;  3Q90 A;  2PNC A;  2CK3 H;  1JZD A;  1UCK A;  3CCS 3;  2WGQ A;  1JN5 A;  1STF I;  3NX0 A;  5G1L A;  1J2B A;  2KXG A;  2O9U X;  3WHO A;  1RNB A;  3WOF B;  3S5C A;  4KFD A;  1G02 A;  1LRA A;  2H0I A;  5AII A;  2OCT A;  3F7X A;  3SYU A;  3FGY A;  3G8Z A;  1Q86 4;  1OCV A;  1TRQ A;  1TU5 A;  1EA2 A;  5CXO A;  1ULI B;  1BNJ A;  1A2V A;  1FUS A;  1K28 A;  3L0R A;  4O2H A;  5M1A A;  1IK3 A;  1BGS A;  4FR9 A;  4R9K A;  4AEQ A;  2XSO B;  3KE7 A;  1OHS A;  2O3O A;  3LTD A;  5EVH A;  1T2H A;  1W2B 2;  1GD3 A;  1OHO A;  1W6Y A;  2CWU A;  3GRD A;  3ZFZ A;  3D79 A;  3EQQ B;  1BAO A;  3H3H A;  2I9W A;  2B1X B;  2BU4 A;  4R4K A;  1O7H B;  2PZV A;  1A90 A;  3MPH A;  5AYS C;  2W6J H;  1FUT A;  2KCD A;  1UI7 A;  3JUN A;  4N3V A;  1QJG A;  1E3V A;  3DGO A;  4EXR A;  1FYS A;  1O7P B;  3IPT A;  4J5G A;  2GU1 A;  3Q1C A;  4DKI A;  3K9M C;  4IIA A;  3OW2 2;  3LH4 A;  1US1 A;  4FMC A;  4AKY A;  1L5G B;  1O7M B;  3NM7 A;  5IEO A;  3FF0 A;  1ZX2 A;  1A67 A;  5M18 A;  4HM4 B;  1M90 4;  1NB5 I;  3HZP A;  1TUH A;  3D4A A;  2C11 A;  1YGW A;  3CPO A;  5TGN A;  2HMK B;  3SOA A;  1EQK A;  3QRD A;  1NWW A;  1UCJ A;  1TTO A;  3MWZ A;  4LMI A;  4CPK A;  3CME 3;  1O7G B;  2XFT A;  3CCJ 3;  3G16 A;  1SPU A;  3NQY A;  2OQE C;  4G1M B;  2F5M A;  4NPB A;  1AVL A;  1BRI A;  1ASK A;  4J9A A;  1BSB A;  1CH0 A;  3ER7 A;  3EC9 A;  4Q53 A;  2OQE A;  4CCV A;  1RDS A;  1RSN A;  1NDO B;  3NBJ A;  3JUQ A;  4KT3 B;  5EQL A;  3X40 A;  2P09 A;  3S29 A;  1EUI C;  1E3R A;  1TIJ A;  4HM1 B;  3FLJ A;  3FH1 A;  1G96 A;  1K41 A;  1BVI A;  4L8P A;  1QAK A;  3EBT A;  3X41 A;  1R4Y A;  3FSD A;  4GSP A;  4HKV B;  1JKG B;  3KII A;  3GZX B;  1FW7 A;  1R4C A;  1MWS A;  4BL3 A;  1IVW A;  1YHQ 3;  3DGM A;  3LYG A;  1BSD A;  1HKX A;  1YVS A;  1RCK A;  1U8C B;  1YNV X;  2Z6B A;  1D6Z A;  3AGN A;  3GWR A;  3LT9 A;  1ISK A;  5EEO A;  4OK0 A;  4R80 A;  3I55 3;  2BMO B;  1MOL A;  1B2S A;  4OUQ A;  5STD A;  4WFO A;  1I70 A;  1I2F A;  3EBY A;  3CCQ 3;  3V92 A;  1JZO A;  1N8R 4;  4AKZ A;  1IVU A;  4K1U A;  1AV4 A;  4NRE A;  3J7Y d;  7GSP A;  3PCS A;  1I0X A;  2W0Q A;  3EB8 A;  3VSY A;  1BNS A;  1QVG 2;  3DUK A;  1KD1 4;  1DE3 A;  3NXJ A;  1YJ9 3;  1GS3 A;  3UB1 A;  5IG4 A;  1BRG A;  1RGH A;  2OOV C;  3N54 B;  2OOV A;  2CW9 A;  1GOU A;  4MMZ B;  4XDW A;  1GSP A;  1G0T A;  1ZGX A;  2K0M A;  5AI1 A;  1UCL A;  1WNH A;  4LZI A;  3WDG B;  2HMM B;  3B4O A;  1QVF 2;  1FGR A;  2F4Y A;  1UI8 A;  1BRN L;  4O8S A;  8CHO A;  3BNC A;  2W2C A;  3DM8 A;  2INX A;  3X3Z A;  4ORL A;  3OX9 A;  3G6E 3;  3N9H A;  1NO3 A;  2GBX B;  3NBB A;  2IUJ A;  2XRX B;  3PCR A;  3NV0 B;  2M7O A;  2CWT A;  3MSO A;  4I5Q A;  2A15 A;  1E97 A;  3HK4 A;  2CG0 A;  2WOF A;  2CIU A;  3GZB A;  3MG2 A;  3HOH A;  1I2E A;  3DXO A;  4EYC A;  2ZL8 A;  2JQ5 A;  3ECF A;  3HX8 A;  1X1X A;  3E99 A;  3LTC A;  4XDV A;  3FG1 A;  4ILF A;  2RNT A;  2H0G A;  2WGO A;  5CF2 A;  3CC2 3;  4HJL B;  1LVN A;  1RTU A;  1FGQ A;  3GZR A;  4LSO A;  2CH9 A;  2Z77 A;  1JBR A;  1B2Z A;  2HMJ B;  5DRE A;  1V58 A;  3LZA A;  1JJ2 2;  1TP6 A;  1WMO A;  2QEX 3;  4IPB A;  1W5Z A;  1CEW I;  4HVN A;  4X2O A;  4WHA A;  3U1W A;  1JBS A;  1M1X B;  1VQP 3;  2ZDJ A;  1BSA A;  1RLS A;  1EG9 B;  1RN7 A;  2CX1 A;  3EHC A;  4XBT A;  4N6O B;  1VQN 3;  1GYB A;  1FGM A;  2F98 A;  1N5H A;  4RNZ A;  3NQZ A;  1TRP A;  1YJW 3;  1OUN A;  1W01 A;  5HGR A;  3GAX A;  1KC8 4;  1B27 A;  5AIH A;  2B24 B;  1W6C A;  3JUP A;  2L1S A;  3RGA A;  1LNH A;  4MMX B;  5BU4 A;  3PYJ A;  1X1Y A;  5CLK A;  1RGF A;  2RBI A;  2V1L A;  5AYR B;  3RDE A;  1I2G A;  2IA7 A;  1Q82 4;  4BTW A;  1RGL A;  1S5A A;  3PZW A;  1Q40 A;  2E2V A;  3F9S A;  4FCZ A;  4IT7 A;  1S72 3;  1RN1 A;  1N5P A;  4L7K A;  4HM6 B;  4HZB B;  1V74 A;  2Z7A A;  2KF6 A;  4HOH A;  1N9E A;  2HML B;  1ZS7 A;  1DYU A;  3CCR 3;  2RGQ A;  2F5W A;  3OXA A;  3OWY A;  5IG0 A;  3BNE A;  1AR0 A;  3BB9 A;  1JN5 B;  3SLU A;  1FA3 A;  2BMR B;  2F86 B;  2GXF A;  1HZ1 A;  3S67 A;  3B7C A;  5IEN A;  1DET A;  1OF5 A;  2XF3 A;  4WYK A;  3X3X A;  1RGC A;  2BT3 A;  4O3V A;  3CNM A;  3F14 A;  1GMR A;  2Y73 A;  3BNB A;  1NNV A;  5CK6 A;  5DRV A;  3UL6 A;  5IW9 A;  1CQS A;  2ZA4 A;  4HM3 B;  5IF6 A;  2RSX A;  2Q07 A;  2XR8 B;  4J5K A;  1VQ4 3;  5G1K A;  5BVB A;  2LQV A;  1K73 4;  1BUQ A;  1BIR A;  1IVV A;  3F7S A;  1BNI A;  4GHO A;  1LOW A;  2D1W A;  2K54 A;  2D42 A;  2R41 A;  3VGN A;  1YIT 3;  2Z76 A;  1WMN A;  2GSP A;  3KZT A;  2KF5 A;  1IQ8 A;  1AY7 A;  1QAL A;  1KSI A;  3BIR A;  1I0V A;  3Q3F A;  1RNT A;  5GSP A;  1VQ8 3;  1LQG C;  3NBR A;  1RMS A;  4HM2 B;  1GD4 A;  4HZ9 B;  3CCE 3;  2YFL B;  1GMQ A;  4JRF A;  1B21 A;  1IVX A;  5FW5 A;  2W03 A;  1UDI I;  4CDL A;  1D6U A;  3G0K A;  2W56 A;  3OWS A;  1KQS 2;  4KZ1 A;  1BAN A;  3T8N A;  2W9P A;  2YX9 A;  2XSH B;  1BUJ A;  1MWU A;  3KCH A;  3LML A;  5AIG A;  1IDP A;  1GMP A;  2CKF B;  1RGA A;  2KF4 A;  4GB5 A;  5G2G A;  1YVB I;  5ELU A;  1GY6 A;  4N6T A;  4EBG A;  1MWT A;  1V57 A;  3WR2 A;  3ROB A;  1VZZ A;  1NB3 I;  2FNQ A;  3UL5 A;  5IG5 A;  2HOH A;  1VQ6 3;  2BHM A;  2BNG A;  3T0U A;  2WO0 A;  6GSP A;  2IY2 A;  1K9M 4;  1LXE A;  1STD A;  4LEH A;  2P0X A;  5BXQ A;  3I56 3;  1BNG A;  2P38 A;  2J8X B;  2YFJ B;  4BTY A;  1B3S A;  2AAE A;  2ZHX B;  1K8A 4;  3X42 A;  3DY5 A;  1BNE A;  3QK9 A;  7RNT A;  3PGB A;  5AEU B;  2OTJ 3;  1Q7H A;  3NV0 A;  1GOY A;  4RNT A;  3G71 3;  1BOX A;  1PY3 A;  3SX1 A;  2MC8 A;  3T8U A;  5ELJ A;  5KP3 A;  1ROV A;  4EV5 A;  4KFF A;  1JRQ A;  1KWI A;  4K1V A;  4N6L A;  3AMO A;  1MNL A;  5AIF A;  2F99 A;  4I4K A;  4HM8 B;  3K63 A;  1ULJ B;  3CPW 2;  3PS8 A;  1QMA A;  1UW1 A;  3CMA 3;  1O7W B;  4KFE A;  4R1K A;  3LTB A;  3A76 A;  4BL2 A;  1JB5 A;  3HII A;  1GY5 A;  2CFW A;  1EEJ A;  2LYX A;  3NHX A;  1DMM A;  2P05 A;  5IG3 A;  2P0M A;  5IEP A;  1T3B A;  2HMO B;  2WOH A;  3KN4 A;  3ALA A;  3BU4 A;  1UGI A;  4HBR A;  1IV7 A;  4X2H A;  3SVA A;  3D5I A;  5CF1 A;  3KSP A;  1UGH I;  1WMP A;  3SED A;  4FMD A;  1A2P A;  1CYV A;  4LYL B;  1LOV A;  3MYT A;  4HM7 B;  1TFO A;  1ROA A;  2C10 A;  1Q9E A;  4MJD A;  5JPU A;  3FCS B;  3HI7 A;  3UJM A;  3ZG0 A;  1VQ9 3;  1DVC A;  4CJN A;  4J8T A;  4RZM A;  4FCJ A;  3FF2 A;  3N8B A;  3KKG A;  3WMD A;  3IJE B;  1AQZ A;  2Y74 A;  3V98 A;  1BSE A;  1Z1S A;  4RNY A;  1W2Z A;  3DGN A;  1N9J A;  3OWU A;  3MHE A;  3I0Y A;  3F8X A;  2GBW B;  2QGU A;  4FMB A;  9RNT A;  2XH9 A;  2CFL A;  4HM5 B;  1JV2 B;  4N6M A;  2ML6 A;  3DGL A;  4LGQ A;  1N8Q A;  3AGO A;  1IT8 A;  2K3D A;  1HYF A;  3H51 A;  4H3U A;  1VQK 3;  1PYL A;  2GEX A;  3AHS A;  3F8H A;  3UNL A;  1GOV A;  1FGT A;  3ZG5 A;  1DMN A;  3EN8 A;  4WWU C;  4N6U A;  2XFS A;  2CFG A;  4XM4 A;  5IER A;  1X1U A;  1DMQ A;  1X1W A;  2CFD A;  5JBS A;  1VQO 3;  1OAC A;  4N6V 0;  4K61 A;  4OVM A;  1LNI A;  3D9R A;  4XBY A;  1TFK A; 
#chains in the Genus database with same CATH homology
 2W9Q A;  4RBN A;  2OTL 3;  1IQY A;  3DZL A;  3EE1 A;  3X3Y A;  3CCU 3;  4EC6 A;  3WOD G;  4R9L A;  3K0Z A;  1YJN 3;  1RKY A;  2W04 A;  5D81 A;  3VF1 A;  1PFP A;  3D3L A;  3JVC A;  1JNQ A;  3SOY A;  4BTX A;  2E2T A;  2JDI H;  1EKM A;  5A0O B;  2E2U A;  1OH0 A;  1SQW A;  3DMC A;  1W7C A;  1YGE A;  4U13 A;  1NJI 4;  3JUM A;  1JB4 A;  3CCM 3;  1NU3 A;  2IMJ A;  1UUV B;  3OV4 A;  1WTH A;  4K90 B;  2ML5 A;  1JKG A;  2YFI B;  4MMY B;  3LOY A;  1PU4 A;  1U5O A;  4QWT A;  4XBX A;  1OGX A;  4HM0 B;  3KFQ C;  4H61 A;  2QA4 3;  3CC7 3;  5LC7 A;  1Q40 B;  4WP5 A;  5I97 A;  1IT7 A;  4N6N B;  4STD A;  2BMQ B;  3TDG A;  3CD6 3;  2BO9 B;  4ZM8 A;  4FMA A;  2FXT A;  3WA2 X;  2CFK A;  2CG1 A;  3V99 A;  3CCV 3;  1ZO2 A;  1M9G A;  1UUW B;  3WA3 A;  3K5T A;  1VQ7 3;  3G4S 3;  1OF5 B;  4WYK B;  3F40 A;  1Q81 4;  2RCD A;  3B4P A;  2KRT A;  5JPP A;  1AVK A;  2XEP A;  3MG1 A;  1RJO A;  4NHF A;  3STD A;  3S27 A;  2CWV A;  4PEJ A;  3U97 A;  1WQL B;  1RRH A;  3B8L A;  1F8N A;  2HMN B;  2RFR A;  3PXM A;  2CHC A;  3S28 A;  4KVH A;  1OHP A;  2SBL A;  3LTA A;  3CXC 2;  1Q7Y 4;  4FCM A;  2GU3 A;  1SII A;  1HU9 A;  1RRL A;  3Q2P A;  4JF8 A;  5AEW B;  1D6Y A;  1DVD A;  1W02 A;  1QAF A;  3MKI A;  1OGZ A;  3GZY B;  1FGO A;  3CCL 3;  2W56 B;  2OWP A;  4GL6 A;  1VQL 3;  3FG3 A;  1W4N A;  2CC3 A;  4L8O A;  1T5Y A;  2QIY A;  1FUW A;  1Q42 A;  1IQX A;  3EN1 B;  2XGN A;  4MEI A;  3LT8 A;  4TX4 A;  6STD A;  3CNX A;  1W00 A;  1VQM 3;  3FZW A;  2L4V A;  1CYU A;  2R4I A;  5LC6 A;  1SJW A;  1M1K 4;  3LXU X;  5D82 A;  4EV2 A;  3FKA A;  3O8Y A;  1OPY A;  2STD A;  3KSE D;  2MF7 A;  4O02 B;  3EF8 A;  5KP1 A;  5KP4 A;  3MG3 A;  2XGL A;  3IMA B;  7STD A;  4HYZ A;  5FGO A;  1YIJ 3;  1Y4K A;  3M8C A;  1VQ5 3;  1IU7 A;  3HIG A;  5D83 A;  1A2K A;  3RGR A;  2UX0 A;  3BLZ A;  3SXX A;  3BND A;  1O7N B;  2GEY A;  1LOX A;  2IUK A;  3AMO B;  3NUV A;  3EX9 A;  5AEU B;  1C7H A;  1SIH A;  3K7C A;  4XB5 A;  3JUO A;  1JB2 A;  3NM2 A;  3CU3 A;  1W6G A;  1YI2 3;  2FGT A;  1IV9 A;  3EJV A;  3WOE B;  1GY7 A;  3FG4 A;  3Q90 A;  2PNC A;  2CK3 H;  3CCS 3;  2WGQ A;  1JN5 A;  1STF I;  3NX0 A;  1J2B A;  2KXG A;  2O9U X;  3WOF B;  3S5C A;  4KFD A;  5AII A;  2OCT A;  3F7X A;  3FGY A;  3G8Z A;  1Q86 4;  1OCV A;  1TU5 A;  1EA2 A;  5CXO A;  1ULI B;  1A2V A;  1K28 A;  3L0R A;  4O2H A;  1IK3 A;  4FR9 A;  4R9K A;  4AEQ A;  2XSO B;  3KE7 A;  1OHS A;  2O3O A;  3LTD A;  5EVH A;  1W2B 2;  1GD3 A;  1OHO A;  1W6Y A;  2CWU A;  3GRD A;  3EQQ B;  3H3H A;  2I9W A;  2B1X B;  4R4K A;  1O7H B;  2PZV A;  1A90 A;  3MPH A;  5AYS C;  2W6J H;  2KCD A;  1UI7 A;  3JUN A;  4N3V A;  1QJG A;  1E3V A;  3DGO A;  4EXR A;  1O7P B;  3IPT A;  2GU1 A;  3Q1C A;  3K9M C;  4IIA A;  3OW2 2;  3LH4 A;  1US1 A;  4FMC A;  4AKY A;  1L5G B;  1O7M B;  3NM7 A;  5IEO A;  3FF0 A;  1ZX2 A;  1A67 A;  1M90 4;  4HM4 B;  1NB5 I;  3HZP A;  1TUH A;  2C11 A;  3CPO A;  5TGN A;  2HMK B;  3SOA A;  1EQK A;  3QRD A;  1NWW A;  3MWZ A;  4LMI A;  3CME 3;  1O7G B;  2XFT A;  3CCJ 3;  3G16 A;  1SPU A;  3NQY A;  2OQE C;  4G1M B;  5ELU A;  1AVL A;  4CCV A;  1ASK A;  4J9A A;  2OQE A;  4Q53 A;  3ER7 A;  3EC9 A;  1QVG 2;  3CC4 3;  1NDO B;  3NBJ A;  3JUQ A;  5EQL A;  3X40 A;  2P09 A;  3S29 A;  1E3R A;  1TIJ A;  4HM1 B;  3FLJ A;  3FH1 A;  1G96 A;  1K41 A;  4L8P A;  1QAK A;  3EBT A;  3X41 A;  3FSD A;  4HKV B;  1JKG B;  3KII A;  3GZX B;  1R4C A;  1IVW A;  1YHQ 3;  3DGM A;  3LYG A;  1HKX A;  1U8C B;  3GWR A;  2Z6B A;  1D6Z A;  3LT9 A;  1ISK A;  5EEO A;  4OK0 A;  4R80 A;  3I55 3;  2BMO B;  1MOL A;  4OUQ A;  5STD A;  4WFO A;  3EBY A;  3CCQ 3;  3V92 A;  1N8R 4;  4AKZ A;  1IVU A;  4K1U A;  1AV4 A;  4NRE A;  3J7Y d;  3PCS A;  2W0Q A;  3EB8 A;  3VSY A;  3DUK A;  1KD1 4;  3NXJ A;  1YJ9 3;  1GS3 A;  3UB1 A;  5IG4 A;  2OOV C;  3N54 B;  2OOV A;  2CW9 A;  4MMZ B;  4XDW A;  2K0M A;  5AI1 A;  1WNH A;  4LZI A;  3WDG B;  2HMM B;  3B4O A;  1QVF 2;  1FGR A;  1UI8 A;  4O8S A;  8CHO A;  3BNC A;  2W2C A;  3DM8 A;  2INX A;  3X3Z A;  4ORL A;  3OX9 A;  3G6E 3;  3N9H A;  1NO3 A;  2GBX B;  3NBB A;  2IUJ A;  2XRX B;  3PCR A;  3NV0 B;  2M7O A;  2CWT A;  3MSO A;  1E97 A;  2A15 A;  3HK4 A;  2CG0 A;  2WOF A;  2CIU A;  3GZB A;  3MG2 A;  3DXO A;  4EYC A;  2ZL8 A;  2JQ5 A;  3ECF A;  3HX8 A;  3LTC A;  3E99 A;  4XDV A;  3FG1 A;  2WGO A;  5CF2 A;  3CC2 3;  4HJL B;  1LVN A;  1FGQ A;  3GZR A;  4LSO A;  2CH9 A;  2Z77 A;  5DRE A;  2HMJ B;  3LZA A;  1JJ2 2;  1TP6 A;  1WMO A;  2QEX 3;  4IPB A;  1W5Z A;  1CEW I;  4HVN A;  4X2O A;  4WHA A;  3U1W A;  1M1X B;  1VQP 3;  2ZDJ A;  1EG9 B;  1RN7 A;  3EHC A;  4XBT A;  4N6O B;  1VQN 3;  1GYB A;  1FGM A;  2F98 A;  1N5H A;  4RNZ A;  3NQZ A;  1YJW 3;  1OUN A;  1W01 A;  5HGR A;  3GAX A;  1KC8 4;  5AIH A;  3RGA A;  2B24 B;  1W6C A;  3JUP A;  1LNH A;  4MMX B;  3PYJ A;  5CLK A;  3RDE A;  1Q82 4;  2V1L A;  5AYR B;  2IA7 A;  4BTW A;  1S5A A;  3PZW A;  4IT7 A;  1Q40 A;  2E2V A;  3F9S A;  4FCZ A;  1S72 3;  1N5P A;  4L7K A;  4HM6 B;  4HZB B;  1V74 A;  2Z7A A;  1N9E A;  2HML B;  1DYU A;  3CCR 3;  2RGQ A;  3OXA A;  3OWY A;  5IG0 A;  3BNE A;  1AR0 A;  3BB9 A;  1JN5 B;  3SLU A;  1FA3 A;  2BMR B;  2F86 B;  2GXF A;  3S67 A;  3B7C A;  5IEN A;  1OF5 A;  4WYK A;  2XF3 A;  3X3X A;  2BT3 A;  4O3V A;  3CNM A;  3F14 A;  2Y73 A;  5CK6 A;  3BNB A;  3UL6 A;  5DRV A;  5IW9 A;  1CQS A;  4HM3 B;  5IF6 A;  2RSX A;  2Q07 A;  2XR8 B;  1VQ4 3;  5BVB A;  2LQV A;  1K73 4;  1BUQ A;  1IVV A;  3F7S A;  2D1W A;  2K54 A;  2D42 A;  1YIT 3;  3VGN A;  2Z76 A;  1WMN A;  3KZT A;  1IQ8 A;  1QAL A;  1KSI A;  1VQ8 3;  3NBR A;  4HM2 B;  4HZ9 B;  1GD4 A;  3CCE 3;  2YFL B;  4JRF A;  1IVX A;  5FW5 A;  2W03 A;  4CDL A;  1D6U A;  3G0K A;  2W56 A;  3OWS A;  1KQS 2;  4KZ1 A;  3T8N A;  2W9P A;  2YX9 A;  2XSH B;  3LML A;  5AIG A;  1IDP A;  2CKF B;  4GB5 A;  5G2G A;  4EBG A;  1YVB I;  1GY6 A;  4N6T A;  3ROB A;  1VZZ A;  1NB3 I;  2FNQ A;  3UL5 A;  5IG5 A;  1VQ6 3;  2BHM A;  2BNG A;  3T0U A;  2WO0 A;  1K9M 4;  1LXE A;  1STD A;  4LEH A;  2P0X A;  5BXQ A;  3I56 3;  2P38 A;  2YFJ B;  4BTY A;  1K8A 4;  3X42 A;  3DY5 A;  3QK9 A;  3PGB A;  2OTJ 3;  3NV0 A;  3G71 3;  3SX1 A;  2MC8 A;  3T8U A;  5ELJ A;  5KP3 A;  1ROV A;  4EV5 A;  4KFF A;  1JRQ A;  1KWI A;  4K1V A;  4N6L A;  3AMO A;  1MNL A;  5AIF A;  2F99 A;  4I4K A;  4HM8 B;  3K63 A;  1ULJ B;  3CPW 2;  3PS8 A;  1QMA A;  1UW1 A;  3CMA 3;  1O7W B;  4KFE A;  4R1K A;  3LTB A;  3A76 A;  1JB5 A;  3HII A;  1GY5 A;  2CFW A;  2LYX A;  3NHX A;  5IG3 A;  1DMM A;  2P05 A;  5IEP A;  2P0M A;  2HMO B;  2WOH A;  3KN4 A;  3ALA A;  4HBR A;  1IV7 A;  4X2H A;  3SVA A;  5CF1 A;  3KSP A;  1WMP A;  3SED A;  4FMD A;  1CYV A;  3MYT A;  4HM7 B;  1TFO A;  1ROA A;  2C10 A;  4MJD A;  5JPU A;  3FCS B;  3HI7 A;  3UJM A;  1VQ9 3;  1DVC A;  4J8T A;  4RZM A;  4FCJ A;  3FF2 A;  3N8B A;  3KKG A;  3WMD A;  3IJE B;  2Y74 A;  3V98 A;  1Z1S A;  4RNY A;  1W2Z A;  3DGN A;  1N9J A;  3OWU A;  3MHE A;  3I0Y A;  3F8X A;  2GBW B;  2QGU A;  4FMB A;  2XH9 A;  2CFL A;  4HM5 B;  1JV2 B;  4N6M A;  2ML6 A;  3DGL A;  4LGQ A;  1N8Q A;  1IT8 A;  3H51 A;  4H3U A;  1VQK 3;  2GEX A;  3F8H A;  3UNL A;  1FGT A;  1DMN A;  3EN8 A;  4WWU C;  4N6U A;  2XFS A;  2CFG A;  4XM4 A;  5IER A;  1DMQ A;  2CFD A;  5JBS A;  1VQO 3;  1OAC A;  4N6V 0;  4K61 A;  4OVM A;  3D9R A;  4XBY A;  1TFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...